CLUSTAL format seed alignment for MF_02076

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYE_CENSY             ------------------------------------------------------------
C7DHS0_MICA2          ------------------------------------------------------------
SYE_PYRAB             ------------------------------------------------------------
SYE_THEON             ------------------------------------------------------------
SYE_PYRAE             ------------------------------------------------------------
SYE_CALMQ             ------------------------------------------------------------
SYE_METM7             ------------------------------------------------------------
SYE_METM5             ------------------------------------------------------------
SYE_METJA             ------------------------------------------------------------
SYE_METMJ             ------------------------------------------------------------
SYE_METHJ             ------------------------------------------------------------
SYE_THEVO             ------------------------------------------------------------
SYE_HALS3             ------------------------------------------------------------
A0A075IDQ0_9EURY      ------------------------------------------------------------
SYE_METAC             ------------------------------------------------------------
SYE_ARCFU             ------------------------------------------------------------
SYE_NANEQ             ------------------------------------------------------------
A0A0B3B0B9_ARCG9      ------------------------------------------------------------
D2EFI4_9ZZZZ          ------------------------------------------------------------
SYEC_SCHPO            -------------------------MSVSVALKAKPIAYGAVACANYVNLSGAGSISVKY
V6R1K4_GIBZE          ------------------------------------------------------------
SYEC_YEAST            -----------------------MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKL
SYEC_ARATH            ----------------------MDGMKLSFPPESPPLSVIVALSLSASPVTIDSSAAATT
SYEC_DICDI            ------------------MSKAKDTGILRFDDTPLAATFPLVAIITSKVVGGVKIVGRKG
SYEC_ENCCU            ------------------------------------MDGKSEFKEELINYILLKKYGKGA
SYEC_NOSCE            -----------------------------------------MAVENAINFREICSLLDIS
SYEC_ENTBH            -------------------------------------MLENISKSEFVNFLLEKKHNIEP
Q7RKL0_PLAYO          MIKDSKINIYYGKNYPFLCRTVFNIYQNNIKKKTANNLNDKKIEEICVNFINDKTIVEDI
                                                                                  

SYE_CENSY             ----------------------------------------------MSDIAGEARKIALQ
C7DHS0_MICA2          ----------------------------------------------MDETTLSAIRKYAV
SYE_PYRAB             -----------------------------------------------MEVERIALKYALI
SYE_THEON             -----------------------------------------------MNVEELIMKYALI
SYE_PYRAE             -----------------------------------------------MNVEEIAFKYALA
SYE_CALMQ             ---------------------------------------------MENAVRDLALKHALI
SYE_METM7             -------------------------------------------------MKDTVMAYLLE
SYE_METM5             -------------------------------------------------MKDTVMAYLLE
SYE_METJA             -------------------------------------------------MEEKILPIALR
SYE_METMJ             ---------------------------------------------MDGDIEHLLFIYALQ
SYE_METHJ             ----------------------------------------------MDDVRSVLLIAALS
SYE_THEVO             ------------------------------------------------MYEEEIKKIALL
SYE_HALS3             -----------------------------------------MDDELRERVRRAAERAALF
A0A075IDQ0_9EURY      ---------------------------------------MADSDDWDSDIVAAVRKYALQ
SYE_METAC             -------------------------------------------MTLSPEDLKTIEKYALQ
SYE_ARCFU             -------------------------------------------------MKEVIMKYVVQ
SYE_NANEQ             -----------------------------------------------------MYKEIIA
A0A0B3B0B9_ARCG9      -------------------------------------------------MKELVLKYALQ
D2EFI4_9ZZZZ          -----------------------------------------------MIDEETIKKAAIK
SYEC_SCHPO            EDVALLDKQNKESNVSIQLNGSDSPVFGSKLALQTFSQVYPKLFIGEN--DRSLVESWVE
V6R1K4_GIBZE          ----------------------------------------------------------MT
SYEC_YEAST            VDDKKAPAAKLDDATEDVFNKITS---------------KFAAIFDNG--DKEQVAKWVN
SYEC_ARATH            VPSFVFSDGRKLNGATVLLRYVGR------------SAKKLPDFYGNNAFDSSQIDEWVD
SYEC_DICDI            LDSTEFSIVGTQDSLKGSYVIAKYLA----------RTTPSLSLYGENALSASKIDEFID
SYEC_ENCCU            QDPPVYSNALKKAPQEMFPPGLVDAL-------------DSYSINLSRSEGVEFLVLLNS
SYEC_NOSCE            ESYKCTINAFLDNVEKCTDKHYNDAL-------------NLLDTFFSNE------VKSNS
SYEC_ENTBH            KTLPILEQHIRE--QKLDDFFLDFSI-------------DFTDEELNNFLSKLDYWLKNT
Q7RKL0_PLAYO          KIEFVKNSVADESRKNVNTNNSVISS-------------DKIFAINLDFLLKTNLYYFTS
                                                                                  

SYE_CENSY             NAVSHGGRAREGAVLAGLLGARPELRPKAG------------------------------
C7DHS0_MICA2          KNAHQYGKADASSVFSKVIAVVPDAKKDIS------------------------------
SYE_PYRAB             NAIEHGGKANPKAVIGKVLGENPELRSKAR------------------------------
SYE_THEON             NAISHKGKANPKAVIGKVLGENPELRPKAK------------------------------
SYE_PYRAE             NAVKYGGKADVKAVMAKLMAEVPELRARAR------------------------------
SYE_CALMQ             NAVKFNGKADVKAVVSKIFADNPELRGNAK------------------------------
SYE_METM7             NSIKFKGKPNPKAAMGKILGENPDLRSNVK------------------------------
SYE_METM5             NSIKFKGKPNPKAAMGKILGENPDLRSKVK------------------------------
SYE_METJA             NAIKYNGKANPKAVLGIFLSENPEYRSKAK------------------------------
SYE_METMJ             NAVKHDSAPKSGTVIGTVLGKHPEFRSRAR------------------------------
SYE_METHJ             NAVKHKSVPAAGAVMGAILGTHPELRSKAG------------------------------
SYE_THEVO             NAYQHNGKAELKSVIGKVMAEIADLRKNPK------------------------------
SYE_HALS3             NALKHGSDAQVGAIMGPMMGEHPDFRAHGD------------------------------
A0A075IDQ0_9EURY      NAVEYTGQGQAGSVLGRLLSEREDLRSMAK------------------------------
SYE_METAC             NAVKYEKAPQSKAVMGKVMGECPQLRANPG------------------------------
SYE_ARCFU             NAAKYGKASE-KAVMGKVMAENPELRKKAK------------------------------
SYE_NANEQ             YLKLKYGKVKPQSVIGKIIAKNPELKAKIK------------------------------
A0A0B3B0B9_ARCG9      NAVKFNGKADPGALIGKVLGENPELKNKLN------------------------------
D2EFI4_9ZZZZ          NAATHEGSARVGSVISEMLGKDKNLVNQMG------------------------------
SYEC_SCHPO            TASALAGNHNFLELSSLLAQLDDHLIMRSL------------------------------
V6R1K4_GIBZE          FDAEKIGAADFKSLGPLVAELDKHLTLRTY------------------------------
SYEC_YEAST            LAQKELVIKNFAKLSQSLETLDSQLNLRTFI-----------------------------
SYEC_ARATH            YASVFSSGSEFEN---ACGRVDKYLESSTF------------------------------
SYEC_DICDI            KFAHLKS----EKFNEFLKEMNEYLTLRAF------------------------------
SYEC_ENCCU            LVNDIRSEEVKDIIFGMINTNQMLTKLMK-------------------------------
SYEC_NOSCE            LVNDL--------IFCIINSNFDFLKVFK-------------------------------
SYEC_ENTBH            KLNSSK----ADVIFGLLYSCNKFIKLIK-------------------------------
Q7RKL0_PLAYO          YRENINKNIITNVFFQAQYNEWIDFLRNKDIEKNIIPICEHINKHLYLNTFLSFHYLTLS
                                                                                  

SYE_CENSY             ----------------ELMEEISDIVAGINAMPE-SKQR-------EELGDVPVERKKQE
C7DHS0_MICA2          ----------------GLRKAVQDAVNEVNAMSP-AELQSSYESYAEEFSEEQKSKVEQT
SYE_PYRAB             ----------------EIVPIINKVVEEVNSLSL-DEQKAKLMEIYPEYFEKKE---EKK
SYE_THEON             ----------------EIIPLVNQIVEQVNGMDI-EEQEAKLKEIYPEFFEAKK---EKK
SYE_PYRAE             ----------------EVKQIVDAVVARVNSMPL-EEQRRILRERWPELLEERR-AEQRR
SYE_CALMQ             ----------------QVVEVVKEVVNYVNSLTL-DEQRRILEEKWPEALGARRTVEEKR
SYE_METM7             ----------------ELNEVISEVVKEIESMSL-EEQQAKLDELAPEGLGQKTERKRKE
SYE_METM5             ----------------EVNQVISEVVKEIETMSL-EEQQAKLDELAPEGLGQKTERKRKE
SYE_METJA             ----------------EVMPIVEKVVEEVNKLSL-DEIKKKLEELGEDVK--KKEKKEKG
SYE_METMJ             ----------------ELGPLAGKAVAQVGKMSA-ADRKSRLEALAPELLAELTETHEHV
SYE_METHJ             ----------------EIKGLLGSVLEEVSSLSA-EDREEKLKTIAPDQYASLFEKKEKK
SYE_THEVO             ----------------LVSELAKAAVDSVNSMSK-DDIVNIVEKQFPEALKKDKKPEEHR
SYE_HALS3             ----------------EIPGVIAPVIEDVNGMSD-DEQRARLAELAPEDVEELD--SEDE
A0A075IDQ0_9EURY      ----------------QLRNLVETEVVAANSLAESNGIEYVREELARTAPEALE--REKH
SYE_METAC             ----------------AVSTALKSIVSEIAKGNP-EAWKTRLSEIAPELIEALN--VKKE
SYE_ARCFU             ----------------EVLELVKECITEFEALSE-EVRKELIKKYS---MDSEA--KREL
SYE_NANEQ             ----------------ELIPIIEQEIKEVEQMDI--EQIKELAKAYEQTIEKKE------
A0A0B3B0B9_ARCG9      ----------------EIKKEIMSIVEEVNSMKP-EEQLKKLQKLAPELLEEKKVEKKE-
D2EFI4_9ZZZZ          ----------------ELKIITEKVVKEVNALKK-EEILKLATDMNLLSTKEKQPEKKE-
SYEC_SCHPO            -----FVGYSLTSADFSIWGALK-SNNMAAGAVR-TGQYFNLARWYKFMDSQ-------N
V6R1K4_GIBZE          -----LNGYTLSEEDGKIWTALR-TNKVAIGLVR-KGAYTNITRWFKLIEE---------
SYEC_YEAST            -----LGGLKYSAADVACWGALR-SNGMCGSIIK-NKVDVNVSRWYTLLEMDPIFGEAHD
SYEC_ARATH            -----LVGHSLSIADVAIWSALAGTGQRWESLRK-SKKYQSLVRWFNSILDEYSEVLNKV
SYEC_DICDI            -----LIGFNLTLADIVLFARIKMVKEIQEEINKLGKTIPHLNRWYGYLSQLESFVEADN
SYEC_ENCCU            --------------DKKEVERFPDTCKMYSEQFKANKPLLKEFNAGSRKEQGNLEIGEP-
SYEC_NOSCE            --------------SNK--LRLENLQIVYESAFNENKPFLKEFSAKDKINK-EVKKNLY-
SYEC_ENTBH            --------------NPT--FSFVEIKQFYNDILNTNKNYIIEYNKKD---KGKINIAV--
Q7RKL0_PLAYO          DIYIYYEMHKYFSGNITTNLKYPKQYKNINRWFKLIKSLLHDHITHDAELVQNLKIKEKI
                                                                                  

SYE_CENSY             GQ-------------------------------------ALPPLEGAIKGRVVTRFPPEP
C7DHS0_MICA2          SK-------------------------------------PKMVIEGAVEGSVVTRYPPEP
SYE_PYRAB             EEK----------------------------------KGLPPLPKAEK-GKVVTRFAPNP
SYE_THEON             EEK----------------------------------KGLPPLPKAEK-GKVVTRFAPNP
SYE_PYRAE             PGL----------------------------------EGLPELPNVR--GGVVVRFAPNP
SYE_CALMQ             GDI----------------------------------ESLPELPDADKLSKLTFRFAPNP
SYE_METM7             I----------------------------------------ELKNVKG--NVVMRFAPNP
SYE_METM5             I----------------------------------------ELKNVKG--NVVMRFAPNP
SYE_METJA             L----------------------------------------ELPNVKD--KVVMRFAPNP
SYE_METMJ             R-------------------------------------KLPDLEGAEN--GVVMRFAPNP
SYE_METHJ             KI------------------------------------GLPDLPKAEG--GVVMRFAPNP
SYE_THEVO             L---------------------------------------PDLQGVNG--HVVMRLAPSP
SYE_HALS3             GDD----------------------------------HALPALPNAEAYDEVRMRCAPNP
A0A075IDQ0_9EURY      RKA----------------------------------EGLRELPGDTS--RVILRFAPNP
SYE_METAC             -PE----------------------------------KGLKPLEGAEP-GKVVMRFAPNP
SYE_ARCFU             -ET----------------------------------KKLPELEGAEK-GKVVMRFAPNP
SYE_NANEQ             -----------------------------------------KDIEIPVKDKVITRFAPNP
A0A0B3B0B9_ARCG9      ----------------------------------------LKELPGAEIGKIVTRMPPEP
D2EFI4_9ZZZZ          ----------------------------------------LKPLPNTAKG-VVLRLPPEP
SYEC_SCHPO            AV-----SVTMEEFTKAVNISKKQKSS---------GPNYEIGLPDAIDGKVVTRFPPEP
V6R1K4_GIBZE          ---------AHPEFNEKLNAGKEKRSG---------GANYNIGLSNTENG-VVTRFPPEP
SYEC_YEAST            FL-----SKSLLELKKSANVGKKKETH---------KANFEIDLPDAKMGEVVTRFPPEP
SYEC_ARATH            LA-----TYVKKGSGKPVAAPKSKDSQQAVKGDGQDKGKPEVDLPEAEIGKVKLRFAPEP
SYEC_DICDI            AFNGKKETKASGKAGAEGTAATTEKVAPQKGAMGWVGNFEALNLPGLVEGKVVTRFPPEP
SYEC_ENCCU            ------------------------------------------------SENVVTRFPPEP
SYEC_NOSCE            ------------------------------------------------STPAVTRFAPEP
SYEC_ENTBH            ------------------------------------------------EGNVVTRFPPEP
Q7RKL0_PLAYO          FNT---TNYGNKKSGNNEDKSSTHPNKSNTKVGGTSLSSYEGKLQNAEKGKVVTRFPPEP
                                                                            * .*.*

SYE_CENSY             NGYPHIGHAKAAIINEEYVTMYGGI-----KILRMDDTNPGAERME------YYAAIKVG
C7DHS0_MICA2          GGYMHIGNAKQCILSDEFAKIYNGK-----IFLYWDDTNPEKCKQE------YVEAMKSD
SYE_PYRAB             DGAFHLGNARAAILSYEYAKMYGGK-----FILRFDDTDPKVKRPE----PIFYEMIIED
SYE_THEON             DGAFHLGNARAAILSHEYARLYGGK-----FILRFDDTDPKVKRPE----PKFYEWIIED
SYE_PYRAE             DFVLHLGSARPAILNYAYRIKYGGK-----FILRFEDTDPRIKSPLVTEEVNAYESIRED
SYE_CALMQ             DFYLHLGSARPAIVNYAYKLKYANKGKDSRFILRFEDTDPRIKRPL----LDAYDAIRED
SYE_METM7             SGPLHIGHARASVLNDFFTKKYNGK-----LVLRLEDTDAKRVLPE------AYEMIQED
SYE_METM5             SGPLHIGHARASVLNDFFTKKYNGK-----LVLRLEDTDAKRVLPE------AYEMIQED
SYE_METJA             SGPLHIGHARAAVLNDYFVKKYGGK-----LILRLEDTDPKRVLPE------AYDMIKED
SYE_METMJ             SGPLHLGHARASILNDYYVRRYGGR-----YVLRVEDTDPKRVDPD------AYAMVLED
SYE_METHJ             SGPLHLGHARAAFLNDEYIRRYGGK-----YILRIEDTDPKRVDPD------AYDMVRED
SYE_THEVO             SGPLHIGHTRMAILNDEYVKRYGGD-----LILRIEDTNPTNIDPE------AYAMIPED
SYE_HALS3             NGPWHVGHARMPSVIGTYKQRYDGS-----FVVRFDDTDPETKRPD----LDAYDQILED
A0A075IDQ0_9EURY      NGPLTLGHSRGVVINSEYAKMYDGK-----VVLRFDDTDTRVKPPL----PDAYGWIEDE
SYE_METAC             NGPGTLGSARGMVVNSEYVKMYKGK-----FVLRFDDTDPDIKRPM----LEAYDWYLDD
SYE_ARCFU             NGPPTLGSARGIIVNGEYAKMYEGK-----YIIRFDDTDPRTKRPM----IEAYEWYLED
SYE_NANEQ             SGLLHIGHARAIVLNHYIAKKYNGQ-----FILRIEDTDPDVKKPM----IEAYELIPKD
A0A0B3B0B9_ARCG9      SKYLHLGHALTFLINYMYAEKYQGK-----CVLRFEDCNPEKVTQE------FIDADLDD
D2EFI4_9ZZZZ          SGYMHWGHALSFTINYLYKEMYNGT-----LWLRFEDTNPNLVKEE------FVK-NFEE
SYEC_SCHPO            SGYLHIGHAKAALLNQYFANKY-----HGKLIVRFDDTNPSKENSE------FQDAILED
V6R1K4_GIBZE          SGYLHIGHAKAALLNDYFAKTSPDG--NGKLIVRFDDTNPAKEKQE------FEDAILHD
SYEC_YEAST            SGYLHIGHAKAALLNQYFAQAY-----KGKLIIRFDDTNPSKEKEE------FQDSILED
SYEC_ARATH            SGYLHIGHAKAALLNKYFAERY-----QGEVIVRFDDTNPAKESNE------FVDNLVKD
SYEC_DICDI            SGYMHIGHCKAAIINNYYAEKY-----NGKIIIRFDDTNPSKEKEE------YVENIIKD
SYEC_ENCCU            NGRLHIGHARAALLNWYFASKG-----NGRLLVRFDDTNPEKEEER------FERGILSD
SYEC_NOSCE            SGCLHIGHLKALLVNYNLAEKS-----NGTLLLRFDDTNPVKNYEK------YEKEILRD
SYEC_ENTBH            SGFLHIGHIKAALLNDLMAK-------NGKLLIRFDDTNPIKEEKM------YENVIIED
Q7RKL0_PLAYO          SGYLHIGHIKAAFLNNYYANIY-----EGKMLLRFDDTNPVLEDVK------FENSIMED
                      .     *      :                  :  :* :.                    

SYE_CENSY             LDWL-GIEYDVIKNTSDDMDLLLSKGRELLESGDAYVCT----CKRDDMSKNRRAMAPCK
C7DHS0_MICA2          LDWL-GIKFSREYFASDYIETMYSKGEELILSGNAYACS----CEEQKIKENRFNRVACE
SYE_PYRAB             LEWL-GIKPDEIVYASDRLELYYKYAEELIKMGKAYVCT----CKPEKFRELRDKGIPCP
SYE_THEON             LKWL-GFQIDEIHIASDRLEIYYKYAEELIKMGKAYVCT----CPPEKFRELRDNGIACP
SYE_PYRAE             LRWL-GVRWDEEYIQSQRMEIYYEHAKKLLEMGAAYVDL----CKPEEWRRLRNEKKACP
SYE_CALMQ             LRWL-GVKWDEEYIQSDRMSIYYEYARKLIENGGAYVVAKGSGCEPDDWKRLKIEGKPCL
SYE_METM7             LKWL-GVKVDEVIVQSERLEIYYEYGRKLIEMGHAYVCD----CDAEEFRNLREQGIPCK
SYE_METM5             LKWL-GVKVDEVIVQSERLETYYEYGRKLIEMGQAYVCD----CDADEFRTLREQGTLCK
SYE_METJA             LDWL-GVKVDEVVIQSDRIELYYEYGRKLIEMGHAYVCD----CNPEEFRELRNKGVPCK
SYE_METMJ             VEWL-GLGITDIVYQSDRLDIYYDWCRKLIELGGAYVCV----CDSERFRELKLKGKACP
SYE_METHJ             IAWM-GLSIAETIFQSDRFSKYYEVGKELIQKGHAYVCR----CDNEKFKDLKMHKTACP
SYE_THEVO             LEWL-GVNVTKTVIQSERFDLYYSVAKKLIENGHLYICT----CDREEFKRKKLASIPCK
SYE_HALS3             LSYL-GFEADEVLTASDRVETYYEHARRLIGMGGAYTCS----CPGAEFSDLKNSGEACP
A0A075IDQ0_9EURY      YEWLAGKPADVIVKASERMPVYLEHAERMIAEGFGYVCR----CSADEFRDFREAKQNCP
SYE_METAC             FKWL-GVVPDRVVYASDHFPIYYDYARKLIEMGKAYVCF----CKGEDFKRLKDAKQACP
SYE_ARCFU             IEWL-GYKPDEVIYASRRIPIYYDYARKLIEMGKAYTCF----CSQEEFKKFRDSGEECP
SYE_NANEQ             VEWLIQEKPDKIVVQSDRLDIYYKYIEELIKQGKAYVCL----CKAEEFREYRNKGLPCP
A0A0B3B0B9_ARCG9      IQNYLGIKPSSIVYVSDHMDKFYEYAEQLITEGKAYMCF----CDREKMQDLRHKGKECD
D2EFI4_9ZZZZ          SIKWLGIKYDKKKFISEDIEKIYEFAKKLIKEGKAYGCT----CSPDEIKRDRTLGNECK
SYEC_SCHPO            VALL-GIKPDVVTYTSDYLDTIHQYCVDMIKSGQAYADD----TDVETMRHERTEGIPSK
V6R1K4_GIBZE          LELM-DIKYHKVTHSSDYFQEIYDLTEKMIQDGNAYADD----TDPEVQSADRKNRLASK
SYEC_YEAST            LDLL-GIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDD----TPTEKMREERMDGVASA
SYEC_ARATH            IGTL-GIKYEKVTYTSDYFPELMDMAEKLMREGKAYVDD----TPREQMQKERMDGIDSK
SYEC_DICDI            INNL-GIKYEKITHTSDYFDLIHDYAIQMIKEGIAYCDD----TPQVKMSEERDNAIESV
SYEC_ENCCU            LSLL-GINEYTLSHTSDYFDKIIDLGVFLIGEGKAYADN----TPQEVMRDERGRGVESR
SYEC_NOSCE            LDTL-GITGLKISHSSDYFELLVDEAVSLINKNLAYVDN----TDQETMRIERFEGIESK
SYEC_ENTBH            LHTL-GIKNYTIVRSSDHFDSLYNYAIQLIQLGLAYCDN----TDQLQMREERTKGIPSK
Q7RKL0_PLAYO          LKTL-GIKYEKISYTSDYFQLLEEYCIKLIKMNKAYADD----TNVDEMRNQRGEGIESV
                                     *  .    .    ::  .  *                :     . 

SYE_CENSY             CSKKAQEDHM-EGWDKM-HGKFKPGQAVARFRGDMESQNTVMRDPVLFRIM------EER
C7DHS0_MICA2          HRLLKPEESL-KIFKGMIAGEYKEGSTVIRLMGDMASDNTAIRDPTLFRIK------NAP
SYE_PYRAB             HRDEPVEVQL-ERWRKMLNGEYKEGEAVVRIKTDLNHPNPAVRDWPALRIVDNP---N--
SYE_THEON             HREEPVEVQL-ERWRKMLNGEYKEGEAVVRIKTDLKHPNPAVRDWPALRIIDNP---S--
SYE_PYRAE             HREQPPEVNL-ELWDKMLEGRFKEGEAVLRIKTDLTHPDPSVRDWVAFRIIDTS---KTP
SYE_CALMQ             TREAESSRNL-ELFDKMLEGAFNEGEAIVAVKTDLSSPDPSIRDWVAFRVIDAH---KYP
SYE_METM7             CRDTTPEENI-ALWEKMLAGEL--ENVAVRLKTDIVHKNPSIRDFPIFRIE------RTP
SYE_METM5             CRDTIPEENL-KLWEKMLAGEL--DNVAVRLKTDIAHKNPSIRDFPIFRIE------RTP
SYE_METJA             CRDRAIEDNL-ELWEKMLNGEL--ENVAVRLKTDIKHKNPSIRDFPIFRVE------KTP
SYE_METMJ             CRELTVEENL-ELWQQMLDGEFYEGDVTVRVKTDLAHPDPAMRDYSAMRIV------NAP
SYE_METHJ             CRSQSPEEAL-DLFDQMLDGAFTEGEVGVRLKTDLSHPDPAMRDYPLFRVL------TST
SYE_THEVO             DRDNPPETNL-YLFEKMLDGEIKAGAAVAVMKTDLNHPNPSVRDWIAFRII------DAK
SYE_HALS3             HRDKDPETVA-DEFEAMVDGEYNSGEMVLRVKTDITHKNPALRDWVAFRMVDT----PHP
A0A075IDQ0_9EURY      CRGRSATESL-SDWKSMNDGKMQDGEGVVRVKTDMTLPNPALRDWPALRIQHT----PHP
SYE_METAC             HRDTSPEENL-MHWEKMLAGEYEDQQAVLRIKTDIEHKDPALRDWGAFRIRKM----SHP
SYE_ARCFU             HRNISVEDTL-EVWERMLEGDYEEGEVVLRIKTDMRHKDPAIRDWVAFRIIKE----SHP
SYE_NANEQ             HRNQSIEENL-ELWSKMLKGEFKKGEAVVRLKTDLTHKDPGVRDFPIARIVEN-------
A0A0B3B0B9_ARCG9      CRKKTPKINK-QEWENMLKKKYQEGECTLRLKIDMKATNQVLRDPVIFRIN------YAK
D2EFI4_9ZZZZ          HRNNSIDENL-RLWEEAENGKIGTGEITFRFKGDMKDKDASLRDPNIMRVI------KND
SYEC_SCHPO            HRDRPIEESLEILSE-MDKGSDVGLKNCIRAKISYENPNKAMRDPVIYRCNLL------P
V6R1K4_GIBZE          RRDRPAEESLAMFRE-MKAGTDLGRKHCIRARIAFDSSNGSMRDPVIFRFPNWKGEEPAP
SYEC_YEAST            RRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT------P
SYEC_ARATH            CRNHSVEENLKLWKE-MIAGSERGLQCCVRGKFNMQDPNKAMRDPVYYRCNPM------S
SYEC_DICDI            HRNNSVEKNLEMFDE-MKKATEQGVKCVLRAKLDMAHIDKAFRDPAIYRCNST------P
SYEC_ENCCU            CRSMDVEESKRIFKE-MARGNASG--YCLRAKIDMSSSNKAMRDPVIFRVN-ESP-----
SYEC_NOSCE            MRNINNSESLKIFKE-LLQGRAPG--YCLRAKIDMSNPNKSMRDPVIYRAS-DKM-----
SYEC_ENTBH            NRNTDIETNLSIFSK-MSSGNCLD--YCLRAKIDYTNLNKALRDPVIYRHI-EKE-----
Q7RKL0_PLAYO          NRNNSIDTNLKLFEE-MRNGTDIGKKNCIRAKIDMSSKNKCMRDPVLYRCIIDIP-----
                                                            :  .**    *           

SYE_CENSY             HPLLGDRHRVWPSYDMAVAIEDSIDGVTHAFRSKEY-ELRNELYGAILGKLDMRAPMVLE
C7DHS0_MICA2          HYRLGSKYSTWPTYHMNTPIIDSINGVTDVIRSKEY-EIWDPVHKLILKALKIKEPRIHS
SYE_PYRAB             HPRAGNKYRVWPLYNFASAIDDHELGVTHIFRGQEH-AENETRQRYIYEYFGWEYPVTVH
SYE_THEON             HPRTGDKYRVWPLYNFASAIDDHELGVTHIFRGQEH-AENETRQRYIYDYFGWEYPVTVH
SYE_PYRAE             HPLTGDKYIVWPTYNFAVSIDDHLMGVTHVLRAQEH-SVNTIKQSYVFRHFGWEQPVTIH
SYE_CALMQ             HPRVGDKYIVWPTYNFAVAIDDHLMGITHVLRAQEH-RVNTVKQYYVFKAFGWEQPYTIH
SYE_METM7             HPKNGTKYHVYPLMNLSVTVDDHLLGMTHVLRGKDH-IVNTEKQEYIYNYFGWEIPEYVH
SYE_METM5             HPKNGIKYHVYPLMNLSVTVDDHLLGMTHVLRGKDH-IVNTEKQEYIYNYFGWEIPEYVH
SYE_METJA             HPRTGDKYCVYPLMNFSVPVDDHLLGMTHVLRGKDH-IVNTEKQAYIYKYFGWEMPEFIH
SYE_METMJ             L-HPRVDATVFPLMNFSVAVDDHLLGITHVIRGKDH-IANTRRQRYIFDYFGWKPPVYRH
SYE_METHJ             P-HQRVDAIVYPLMNLSVAVDDHLLGMTHVIRGKDH-IANTKRQEFIFRYMGWETPVYRH
SYE_THEVO             HPRTGDKYRVFPMMSFSVAVDDHYLGLTHVLRGKDQ-LTNTEKQRYVFEYNGWNKPYYYH
SYE_HALS3             RD-AASGYRCWPMLDFQSGVDDHRTGVTHIIRGIDL-QDSAKRQRFLYEYFGWEYPEVVH
A0A075IDQ0_9EURY      L--AGDQYKVWPLLDFQSAIEDHEQGVTHIVRGKDL-MDSTRKQTLLYEHFGWKYPEPLY
SYE_METAC             RAEIGNKYVVWPLLDFAGAIEDHELGMTHIIRGKDL-IDSEKRQGYIYKYFGWTYPKTTH
SYE_ARCFU             L--VGDKYVVYPTLDFESAIEDHLLGITHIIRGKDL-IDSERRQRYIYEYFGWIYPITKH
SYE_NANEQ             PHPRIGYKPVFPLYNFAVVIDDHLLGITHVIRMKEH-TNNAIKQSFIYKAFGWEEPIYLE
A0A0B3B0B9_ARCG9      HYKYGNKYHVWPLYDFYNAIEEHLCGVNYVLRSNEFGTMRTELQNHIRELFGMKNPKEKQ
D2EFI4_9ZZZZ          Y----KPYNLWPLYDFASVIEDELCGITHILRSN---EFKTNLQSKLRKALDFKEPNIIQ
SYEC_SCHPO            HHRTGTKYRAYPTYDFACPIVDSLEGVTHALRTTEYRDRNPLYQWMIKAMNL-RKIHVWE
V6R1K4_GIBZE          HHRTGWTWNIYPTYDLVVPILDSIEGVTHALRTTEYADRNEQYHWFLKALNL-RQVHLWD
SYEC_YEAST            HHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL-RKVHIWD
SYEC_ARATH            HHRIGDKYKIYPTYDFACPFVDSLEGITHALRSSEYHDRNAQYFKVLEDMGL-RQVQLYE
SYEC_DICDI            HHRTGDKYKVYPLYDFACPIVDSVEGITHALRSNEYNNKRNLYNHYLEILHLENKPYISD
SYEC_ENCCU            HHRTGDKYKVYPTYDFACPIVDSLEGITLSLRANEYRDRNQQYYWFIDNLRLRNRPKIHD
SYEC_NOSCE            HGRC-KLYKAFPTYDFVCPIVDSIEGVTVVCRANEYKDRNEQYKWFLENLELENKPEFND
SYEC_ENTBH            HNITKNKYKIYPTYDFACPIIDSLDGVTLALRTNEYRDRNEQYYWFLEKLNLPNKPKIYD
Q7RKL0_PLAYO          HHRHEFKYKCYPTYDFACPIIDSIEGVTHALRTNEYSDRIEQYNWFISTLELRNV-HIYE
                                :*   :   . :   *:.   *              :             

SYE_CENSY             FSRLEFEGMP--VSKRVIRPLIEDGKIPWYDDPRLPTLEGMKKRGITPGAIRRFVI-SLG
C7DHS0_MICA2          EARLRIKGAV--TQKRTLRDFISKGYIKSWDDPRLLTIAGMKRRGIQPGAIREFVL-RFG
SYE_PYRAB             HGRLSIEGVI--LSKSKTRKGIEEGKYLGWDDPRLGTIRALRRRGILPEAIKELII-EVG
SYE_THEON             HGRLSIEGVI--LSKSKTRKGIDEGKYFGWDDPRLGTIRALKRRGIRPEAIRELII-EVG
SYE_PYRAE             FGRLRIEGAT--LSKS-----KLKAMRIKYDDLTLPTLAGLRNRGIVPEAIWDLIL-SVG
SYE_CALMQ             FGRLKIEGLK--LSKS-----ILKKLNLTKDDVTLPTLAGLRNRGITPEAIWSLIL-FVG
SYE_METM7             YGILKIEGPV--LSTSKMHAGILSGEYSGWDDARLGTLRALRKRGIRPEALYKLMV-EIG
SYE_METM5             YGILKIEGPV--LSTSKMHAGILSGEYSGWDDARLGTLRALRKRGIRPEALYKLMV-EIG
SYE_METJA             YGILKIEDIV--LSTSSMYKGIKEGLYSGWDDVRLGTLRALRRRGIKPEAIYEIMK-RIG
SYE_METMJ             YGRMGISGVV--LSTSGMREGINSGLYTGWDDIHLGTMRAIARRGIEPEAVRNAMV-DIG
SYE_METHJ             YGRMGIEGVV--LSTSQMRAGIQSGEYSGWDDVRLGTLRAMARRGIQPQAVRNAVV-EIG
SYE_THEVO             YGMIRFPGTR--LKTSLMKKGIQAGQYDGWSDVRLGTVRAMARRGYQPETFRRYWI-NSG
SYE_HALS3             WGHVQLDAYDVAMSTSTIKERIAAGELEGWDDPRAPTMQSIRRRGIRGAAVVDAMV-ELG
A0A075IDQ0_9EURY      WGRVKVHEFG-SFSTSGMRTTIESGSHEGWGDLRLPTLRALRRRGFSARALRDFWI-DLG
SYE_METAC             WGRVKIHEFG-KFSTSSLRKAIEAGEYSGWDDPRLPTIRAIRRRGIQAEALKKFMI-EMG
SYE_ARCFU             WGRVKIFEFG-KLSTSSIKKDIERGKYEGWDDPRLPTLRAFRRRGFEPEAIKSFFL-SLG
SYE_NANEQ             YGALLTDMPT---HKSEIRKLIEQKQIEGWDDIRLPTLIALRRRGILPEAIYEYIVKDVG
A0A0B3B0B9_ARCG9      YGRFNINDKT--TQGREVRELIEKGEVNGWDDPRLVTLKALKRRGIEREVYYELIK-EVG
D2EFI4_9ZZZZ          FSRFNFQGTL--TSKRKVRELIKQGYIKDWQDIRLATISSMKRRGIEPEAIRDFVK-EVG
SYEC_SCHPO            FSRMNFVRTL--LSKRKLTEIVDHGLVWGWDDPRFPTVRGVRRRGMTIEALQQYIV-SQG
V6R1K4_GIBZE          FARINFIQTF--LSKRKLTKVVDTGRVSGWDDPRMPTVRGIIRRGLTVPALREFML-KQG
SYEC_YEAST            FARINFVRTL--LSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVL-SQG
SYEC_ARATH            FSRLNLVFTL--LSKRKLLWFVQTGLVDGWDDPRFPTVQGIVRRGLKIEALIQFIL-EQG
SYEC_DICDI            YSRLSFFNVL--LSKRKLQHFVDTGLVSGWTDPRLPTLQGITRRGLTVAALKEFIL-SQG
SYEC_ENCCU            FSRLNFENTV--LSKRKLKYYVDNGFVSGWDDPRLATIAGIKRLGMNMEALREYIL-MQG
SYEC_NOSCE            FSKLNLEDTV--LSKRKIDKLISDSLVTGWDDPRLATIQGIKRLGMHMTALKDYIN-LQG
SYEC_ENTBH            FSRLNFENTV--LSKRQMKFYVDNHFVSGWDDPRLSTLRGILRLGMDIDTLKEYII-NQG
Q7RKL0_PLAYO          FSRLAFVKTV--MSKRKLKWFVENNIVDGWTDPRMPTIKGILRRGLTKEALFQFIL-EQG
                       . .                           *    *: .. . *              *

SYE_CENSY             LTKADTLAPFGALEAFNRKEIDGNSTRLFLVGD--PRRIDVAGLPG------------TA
C7DHS0_MICA2          MSKTDSTVGIDMLLSENRKIIDQMSKHLFFVGNLFAVQVTEGDFPT------------DV
SYE_PYRAB             LKKSDATVSWDNLAAINRKLVDPIANRYFFVADPVPMEVEG-APEF------------IA
SYE_THEON             LKRSDTTISWDNLAAINRRIVEPIANRYFFVADPIPMYIEGYDEEF------------VA
SYE_PYRAE             IKPSDSTVALANLFAFNRKHIEPIADRYMYVADPVKLVFEADKEL-------------TA
SYE_CALMQ             IKETDATISLKNLYAYNRRVIEPLANRYMFVKNPVKLRLRGVGDLI------------EA
SYE_METM7             IKQADVRFAWENLYAANKDIIDKDARRFFFVESPKKLVISG-AESK------------KI
SYE_METM5             IKQADVRFAWENLYAANKDIIDKDARRFFFVESPKKLVISG-ADSR------------KI
SYE_METJA             IKQADVKFSWENLYAINKELIDKDARRFFFVWNPKKLIIEG-AEKK------------VL
SYE_METMJ             IGETDISFSWENLYSRNKELVDPKANRYFFVPDPVEVTVEG-APRR------------EA
SYE_METHJ             IGETDIQFSWENLYAKNKEIIDSQADRFFFVPDPVLVPVSG-SDPV------------VA
SYE_THEVO             LREIDAVFSWEIFNSLNREFVDPKAYRFSFTKDPVEIKMEG-SNGL------------TA
SYE_HALS3             TSSSDVELAMSAVYANNRDLVDDTAPRQFLVRDGFEARGEGPEESHEAVEVPVDDGPDEA
A0A075IDQ0_9EURY      LSQKDISISMQTIEAFNSSLIDSSVERRSFVASPVTLELRGTEE-------------QRV
SYE_METAC             VGMTDVSISMESLYAENRKIVDPVANRYFFVWAPVELEIAGM-EP------------TVA
SYE_ARCFU             VGENDVSVSLKNLYAENRKIIDRKANRYFFIWGPVKIEIVNLPEK------------KEV
SYE_NANEQ             LNKADIKVDWNKIYYYHKIRIDKQTPRYFMIRDPIAIVIENYDDIIDKFEI---KNGIPY
A0A0B3B0B9_ARCG9      LTPTQTNLDFTVVAAINRRILDKKSNRYFVLVNTEKIKVDNAPKRK-------------V
D2EFI4_9ZZZZ          YSSSEHEYSLDMLFTFNRRIIDKSAKRLFFVPNPIKLQVENAPAEK-------------I
SYEC_SCHPO            PSKNILTLDWTSFWATNKKIIDPVAPRHTAVESGDVVKATIV---NGPAA------PYAE
V6R1K4_GIBZE          PSRNVVTMDWTTIWAINKRMLDPVVPRYMAIEEKDAVTVTIT---GGPEK------SYKE
SYEC_YEAST            PSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGS---EAPQE------PKIE
SYEC_ARATH            ASKNLNLMEWDKLWSINKRIIDPVCPRHTAVVAERRVLFTLT---DGPDE------PFVR
SYEC_DICDI            ASAANTTLDLGKLFVGNKAVLEPTCPRYTAIAKATAVKFTLS---NGPTL------PEVK
SYEC_ENCCU            VSQKTCTISWDKVWAINRKKIDPVSARYFCVQQRDAVEVSID---NTS--------EYTM
SYEC_NOSCE            ASNKTNVISWDKIWAMNKKVIDPLSPRFMAVEKINCVRVFIT---NFEGL------KYTK
SYEC_ENTBH            SSQKSSVISWDKVWSLNKKNIDHKSARYSAIPKLYCVECLILDKNNNEII------TKTE
Q7RKL0_PLAYO          PSKAGNLMQWDKLWSINKQIIDPNIPRFACVDMNNGIILKLIDLKENEII------EKTR
                                  .   :   ::    :                                 

SYE_CENSY             ELPNHPSGD-MGSRKIETGG-----ALYLPGKDAEGLSEGGHIRL---MGLGDVRI----
C7DHS0_MICA2          KLKIRPNDG-SAMREYRVGK-----DFFIAGEDAKSLHPGSIISLKDLITLEVLSI----
SYE_PYRAB             KIPLHPDHPERGTRELRFTP---GKPIYVSKDDLDLLKPGSFVRLKDLFNVEIVEV----
SYE_THEON             EIPLHPDHPDRGVRKLKFEP---GRPVYVSKDDMELFKPGSFVRLKDLFNVEILEV----
SYE_PYRAE             HVPFHPSFKERGERTYRLGP--GRVEVYIQRRD---AVAGKVVRLMELANVEIVRV----
SYE_CALMQ             KIPMHPSYPERGIRVIKITGEGGYANVYVQASD---VKPGLVVRLMGLGNVKVINV----
SYE_METM7             DLRMHPDRNELGNRELLFDG-----EIYV-SDDLE---VGTMYRLMELFNIVIEKI----
SYE_METM5             DLRMHPDRSELGNRELLFDG-----EIYV-SDDLE---AGKMYRLMELFNIVVEKV----
SYE_METJA             KLRMHPDRPEFGERELIFDG-----EVYVVGDELE---ENKMYRLMELFNIVVEKV----
SYE_METMJ             HAALHPNDPSRGVRTLVAEE-----AILLPRADIE---GKSMVRLKDLYNVKI-AW----
SYE_METHJ             KAMRYPGDESRGYREIPFAG-----SLYLPKAELES--GAAYIRLKDLFNIKV-LY----
SYE_THEVO             RLPYHPSHPEYGVRKYEIGD-----TVYISKGDADKIADGERFRLKDLCYVVR-------
SYE_HALS3             TPQVHPEHPDRGDREIPVGE-----RVLVEATDLPAAG--DRVWLKGYGPVRYDGE----
A0A075IDQ0_9EURY      NAPRHPDGSIPGSREWELTG-----SILIQASDTGQR----RVRLKEFADIEILGD----
SYE_METAC             KLPLHPTDHSRGVREIAVGN-----KVLVCAEDVEKLELGSVIRLKDFCNIEITSL----
SYE_ARCFU             ELPLNP--HTGEKRRLKGER-----TIYVTKDDFERLK-GQVVRLKDFCNVLLDE-----
SYE_NANEQ             KKISKHPDVDLGYRELPIKE-----VLYIDKRDAERLK-QKPLRLFELFNIKFVGE----
A0A0B3B0B9_ARCG9      KLPLHPEDEKRGYRTMDTES-----EFYITKEDLKELKTENKLH-RLMDCMNLEYK----
D2EFI4_9ZZZZ          KLPFHPSND-LGFREIQTNG-----KFFIDKTDIASLEIGDKFRLKELYSLEIVDK----
SYEC_SCHPO            DRPRHKKNPELGNKKSIFAN-----EILIEQADAQSFKQDEEVTLMDWGNAYVREI--NR
V6R1K4_GIBZE          DRPKHVKNPDVGTKQVTFGP-----KLLLDQVDVASFDDNEEITLMSWGNAIVRGI--NK
SYEC_YEAST            MKPKHKKNPAVGEKKVIYYK-----DIVVDKDDADVINVDEEVTLMDWGNVIITKK--ND
SYEC_ARATH            MIPKHKKFEGAGEKATTFTK-----SIWLEEADASAISVGEEVTLMDWGNAIVKEI--TK
SYEC_DICDI            DCLKYAKDPSMGTKKVTFSN-----NLLLEGDDCNQIKEGEEVTLMNWGNAIVETL--QR
SYEC_ENCCU            DVPKHKKNGDLGTKEVFYSS-----QILLSQEDGRVLQDNEEFTLMNWGNAIVKS---KT
SYEC_NOSCE            NIPLNKKNTSLGSKDVLFSD-----TLLFSQEDGFVLKENEEFTLMNWGNAIVEK---KV
SYEC_ENTBH            DIPKFKKNLSLGNKTIIKSS-----HILISQEDANILNNNEEFTLMNWGNMKVKE---KQ
Q7RKL0_PLAYO          DLHVKNKN--LGTCTMYYTQ-----KIYIELEDAQMIEPNEEITLIKLGNVIVKEIIKDV
                                                . .   :                           

SYE_CENSY             -DSA--GRDLAGTYTGDDISAGYPKMQWVPCGDARKIKVVIPRAPIKD-GE---------
C7DHS0_MICA2          -DAQ--SKKMSAKKIAPD-SGYGKIVQWVSSGNFMECIVEVPGEMINEEGE---------
SYE_PYRAB             -GEK-IKAKFHSFEYEIARKNKWRMIHWVP-EGRPCEVIIPEGD----------------
SYE_THEON             -SEEGIKARFHSIEYEIARENRWRMVHWVT-EGRACGVLIPQGD----------------
SYE_PYRAE             -EGDVAYGRIHSYSLDEAKKIGAPIIQWVW-DPVEITVIKPAGV----------------
SYE_CALMQ             -SGNEAEADFIGQSVEDARRSEAPIVQWAPPDAVNAEVIIPVNV----------------
SYE_METM7             -ENDVIYAKYDSDDLAVAKSNKASIIHWIPVKDSIPVTVI---D----------------
SYE_METM5             -ENDILYAKYDSDDFAIAKSNKASIIHWIPVKDSVPVTVI---D----------------
SYE_METJA             -D-DIALAKYHSDDFKIARKNKAKIIHWIPVKDSVKVKVL---M----------------
SYE_METMJ             -DGDTPRVSYAGDSLEEARHEKAPIIQWLPADAKLPCTLL---R----------------
SYE_METHJ             -EGDIIRGEYAGDDLQEARSKKAPIIQWLPENHANPCTLK---T----------------
SYE_THEVO             ---KGDRFLFDGTEMK----EKTKIINWCPPN-SREFQVL---K----------------
SYE_HALS3             ------RFAFLDADIDIVREEGVDVVQWVPAEHNVDVRLRTM------------------
A0A075IDQ0_9EURY      ------VATIESFD----RSDERPIIHWIPTGIAREAELVTP------------------
SYE_METAC             -S--PLQAKHSDVSLEALKKAKAKIVHWAP-VDGISVKVRGP------------------
SYE_ARCFU             ------KAEFMGFELEGVKKGK-NIIHWLPESEAIKGKVIG-------------------
SYE_NANEQ             -I---EIEYGDEYSKTKEKAYAVRVISFDVQEAIKNKYPIVQWL----------------
A0A0B3B0B9_ARCG9      -NDKFVYHSQDHDTYKNSKNKGKIINYLPVSKDLVKCTIMMDDA----------------
D2EFI4_9ZZZZ          -EDELITCKIYSKEHQQGEKIIQWVTEQNLPIKVIKVGNLLNTDGTFN------------
SYEC_SCHPO            DASGKVTSLKLELHLDGDFKKTEKKVTWLA-DTEDKTPVDLVDFDYLITKD--KLEEGEN
V6R1K4_GIBZE          TAS-PINELNLELHLAGDFKTTSKKVHWLAADPENLVKAELWEFGSLITKD--TLEKDDN
SYEC_YEAST            DGS-----MVAKLNLEGDFKKTKHKLTWLA-DTKDVVPVDLVDFDHLITKD--RLEEDES
SYEC_ARATH            DEEGRVTALSGVLNLQGSVKTTKLKLTWLP-DTNELVNLTLTEFDYLITKK--KLEDDDE
SYEC_DICDI            NENGDVVSMTGKLHLEGDVKKTDKKLSWLSSDCADTVTVVLQDYDYIITKP--KLEDGDD
SYEC_ENCCU            VENGTVTKMEVSLNPDGDFKLTKNKMSWVS--KRGSVTVELAEYGNLM-----NDEDTED
SYEC_NOSCE            VENSIVTELYIKLHLEGDYKSTTNKISWVS--ESGAVTATGIEYGKLL-----VNE----
SYEC_ENTBH            IVNGIIIKIILEENLAGDVKTTKNKLTWVN--KENIIEFKILEYDTLQ-----NDKNTDN
Q7RKL0_PLAYO          DNVNKIKEIIAVSNFDGDFKTTKKKIHWLPYIPDKLIKCTLYEYDHLITVDKFENDNKED
                                                                                  

SYE_CENSY             -----FDSSSLGILEGMVEPHYLQVGDGQSIQFVRFGYCRKESQHMAVFTHG--------
C7DHS0_MICA2          -----FNPDSLKMETGYVESYASRLGKGDIVQFERFGYCILDDPKSSTFIYISK------
SYE_PYRAB             ---------ELIVRKGLLEKD-ANVKAGEIVQFERFGFVRIDKIEGEKVVAIYAHK----
SYE_THEON             ---------ELIVRKGLLESD-ANVKVDDVVQFERFGFVRIDDVTPEKVVAIFAHK----
SYE_PYRAE             --------GRKEVEVGLGEGWLERVEVGKYVQFFRYGYLKKRGPRE----FVFLHD----
SYE_CALMQ             --------GQVTVDNGLAEPAVAKLEQGTVMQFIRYGFVKLMGSSNGKLRLVYIHD----
SYE_METM7             --------ENAEKIEGFAEKDFAVVNEDDFVQFERFGFVRVDEKEDNGYTCYLTHK----
SYE_METM5             --------ENAEKIEGFAEKDFAVVKEDDFVQFERFGFVRIDEKVDNGYTCYLTHK----
SYE_METJA             --------PDGEIKEGFAEKDFAKVEVDDIIQFERFGFVRIDKKDNDGFVCCYAHR----
SYE_METMJ             --------QDG-SLEGFCEPLVAGET-DRVVQFERIGFARIDSADGGRVSAYFAHR----
SYE_METHJ             --------PDG-DVSGVCEPEAVTTQ-DRIVQFERVGFARIDAA-GNPAVAYFTHR----
SYE_THEVO             --------PDGSIDKGLIEPASKGYR--GISQLERYGYVNFYDS---DEKAYFTHD----
SYE_HALS3             --------DGD--VTGYAEPGFADRDADEIVQFVRVGFARVDAHRDGGASVAYFTHP---
A0A075IDQ0_9EURY      --------TGDGLVTQTGVLEDFELVVGETYQLERVGYARLEELSEDGLAKLVWLHG---
SYE_METAC             --------EGD--LEGIGEKG-IVGELDKIVQFERFGFCRIDAVSEE-KVVAYFAHK---
SYE_ARCFU             --------ERE--AEGLVERN-AVRDVGKVVQFERFAFCKVESADEE-LVAVYTHP----
SYE_NANEQ             --------PEYEETTLFELDGYKKAYVEPNIKENYVHFIREGYYKRENDKWIFSVK----
A0A0B3B0B9_ARCG9      -----------TVVEAIAEPDTKNVKVDDKIQAERFAFLRLDSITKGKYNFWFTHK----
D2EFI4_9ZZZZ          -------ENSLTQIEGLAEKTADEIGEEQTIQFERFGFCRLDNKNKKEFIFVSK------
SYEC_SCHPO            YKDFLTPQTEFHSPVFADVGIKNLK-KGDIIQVERKGYYIVDVPFD---GTQAVLFNIPD
V6R1K4_GIBZE          LDDFLNDNSATLTNALVDASIAELK-ENDFLQLERKGYYRVDKALGQGPDGRAVLFKVPT
SYEC_YEAST            FEDFLTPQTEFHTDAIADLNVKDMK-IGDIIQFERKGYYRLDALPKD--GKPYVFFTIPD
SYEC_ARATH            VADFVNPNTKKETLALGDSNMRNLK-CGDVIQLERKGYFRCDVPFVK-SSKPIVLFSIPD
SYEC_DICDI            LDTFTNKNSKFEIEAFTDENILTLK-LNDKIQFERRGFFNVDQVGDG--VKPYILIYIPS
SYEC_ENCCU            LALRFNRNSVKKEYWYAESAIINVR-EGEVIQFERNGFYYCDGFLVFNLLPFTKQKRTGN
SYEC_NOSCE            ---EFNINSKIDKQYYVESSITNLSTDMKHVQFERIGFFYCDSPCVFHLVPFTKQKRTY-
SYEC_ENTBH            LAEKFNTNSKKEEIWLGEKALISVS-PKTYIQIERIGFFICDKPLEFILIPYTKQKRMR-
Q7RKL0_PLAYO          WTNCINQNSKFETVGYAEPALINLK-VSDKFQFERRGYFIVDKITENNHFHLIKIPDGKS
                                                     :     :                      

SYE_CENSY             --------------------------------------
C7DHS0_MICA2          --------------------------------------
SYE_PYRAB             --------------------------------------
SYE_THEON             --------------------------------------
SYE_PYRAE             --------------------------------------
SYE_CALMQ             --------------------------------------
SYE_METM7             --------------------------------------
SYE_METM5             --------------------------------------
SYE_METJA             --------------------------------------
SYE_METMJ             --------------------------------------
SYE_METHJ             --------------------------------------
SYE_THEVO             --------------------------------------
SYE_HALS3             --------------------------------------
A0A075IDQ0_9EURY      --------------------------------------
SYE_METAC             --------------------------------------
SYE_ARCFU             --------------------------------------
SYE_NANEQ             --------------------------------------
A0A0B3B0B9_ARCG9      --------------------------------------
D2EFI4_9ZZZZ          --------------------------------------
SYEC_SCHPO            GKTVNRYGVKN---------------------------
V6R1K4_GIBZE          G------GQKG---------------------------
SYEC_YEAST            GKSVNKYGAKK---------------------------
SYEC_ARATH            GR-----AAK----------------------------
SYEC_DICDI            GPIKPAGAALYPFKKVEKVAAPVNPKPTAKKQEKQSKK
SYEC_ENCCU            --------------------------------------
SYEC_NOSCE            --------------------------------------
SYEC_ENTBH            --------------------------------------
Q7RKL0_PLAYO          KNMSIISTKVNPQNLSGTKK------------------