CLUSTAL format seed alignment for MF_02079

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RODA_HELPY            ----------------------------------------------------------MA
RODA_HELPJ            ----------------------------------------------------------MA
B2V6L7_SULSY          ----------------------------------------------------------MF
RODA_ECOLI            ------------------------------------------------MTDN-PNKKTF-
Q32IU6_SHIDS          ------------------------------------------------MTDN-PNKKTF-
Q7CQZ3_SALTY          ------------------------------------------------MTDN-PNKKTF-
A9MKD7_SALAR          ------------------------------------------------MTDN-PNKKTF-
A8AJG9_CITK8          ------------------------------------------------MTDN-PNKKTF-
B2VBJ6_ERWT9          ------------------------------------------------MNSS-HQKKTI-
A0A5P8YIV2_YERPE      ------------------------------------------------MTDN-QQKGSL-
RODA_HAEIN            ------------------------------------------------MEDKIPFWLRV-
Q5E6V4_ALIF1          ----------------------------------------------MRVDIASGKNRDF-
Q9KTF3_VIBCH          ----------------------------------------------MKMDPATGQNRAL-
Q6LN92_PHOPR          -------------------------------------------------MATTGNKRTL-
Q8EHQ0_SHEON          --------------------------------------------------MSAHQRQNI-
G3XD88_PSEAE          ----------------------------------------------------MRRRASL-
Q83DY9_COXBU          --------------------------------------MTTRAHLLNKLNSDSRLKRRMV
Q7VSM6_BORPE          -----------------------------------------------------MKRLGL-
Q63YK5_BURPS          --------------------------------------------------MQFDKRASLD
Q5GVQ2_XANOR          --------------------------------------------------MSDILRWLVD
Q8P576_XANCP          --------------------------------------------------MSDILRWLVD
A5EY25_DICNV          --------------------------------------------------MIADHDQPWQ
Q5E093_ALIF1          ------------------------------------------------------------
Q9A817_CAUVC          ---------------------------------------MTLSGGLS------RPGERDR
Q2RN22_RHORT          ---------------------------------------MAKKELLD------EPLVTPW
Q5FQ66_GLUOX          ---------------------------------------MNTFGFLKSDRRLLRAEPDFR
Q3J405_CERS4          ------------------------------------------MSFLE-----YRVKTAPT
Q5NQM0_ZYMMO          ---------------------------------------------------------MLS
Q9ZDP7_RICPR          ----------------------------------------MLDTVIKLYDDRINIKTMHK
Q5SIX3_THET8          --------------------------------------------MAPARPNW--------
D1B5Z4_THEAS          --------------------------------------------MSLKSPSWNE------
D1AAV9_THECD          --------------------------------MIGGIGAADVVEGYGARQTWRHRLVALR
Q1AVU0_RUBXD          ---------------------------------MTMIGREAAPASFSNLDRWR-------
Q7NKJ1_GLOVI          --------------------------------------------MELAKLSWNSWLNSLY
Q8DIK2_THEEB          MLSLSSNGSSLRAWAAKHSATQAKMGVLIKPPLFQPSGNEGYLAMFWTTRLWQRRWSAWL
Q7V9T9_PROMA          --------------------------------------MPSIVNSFARQSNRSTKLDFRR
B8E312_DICTD          -------------------------------------------------------MKRRE
Q8RER8_FUSNN          --------------------------------------------------------MQNN
Q1IRN2_KORVE          --------------------------------------------------------MSRY
RODA_TREPA            ------------------------------------------------------------
Q72DZ4_DESVH          ---------------------------------------------------------MTP
Q74BG3_GEOSL          -----------------------------------------------------------M
B5YHQ0_THEYD          ---------------------------------------------------------MLK
Q8KFN2_CHLTE          -----------------------------------------------------------M
A5HZF9_CLOBH          -----------------------------------------------MIRRKNVNLNKSF
A6TMZ7_ALKMQ          -------------------------------------------------------MRIDH
Q2RL15_MOOTA          --------------------------------------------------------MFER
B2A6A7_NATTJ          --------------------------------------------------------MFDK
Q97JM3_CLOAB          -----------------------------------------------------MILNKLK
RODA_BACSU            ---------------------------------------------------------MSR
                                                                                  

RODA_HELPY            LDKRIWMHFDLLPFVFIIPLLVVSFLLIFESS---------AVLSLKQGVYYAIGFILF-
RODA_HELPJ            LDKRIWMHFDLLPFVFIIPLLVVSFLLIFESS---------AVLSLKQGVYYAIGFLLF-
B2V6L7_SULSY          NLFKKIKQTDLIVYLLTAFLLIWSVINIYSASYH-----EYSNLYIKQIVFVSIAFFIIT
RODA_ECOLI            ---WDKVHLDPTMLLILLALLVYSALVIWSASG-------QDIGMMERKIGQIAMGLVIM
Q32IU6_SHIDS          ---WDKVHLDPTMLLILLALLVYSALVIWSASG-------QDIGMMGRKIGQIAMGLVIM
Q7CQZ3_SALTY          ---WDKIHIDPTMLLILLALLVYSALVIWSASG-------QDIGMMERKIGQIAMGLVVM
A9MKD7_SALAR          ---WDKIHIDPTMLLILLALLVYSALVIWSASG-------QDIGMMERKIGQIAMGLVVM
A8AJG9_CITK8          ---WDKIHIDPTMLLILLALLVYSSLVIWSASG-------QDIGMMERKIGQIAMGLVIM
B2VBJ6_ERWT9          ---WTRIHIDPLFCLIIAALLVYSALVMWSASG-------QDPGMMERKLVQICMGIVVM
A0A5P8YIV2_YERPE      ---WYKLHIDLPFLICILALLAYSAFVMWSASG-------QDIGMMERKVGQIAMGLIVM
RODA_HAEIN            ---WQRLHIDFWLFIGLLAITAYGMLVLYSASG-------ASETMFNSRIIQVLLGFIVM
Q5E6V4_ALIF1          ---FHRIHLDLPLLLGILLLMACALVIMYSASG-------QSLLMMDKQAMRMLLSLGVM
Q9KTF3_VIBCH          ---FERFHIDLPLLLGVLALMGFGLVVMYSASG-------QSLAMMDRQAMRMAMALIIM
Q6LN92_PHOPR          ---SDRLHLDLPLLLGILALMGFGLLVMYSASG-------QSLPMMERQAARMCLALGVM
Q8EHQ0_SHEON          ---WQRLHIDLPLLLGLLAVMGFGLFVIYSASG-------EDLGMMERQLFRMFLSICVM
G3XD88_PSEAE          ---LQRLHIDGILLLLLLILGATGLFVLYSASG-------KSWDMLMKQATSFGLGLGMM
Q83DY9_COXBU          HLRWQGLPIDPLLLIFVFLLVNVGLFILFSASN-------QNVSVMLKQTVWLLIGFLVM
Q7VSM6_BORPE          ILLRVFTAFDWPLLLILILFTLLGLTVMHSAVG-------STDWRFAEQSRNFLIAFAAM
Q63YK5_BURPS          KIKQMFAGFDRPLALIVFLLLCVGIVTLYSASV-------DVPGRVEDQLRNIMLTFVLM
Q5GVQ2_XANOR          MAARFTRSLDWVLCLALGGLMAIGLSVLKSAGGT-----ANGQHLLQAQAIRFVIGIAAM
Q8P576_XANCP          LAARFARSLDWVLCLALAALMVIGLSVLKSAGGT-----ANGDHLVMAQGVRFAIGAAAM
A5EY25_DICNV          GMSNWLKRFDWWLILLLLLLMLGSLLILYSSN--------NDAHILWRQMLHFALAWSVF
Q5E093_ALIF1          -MYDYKPRIDYALLAAILVLIVLGSLTVWSASG-------FSEPMLERHLIRAMIAVGCI
Q9A817_CAUVC          PTIKFMEI-DWTFCLFLCLIAGAGALMLFSIAG------ASWEPWAAKHLIRFGLYFIMM
Q2RN22_RHORT          HVVASLRIHDILFLLALAFLSLVGALALFSAAG------GRADPWADSHLIRFGIGLVAA
Q5FQ66_GLUOX          PMARLLQV-NWLYVLLVCVLAGVGYIALYSAGG------GSAKPFAGPQMVRFGFGLVMM
Q3J405_CERS4          GLAKVLHI-NWALVLLVTATASVGWLMLTSVAG------GDIDTWAGPQMKRFAVGLVLM
Q5NQM0_ZYMMO          LVPAPIRQLPWKLLLLVMAVGSFGLVVLYSAGG------G-LHPWALNQGLRFVFFIFVA
Q9ZDP7_RICPR          NYLEQLQKLPITLIVLIIIICCIGFIVLYSAAN------SNLQPWAYKQMINFCIFLPLA
Q5SIX3_THET8          ------LAYDWGLVFLVAAIVALGFVNLGSAA--------PDPVLLYRQSVALGLGLLLA
D1B5Z4_THEAS          ----IRSTLDRPLGLITGALFSLGMVALLSASTGV---YKANYSFPIRQALWGMVGFAGY
D1AAV9_THECD          RLDWKLITAVVALSVLSALLVRSATFAELAEQG------RDPNGFVKRHLLNLALGLILG
Q1AVU0_RUBXD          -------SADPVLLLVTLLLSAYGIFAVYVAGT------SDREAYAVNQSIGFAVGLAGA
Q7NKJ1_GLOVI          K---LFRGFDGWLLLFAVLLLSTGVLTIFSTR------PEG--IEWKAQLGTGLVGIAWA
Q8DIK2_THEEB          Y---PWRGMDWLLLIAVWLITLLGAVAIHSAE------LHIGEKDGFQHLAIAGLGTILL
Q7V9T9_PROMA          K---QLNDAELILWFVPLSLVVLSSVLIASTQ------RQVFYGSWYQHLITAVFGGFLA
B8E312_DICTD          I---KLILVVILLTFIGFLFIYDTTATRLIAK------ELSPYVFLQRQVIAFLIGLVFF
Q8RER8_FUSNN          IYLKKISKFSVFFIVNILLLFIISLSTIYSATI----TKSE--PFFLKEIVWFIISIFVF
Q1IRN2_KORVE          VSFR---DFDWFLLLFVLIICTLGVIEIYSATFG---TKFA--GAHVKQIYWVIGGVIVM
RODA_TREPA            MRIRGVSDFDYLLLLTMLALTSIGILFIYSSGVNSEGHVIS--REYLKQIVWAVMGVVLM
Q72DZ4_DESVH          IDRRLITHMNWGLLAFTFILFCVGAANLYSASGVRIEDGIEVSSFYQKQLVWGLIGLGGM
Q74BG3_GEOSL          IDRRLITNFDWMLLGLVLLICAVGVVNIYSASSSYVLSG---TPYYLKQMSWVLVGLAIM
B5YHQ0_THEYD          IDRRLISSFDWVTLGVVLFICIIGILTIYSATRPPLDEG-EQPPFYVKQLIWLIIAIIAL
Q8KFN2_CHLTE          MEKYNKFDLLWLLVPLSGLI-VMGLMAVYSATNGSTESV----PLFYKQLSWAVTGAIAA
A5HZF9_CLOBH          NLKRHIKYFDVFLFIVIILISILGIVMISSATS----NFENSRKYIITQILSLVIGLVFM
A6TMZ7_ALKMQ          RLARKI---DFGLIAVVLIICIIGVMMVGSATE----GALSNR-HIRTQIISVLIGIGAI
Q2RL15_MOOTA          RLWRNL---DYYFVGGVIALLAIGLVVLNSASA---NVMPDPYYFVKKQLIWILFGLVGL
B2A6A7_NATTJ          KLLRNF---DYTLLIVVLLISVIGVIIITSATQL--NPTGDSYYYTRRQIAYIAAGLLVL
Q97JM3_CLOAB          IDKRTLKQIDFLIFLIPIVIAIFSSLNIYSAVHR----NSALASTWKLQLIWCLMGIIAI
RODA_BACSU            YKKQQSPFYQGDLIFIFGVFFIISVVSIYAAGQF----GQYGNTDWIQQIVFYLLGAVAI
                                                                                  

RODA_HELPY            WIVFFIPFRKLGRWLFVFYWACVILLALVDF--MGY--SKLGAQRWLVIPFISITLQPSE
RODA_HELPJ            WVVFFIPFRKLDRWLFALYWACVILLALVDF--MGS--SKLGAQRWLVIPFTSITLQPSE
B2V6L7_SULSY          FLPFLIEYRKFGYISFYLYLVSVILLIFVKF--FGV--SILGAKRWINLGF--FQLQPSE
RODA_ECOLI            VVMAQIPPRVYEGWAPYLYIICIILLVAVDA--FGA--ISKGAQRWLDL-G-IVRFQPSE
Q32IU6_SHIDS          VVMAQIPPRVYEGWAPYLYIICIILLVAVDA--FGA--ISKGAQRWLDL-G-IVRFQPSE
Q7CQZ3_SALTY          VVMAQIPPRVYEGWAPYLYIICIILLVAVDA--FGA--ISKGAQRWLDL-G-IVRFQPSE
A9MKD7_SALAR          VVMAQIPPRVYEGWAPYLYIICIILLVAVDA--FGA--ISKGAQRWLDL-G-IVRFQPSE
A8AJG9_CITK8          VVMAQIPPRVYEGWAPYLYIFCIILLVAVDA--FGA--ISKGAQRWLDL-G-IVRFQPSE
B2VBJ6_ERWT9          LVMAQIPPRVYEGWAPYLYIVCVVLLIAVDT--FGH--ISKGAQRWLDL-G-VVRFQPSE
A0A5P8YIV2_YERPE      LVMAQIPPRVYESWAPYLYFVCVILLILVDA--FGQ--ISKGAQRWLDL-G-FIRFQPSE
RODA_HAEIN            LLMAQFPPRFYQRIAPYLYLIGFVLLILVDV--IGT--TSKGAQRWLDL-G-FIRFQPSE
Q5E6V4_ALIF1          FFLAQISPRAYEAAAPYVFTIGIFLLLGVLL--FGE--ASKGAQRWLNF-G-FVRFQPSE
Q9KTF3_VIBCH          VILAQIPPRTYESAAPILFFCGVILLVCVLL--FGE--ISKGAQRWLDL-G-FVRFQPSE
Q6LN92_PHOPR          FILAQIAPRHYETWAPYLFGVGLILLLGVLF--FGE--ASKGAQRWLNL-G-FIRFQPSE
Q8EHQ0_SHEON          FTMAQINPEALKRWALPIYLAGVVLLLAVHF--FGE--INKGAQRWLNL-G-FMEFQPSE
G3XD88_PSEAE          VVIAQIEPRFMARWVPLGYLVGVALLVVVDV--IGH--DAKGATRWINIPG-VIRFQPSE
Q83DY9_COXBU          FIFAYIPPKFYYHWTPWIFSAGLLLLIGVLI--FGN--ISKGARRWFDL-G-FFHLQPSE
Q7VSM6_BORPE          WAMALVPPNTLMKLALPFYVLGVILLLGVEF--FGE--TSKGATRWLNL-G-VTRIQPSE
Q63YK5_BURPS          WVIANIPPQTLMRFAVPLYSFGVALLVAVAL--FGM--TKKGAKRWLNV-G-VV-IQPSE
Q5GVQ2_XANOR          WGISRMSVLRLRAWTPWVYGLSMLPLLAVFA--LGT--GKYGRQ-WLDL-K-VFYLQPAE
Q8P576_XANCP          WGISRMSVLRLRAWTPWVYGLSMLPLLAVFA--LGT--GKYGRQ-WLDL-K-LFYLQPAE
A5EY25_DICNV          LFIMMVPSVLIRKLTPFLYVITIVLLILVLF--FGS--SAGGAQRWLDL-K-FLRVQPSE
Q5E093_ALIF1          VVMSGISPMHYQRSAPFLYGLAVVLLIGVII--AGD--STNGSQRWLVI-G-PIRFQPSE
Q9A817_CAUVC          VILAMCDLRWWFMAAYPIYVVGLLLLIAVEV--AGD--VSLGAQRWLSI-G-GFRFQPSE
Q2RN22_RHORT          LALACVNVRLIMHAAYAIYGFFLLALVGVAV--FGH--VGMGAQRWLNL-G-VVAVQPSE
Q5FQ66_GLUOX          IAVSLVSPRILRMASMPIYLLSVTLLALVLR--MGH--VGKGAERWINL-A-GMQFQPSE
Q3J405_CERS4          FSVAFVPIWFWRNMAGLAYIVSLALLVVVEF--FGT--VGMGAQRWIAL-G-PVVLQPSE
Q5NQM0_ZYMMO          IAISRIDQGSLKQISWPLYGGLLLLLIFVEL--FGF--VGGGSRRWLNL-G-IMTLQPSE
Q9ZDP7_RICPR          IIIALIDLRTIFRLSYILYFCVLALLIAVEL--FGS--TAMGGKRWIDI-G-IVKLQPSE
Q5SIX3_THET8          FLLQFLSRRRLFGLAYPLYGASLLLLALVLV--VGR--EINGARAWFVLGP--LQFQPLE
D1B5Z4_THEAS          IWVIKVGYRRILEMSERIYGASLLLLFLVLV--MGH--TAKGAQSWFNLGP--VRLQPSE
D1AAV9_THECD          GVVAMLDYRLLRAYAPIVYGLACVGLVAVLSP-LGE--TINGSHSWIVLGGG-FQVQPSE
Q1AVU0_RUBXD          IPLALIDYRFWQRLVKPIYLCVLLMLLAVLV--VGV--AAGGAQRWIDVGP--VQVQPSE
Q7NKJ1_GLOVI          LFLSRLTYGWLQRWSWLIYSSACAMLLGVLF--TGN--SVKGAQRWIEFGG--IQLQPSE
Q8DIK2_THEEB          FLLARVPTSVLISVHWWVYGISCFLLLAVSL--FGV--EANGAQSWLPIAG--FNLQPSE
Q7V9T9_PROMA          LIISRLHLERIRNFLFPLYLITISSLLAVKL--LGV--SALGAQRWLSIGG--LNIQPSE
B8E312_DICTD          AFFATTYYRLWERVWKYVYVINLFLLVMVIF--FGK--ESLGAQRWFSIFG--FSFQPSE
Q8RER8_FUSNN          IGVSLVDYRKYYKYATAIYIFNILMLLSVLV--IGT--SRLGAKRWIDLGP--LALQPSE
Q1IRN2_KORVE          FLLSLVNYHLLLGNAHWMYLVAIVALIAVRV--FGK--KYLGARRWIQIGG--NHFQPSE
RODA_TREPA            LSVSMYDYHRFKDRTTLIFAGFILLLIYTRL--FGR--YVNGAKSWIGVGE--FGIQISE
Q72DZ4_DESVH          ITFMLFDYRHLKSLAWPIFILTVLLLACVPP--FGK--VIYGARRWLSFGL--FNLQPSE
Q74BG3_GEOSL          LLVCSIDYHLLEDVAYWFYGILFLLLLVVLA--FGK--TSMGATRWLHLGF--ISVQPSE
B5YHQ0_THEYD          CVFITFDYIKLKDFWLIFYITGILLLIIVLF--TGK--TAMGAKRWINLGF--FSFQPSE
Q8KFN2_CHLTE          SIIYFMDYRVVKDNAYFMYAAGIILLIAVLV--FGK--KVAGATSWVRFGM--FSFQPSE
A5HZF9_CLOBH          FITIYIDYRNIGRAYKIIYIFNFLLLAGVILL-GTG-KDQWGAQRWIRIGG--IGIQPSE
A6TMZ7_ALKMQ          IAIMLIDYNSLSRMYIPIYILSNALLLAVLVM-GTG-QEQWGANRWIRIAG--FQFQPAD
Q2RL15_MOOTA          VAVLSIDYEQLKHYHLPLYVLNIIMLAAVALV-G---HEAKGAQRWINLGF--FLLQPSE
B2A6A7_NATTJ          LTMLSIDYHSILRIAKPLYIINLLLLTAVFVP-GLGRAAGGGAQRWLSLGI--IDIQPAE
Q97JM3_CLOAB          YIIIKMDYDFLKNYAEIIYGLAVVLLVINDI--FGS--TRNGATGWIAIGQ--RAIQPSE
RODA_BACSU            TVLLYFDLEQLEKLSLYIFIIGILSLIILKISPESIAPVIKGAKSWFRIGR--ITIQPSE
                                        :      *               *   *. .      .*  :

RODA_HELPY            PVKIAILLLLAHLIKINPPPF-----KGYDWGMFLKLSFYICLPAALILKQPDLGTALIV
RODA_HELPJ            PVKIAILLLLAHLIKINPPPF-----KGYDWGMFLKLSFYICLPAALILKQPDLGTALIV
B2V6L7_SULSY          VAKFSMIIFSAYFISNTKLPL-----SFKD---FLKIMGLSAIPFILIYSQPDLGSAILV
RODA_ECOLI            IAKIAVPLMVARFINRDVCP-------PSLKN-TGIALVLIFMPTLLVAAQPDLGTSILV
Q32IU6_SHIDS          IAKIAVPLMVARFINRDVCP-------PSLKN-TGIALVLIFMPTLLVAAQPDLGTSILV
Q7CQZ3_SALTY          IAKIAVPLMVARFINRDVCP-------PSLKN-TAIALVLIFMPTLLVAAQPDLGTSILV
A9MKD7_SALAR          IAKIAVPLMVARFINRDVCP-------PSLKN-TAIALVLIFMPTLLVAAQPDLGTSILV
A8AJG9_CITK8          IAKIAVPLMVARFINRDVCP-------PSLKN-TAIALVLIFMPTLLVAAQPDLGTSILV
B2VBJ6_ERWT9          IAKIAVPLMVARFINRDVCP-------PTLKN-TAIALILIFMPTLLVAAQPDLGTSILI
A0A5P8YIV2_YERPE      IAKIAVPLMVARFMNRDVCP-------PSLKN-TGIALILIFIPTLLVAAQPDLGTSILV
RODA_HAEIN            IVKLAVPLMVAVYLGNRPLP-------PKLSE-TFIAIAMILLPTLLVAIQPDLGTSILV
Q5E6V4_ALIF1          LIKLAVPLMVARYIGNKPLP-------PTVRT-LFFALLMVFVPTIMIAKQPDLGTSILI
Q9KTF3_VIBCH          LLKLAVPLMVARYIGKHALP-------PSFKT-LFASLVMVFVPTILIAKQPDLGTSILI
Q6LN92_PHOPR          LIKLAVPLMVARFISSKPLP-------PTFTN-VVIAVVMIFVPTILIAKQPDLGTSILI
Q8EHQ0_SHEON          LIKLAFPITMAWYISKFPLP-------PKKRY-LAGAGVILLIPTLLIAKQPDLGTSILV
G3XD88_PSEAE          FMKLLMPMTVAWYLSKRNLP-------PGLKH-MVISLAIIITPFVLILKQPDLGTAMLI
Q83DY9_COXBU          IMKLAMPMMLSYYFDNKQLP-------PKIKP-LIISLLLLVFPVILTAKQPDLGTAIII
Q7VSM6_BORPE          MMKIAVPMMLAWYFQRHDGA-------VRIRD-FFVAAAMLAAPFVLIVLQPDLGTALLV
Q63YK5_BURPS          ILKIATPLMLAWYYQRRESS-------LRWYD-FVVAFAILMVPVGLIAKQPDLGTAVLV
Q5GVQ2_XANOR          LLKISLPMMAAWYLHRMPLP-------PRIST-VLVTGMIIGVPTALIMLQPDFGTGVLI
Q8P576_XANCP          LLKISLPMMAAWYLHRMPLP-------PRIST-VLVTCVIIGVPTALIMLQPDFGTGVLI
A5EY25_DICNV          LAKLSVPMMVAWYASRQAQL-------PRSQD-IFAIALFIIFPVWFIFLQPDLGTAILV
Q5E093_ALIF1          LVKVAIPLMVAWILAAEATR-------PDLKK-IGICLLVTAVPAGLIFIQPDLDGAIFT
Q9A817_CAUVC          IMKIGLVLALARYYHGLSADS-----ARMSWR-LLIPAGMIAAPVLLVAHQPDLGTALLI
Q2RN22_RHORT          FMKVGLIVALARYYHHLPNDR-----CTTLLA-ALPAAFLTLLPVGLVFLQPNLGTSILL
Q5FQ66_GLUOX          FAKIGLVLMLATWFHRIGNER-----MGNPLR-LIPPALLTLLPVLLVLKEPNLGTATII
Q3J405_CERS4          MAKVTLVMMLAAYYDWLDPKK-----VSRPLW-VLLPVLIILVPTALVVIQPNLGTALLL
Q5NQM0_ZYMMO          LMKLAIVLAISRFYDLLPAGE-----IRTFSA-MWPAAVLILVPALLVAVQPDLGTALMI
Q9ZDP7_RICPR          PIKISIVLMLARYFHRSTSDD-----ITKLHK-VIIPIIGVLTPAFLIIREPDLGTGMIV
Q5SIX3_THET8          LAKLGLLLALAKALEGRPIAR---------VWDYALPALLTLPVVGLLLLQPDLGGALVV
D1B5Z4_THEAS          LGKLALGVFMARHLCRFPPED---------LRSIGMALGLSGLSLALLMLQPDLGSALVY
D1AAV9_THECD          FAKVGLVVLLAMLLAEPRDGEPRDTDSGPGGRDIVLALALAGGPAVLVLAQPDLGTTMVF
Q1AVU0_RUBXD          FAKLMMVIVLAGYFAGRAVG-----DAGV----FVRSLGVVGAPALLVFLQPDLGTALVF
Q7NKJ1_GLOVI          FAKLGVIIALAALIQRY---------PIRSFGQIWVVLGVLAVPFLLVFKQPDLGTALVF
Q8DIK2_THEEB          FAKISIILTQAALLQRV---------PAHGLSGILRVFAATALPLGLILSEPDLGTSLVF
Q7V9T9_PROMA          IAKISLIIILASILENQ---------KFNSPIQLWRPFVVILIPWFLVFIQPDLGTSLVF
B8E312_DICTD          LSKLLLVISLSGFLTNLDYEK-----KTLGLREFILTLVLVIIPFIVVMIQPDLGTAIVI
Q8RER8_FUSNN          FSKLFLIFTFSAYLINNYSD------RYTGFRAMFMSFLHIFPVFFLIAIEPDLGTSLVI
Q1IRN2_KORVE          WVKLILILAVAKYFAEEKSS------EASGSDIVKVGLLVGVP-FLMVLAQPDLGTALTY
RODA_TREPA            FAKIAYILYLAHYLVYSQS-------EPMLKRFAKAGVITLLP-MALILSQPDLGTASVY
Q72DZ4_DESVH          IAKISILILGARLLSGDKNS-------LNWTELFKVLGV-GLVPAAFIVIQPDLGTTLNL
Q74BG3_GEOSL          PMKIIGIITMARILANIPVSG-----GLGLRELAFPALM-IGAPAILIMKQPDLGTAILV
B5YHQ0_THEYD          IFKIIFIISISAFLEDKQSP-------LSIKDTLKTLLIFGIIPFLLIVKQPDLGTAILI
Q8KFN2_CHLTE          LTKMFTIIAMARFLSDDQTDI------GNMMDLGKALAI-ALVPAGLIMLQPDMGTTLTC
A5HZF9_CLOBH          IAKIGFIITFAKFLELIKDD-------LNKIKYLLAAFCYIGVPIILVMIQPDLGTALSF
A6TMZ7_ALKMQ          FAKIGIIICLAKMIDDNKES-------IHKIPTLMKIIAFAGLPMLLIMRQPDLGTTMAF
Q2RL15_MOOTA          FAKTITVITLACFLDKRQGK-------LNCWQDLVVPFLYVAVPLVLILKQPDLGTALVL
B2A6A7_NATTJ          FAKIIIIITLAKFLVDQKNG-------IEDIYDLILPIGHVLVPMGLIFLQPDLGTAMVF
Q97JM3_CLOAB          FAKIALVIILAKKVDAMKDGI-------NNVKNFFIILIYAAIPTALVLIQPDMGMAMVY
RODA_BACSU            FMKVGLIMMLASVIGKANPKG--VRTLRDDIHLLLKIAGVAVIPVGLILMQ-DAGTAGIC
                        *    .  :                                   .   : : .     

RODA_HELPY            LIMGFGILLIVGLRTRVWLP----------------LFIALLVAS---------------
RODA_HELPJ            LIMGFGILLIVGLRTRVWLP----------------LLIALIVAS---------------
B2V6L7_SULSY          VLPVLVMVFLAKFNIKYIIG----------------FVLTGIILS---------------
RODA_ECOLI            ALSGLFVLFLSGLSWRLIGV----------------AVVLVAAFI---------------
Q32IU6_SHIDS          ALSGLFVLFLSGLSWRLIGV----------------AVVLVAAFI---------------
Q7CQZ3_SALTY          ALSGLFVLFLSGLSWRLIGV----------------AIVLIAAFI---------------
A9MKD7_SALAR          ALSGLFVLFLSGLSWRLIGV----------------AIVLIAAFI---------------
A8AJG9_CITK8          ALSGLFVLFLSGLSWRLIGI----------------AVVLIAAFI---------------
B2VBJ6_ERWT9          AASGLFVLFLSGMSWKLIAV----------------AVLLVAAFI---------------
A0A5P8YIV2_YERPE      AASGLFVLFLSGMSWRLIGV----------------AVVLLAGFI---------------
RODA_HAEIN            SASGLFVVFLAGMSWWLILA----------------AVIGLAGFI---------------
Q5E6V4_ALIF1          AASGIFVIFLAGISWKIITA----------------AAVAVGAFI---------------
Q9KTF3_VIBCH          AASGIFVIFLAGISWKLITA----------------AAVAIGAFV---------------
Q6LN92_PHOPR          AASGVFVLFLSGMSWRIIFA----------------AGALLGAFT---------------
Q8EHQ0_SHEON          AASGIFVLFLSGMSWAIVGG----------------FIAAVLAFL---------------
G3XD88_PSEAE          LASGGFVLFVGGLRWRWIVG----------------AVSAAVPIA---------------
Q83DY9_COXBU          AAAGLCVLLLAGLNWKLILV----------------FLSLGALST---------------
Q7VSM6_BORPE          FGAGFFVIYFAGLSFKLLVP----------------CLLAGIIAIGTLIYYE--------
Q63YK5_BURPS          FAAGLFVIYLAGLSFKLIVP----------------VLVAGVLAVGSIAVFE--------
Q5GVQ2_XANOR          AASGVFVLLLAGLPWWWVAV----------------GVGGVSAAA---------------
Q8P576_XANCP          AASGVFVLLLAGLPWWWVAV----------------GVGGVSAAA---------------
A5EY25_DICNV          TASGIIALFLAGLSWWFLGI----------------LITLTAVIL---------------
Q5E093_ALIF1          VIYALFVLYFAGMSWKIIGS----------------FLATVATAV---------------
Q9A817_CAUVC          AATGLSIVVLAGLSWRIIFA----------------GIAA--------------------
Q2RN22_RHORT          AATGGIIALLGGLPLWTLVV----------------AFTA--------------------
Q5FQ66_GLUOX          GVIGATMFFAAGMRLWQILL----------------LVA---------------------
Q3J405_CERS4          LMVGAAVMFLAGVSLWYFGV----------------VAAMGVGAV------F--------
Q5NQM0_ZYMMO          VAGGIIVCFLAGLPLWLFIG----------------GGVS--------------------
Q9ZDP7_RICPR          LIVAAIIFFAAGFRIKYFII----------------LALA--------------------
Q5SIX3_THET8          LFGVFVVVFVRGLPWRHLL-----------------VGLFALALLVP-------------
D1B5Z4_THEAS          CAMIGAGLWAAGIGSRYM------------------GGLVTLGLMAL-------------
D1AAV9_THECD          GAVVMGMLAVAGVRKRWLAG----------------LAGAAVLAAFA-------------
Q1AVU0_RUBXD          GAVFVVMAYVGGARLWQLGA----------------LGAAGALAAAL-------------
Q7NKJ1_GLOVI          GAISLGMLYWGGARLGWLAL----------------VVSPLMAAILYAIWIP------AW
Q8DIK2_THEEB          AAITLGMLYWANARLGWIVL----------------MLSPLVAAILFALPLPYELNLVLW
Q7V9T9_PROMA          GAVLLIMLYWSGMPLEWLLL----------------FLSGILTAVLVGIFHW------GL
B8E312_DICTD          FATGIFMIFLSEISVKYFLR----------------LI--LLGLLLL-------------
Q8RER8_FUSNN          ILIYGMLLFLNKLEWKCIAT----------------VFFTIAAFIPISYK----------
Q1IRN2_KORVE          LPVAIMGFFLGGMKAKHAVV----------------ILLLVALVIPIAWM----------
RODA_TREPA            LPIFLVMCFIAGFPLRLIFA----------------VVCVVLLTLLFTLLPLWEQTFLQY
Q72DZ4_DESVH          LLLLGGMILYHGIQWRVLK----------------VCLAVVPPLLPLGWFCLHD------
Q74BG3_GEOSL          ILIAGSMLAFVGIRLSALAA---------------VCIATVPAVWLGWHYYLRD------
B5YHQ0_THEYD          LTITFIMIIYKGLRTRLMILILA------------ILIISVFFLWEILWEGLKE------
Q8KFN2_CHLTE          LSFIVPMIVLAGFDLYYILLGVVPVALMLSGFFNLTILATIAVLSMVMFFLLRKKFYLHQ
A5HZF9_CLOBH          VFISIAMIYICGIDYKYILG----------------GFLACIVIIPIAWQ----------
A6TMZ7_ALKMQ          ASFTFGMLFIAGLRYKHILI----------------TGIMGVVSLPFMWF----------
Q2RL15_MOOTA          LAILFGMLYVSGANWKLLLM----------------IFGGGLLLTGLALFAHFH------
B2A6A7_NATTJ          IAILFGGLFFYRVKLKLLGY----------------LIGAGILVGVPSFW----------
Q97JM3_CLOAB          FFTVLGIVFAAGLDLRVIFGG---------------IFGIIVAVV---------------
RODA_BACSU            MFIVLVMVFMSGINWKLIAIIAGSG----------ILLISLILLVMINFP----------
                                                                                  

RODA_HELPY            ---------------------------------------------------------PIA
RODA_HELPJ            ---------------------------------------------------------PIA
B2V6L7_SULSY          ---------------------------------------------------------PFI
RODA_ECOLI            --------------------------------------------------------PILW
Q32IU6_SHIDS          --------------------------------------------------------PILW
Q7CQZ3_SALTY          --------------------------------------------------------PILW
A9MKD7_SALAR          --------------------------------------------------------PILW
A8AJG9_CITK8          --------------------------------------------------------PIMW
B2VBJ6_ERWT9          --------------------------------------------------------PILW
A0A5P8YIV2_YERPE      --------------------------------------------------------PILW
RODA_HAEIN            --------------------------------------------------------PIMW
Q5E6V4_ALIF1          --------------------------------------------------------PILW
Q9KTF3_VIBCH          --------------------------------------------------------PVLW
Q6LN92_PHOPR          --------------------------------------------------------PVLW
Q8EHQ0_SHEON          --------------------------------------------------------PILW
G3XD88_PSEAE          --------------------------------------------------------VAMW
Q83DY9_COXBU          --------------------------------------------------------PILW
Q7VSM6_BORPE          ---------------------------------------------------DQLCEPEVD
Q63YK5_BURPS          ---------------------------------------------------ERICQPEVV
Q5GVQ2_XANOR          --------------------------------------------------------PVAW
Q8P576_XANCP          --------------------------------------------------------PVAW
A5EY25_DICNV          --------------------------------------------------------PVFW
Q5E093_ALIF1          --------------------------------------------------------PLLW
Q9A817_CAUVC          ---------------------------------------------------FVAAIPPFV
Q2RN22_RHORT          ---------------------------------------------------AGVSLPVLW
Q5FQ66_GLUOX          ---------------------------------------------------PLPFMGKLI
Q3J405_CERS4          ---------------------------------------------------SVFSLRGTP
Q5NQM0_ZYMMO          ---------------------------------------------------LAAIAPLAF
Q9ZDP7_RICPR          ----------------------------------------------------ALISMPIA
Q5SIX3_THET8          ---------------------------------------------------------TAV
D1B5Z4_THEAS          ---------------------------------------------------------PVA
D1AAV9_THECD          ---------------------------------------------------------VWF
Q1AVU0_RUBXD          ---------------------------------------------------------ALR
Q7NKJ1_GLOVI          IVWVAAMAVVAWRELDWRWWGA---------------------IGAGAINLVAGGLGQVF
Q8DIK2_THEEB          FLWTLGMGVVAWQSLPLGWIGA---------------------IGGIVLNLSGAGLGQLL
Q7V9T9_PROMA          FLWIPFMGFLAYRSLPKKYLSAF--------------------LTMSTLSGIAISTPWLW
B8E312_DICTD          ---------------------------------------------------------PFF
Q8RER8_FUSNN          ------------------------------------------------------------
Q1IRN2_KORVE          ------------------------------------------------------------
RODA_TREPA            QGVATRIADSRMLSLFVFFSLSATSAVAVVGYLLSGRKYYYWITYALGMVSISYGASLLG
Q72DZ4_DESVH          ------------------------------------------------------------
Q74BG3_GEOSL          ------------------------------------------------------------
B5YHQ0_THEYD          ------------------------------------------------------------
Q8KFN2_CHLTE          FLVTGGGLLGGLLTW------------------------------------------KFT
A5HZF9_CLOBH          ------------------------------------------------------------
A6TMZ7_ALKMQ          ------------------------------------------------------------
Q2RL15_MOOTA          ---------------------------------------------------------FGL
B2A6A7_NATTJ          ------------------------------------------------------------
Q97JM3_CLOAB          --------------------------------------------------------GIWN
RODA_BACSU            --------------------------------------------------------DVAK
                                                                                  

RODA_HELPY            YHFLHDYQKKRIADFLSEKPN--------YHVMQSIIAIGSGGFLGKSK--EACTQ----
RODA_HELPJ            YHFLHDYQKKRIADFLSEKPN--------YHVMQSIIAIGSGGFLGKSK--EACTQ----
B2V6L7_SULSY          WTHLKDYQKNRIIAFLNPESD---PKGTAYHIIQSKIAIGSGMLTGKGY--LQGSQ----
RODA_ECOLI            FFLMHDYQRQRVMMLLDPESD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
Q32IU6_SHIDS          FFLMHDYQRQRVMMLLDPESD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
Q7CQZ3_SALTY          FFLMHDYQRQRVMMLLDPETD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
A9MKD7_SALAR          FFLMHDYQRQRVMMLLDPETD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
A8AJG9_CITK8          FFLMHDYQRQRVMMLLDPETD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
B2VBJ6_ERWT9          FFLMHDYQRDRVMMLLDPESD---PLGAGYHIIQSKIAIGSGGLRGKGW--LHGTQ----
A0A5P8YIV2_YERPE      FFLMHGYQRDRVMMLLDPESD---PLGAGYHIIQSKIAIGSGGLSGKGW--LHGTQ----
RODA_HAEIN            LYLMHDYQRTRVLTLLDPEKD---PLGAGYHILQSKIAIGSGGLSGKGW--MQGTQ----
Q5E6V4_ALIF1          FFLMRPYQKVRVQTLFNPESD---PLGAGYHIIQSKIAIGSGGLLGKGW--LHGTQ----
Q9KTF3_VIBCH          FFLMHEYQKTRVRTLFDPESD---PLGAGYHIIQSKIAIGSGGLSGKGW--LHGTQ----
Q6LN92_PHOPR          FFLMRDYQRTRVLTLFNPESD---PLGAGYHIIQSKIAIGSGGLMGKGW--LQGTQ----
Q8EHQ0_SHEON          YFLMHDYQRTRVLTLLDPEQD---PLGAGYHIIQSKIAIGSGGLWGKGW--LDGTQ----
G3XD88_PSEAE          FFIMHDYQKQRVLTFLDPESD---PLGTGWNIIQSKAAIGSGGVFGKGW--LLGTQ----
Q83DY9_COXBU          HFV-HGYQKERVLTFLNPERD---PLGSGYHIIQSKIAIGSGGLFGKGW--LHGTQ----
Q7VSM6_BORPE          WVVLHDYQKHRVCTLLNPSSD---PLGKGFHTIQSMIAVGSGGLYGKGY--MQGTQ----
Q63YK5_BURPS          WPLMHDYQKHRVCTLLDPTSD---PLGKGFHTIQAVIAIGSGGPLGKGY--LKGTQ----
Q5GVQ2_XANOR          FWLLRPYQKDRIMMFLNPEND---ALGAGWNIIQSKIAIGSGGLNGKGW--GLGSQ----
Q8P576_XANCP          FWLLRPYQKDRIMMFLNPEND---ALGAGWNIIQSKIAIGSGGLNGKGW--GLGSQ----
A5EY25_DICNV          FWGIKDYQRQRILTLFNPEAD---PFGAGYHIIQSKIAIGSGGVFGKGY--MSGTQ----
Q5E093_ALIF1          IFVMEAYQKKRVTQFLDPESD---PLGAGYQIIQSLIAIGSGGIRGKGW--MNATQ----
Q9A817_CAUVC          MFVLHDYQRHRVMTFLNPEAD---PSGKGYQIVQSKIALGSGGLLGKGF--GLGSQ----
Q2RN22_RHORT          SH-MHDYQKARVLTFLNPERD---PLGAGYNIIQSKIALGSGGIWGKGL--LNGSQ----
Q5FQ66_GLUOX          YSHLHDYQKARIDTFLHPEHD---PLGAGYNIIQSKIALGSGGMWGEGY--LHGSQ----
Q3J405_CERS4          WQFLHDYQYRRIDTFFDPTAD---PLGAGYNIIQAKIALGSGGWAGKGF--MQGTQ----
Q5NQM0_ZYMMO          FFLLHDYQRNRVLIFLTPESD---PLGRGYHISQSKIAIGSGGIFGKGF--LNGTQ----
Q9ZDP7_RICPR          WNMMYDYQKKRVMVFLNPEHD---PLGASYNIIQSKIAIGSGSLFGRGL--NQGSQ----
Q5SIX3_THET8          WPNLKPYQRERVLIVLDPYRD---PLGQGFQVIQSTIAIGSGGLFGKGY--GQGTQ----
D1B5Z4_THEAS          WGFLKPYQRMRLLVFIDPKVD---PLGAGYNVIQSRIAVGSGGLFGKGF--MGGTQ----
D1AAV9_THECD          FGLLKPYQIARFTAFIDPEAD---PRGAGYNAQQARIAVGSGGLTGKGL--FEGEQ----
Q1AVU0_RUBXD          FRLLEEYQIARLTAFLDPES----AGEIGYQVTQSKLAIGSGGLTGKGL--DATTL----
Q7NKJ1_GLOVI          WHLLKPYQQQRLVVFLDPSGD---PLGSGYHILQSEIAIGAGGLWGRGI--FQGTQ----
Q8DIK2_THEEB          WSVLKDYQKDRLLMFLDPDKD---PLGAGYHLIQSRIAIGAGGLWGRGL--FHGTQ----
Q7V9T9_PROMA          INALKDYQRDRLILFLDPGKD---PLGGGYHLIQSTIGIGSGGLFGTGL--LQGQL----
B8E312_DICTD          WLILKPYQQQRIITFLDPMKD---PLGSGYQVIQSLIAIGSGGIWGKGW--FQGTQ----
Q8RER8_FUSNN          -FLLKGYQKDRIDTFLNPELD---ALGTGWNITQSKIAIGSGKIFGKGF--LNNTQ----
Q1IRN2_KORVE          -KVLKPYQKDRLTSFVDPEAD---PQKAGYQVLQSLVAVGSGGLTGKGI--RKGSQ----
RODA_TREPA            VRVLKPYQMMRLIIFLNPEVD---PLKAGWHIIQSMIAIGSGGAFGMGY--LRGPQ----
Q72DZ4_DESVH          ------YQKQRILTFLDPQND---PLGAGYHIIQSQIAIGSGELWGKGF--LGGTQ----
Q74BG3_GEOSL          ------YQKNRVLNFLDPERD---PLGTGYHIIQSKIAVGSGGLFGKGF--LQGTQ----
B5YHQ0_THEYD          ------YQKNRLIAFIDPNID---PKGIGYNIMQSVITVGSGGLFGKGF--LEGTQ----
Q8KFN2_CHLTE          SVILKPHQIKRIQIFLDPTAD---PRGAGYNALQAKIAIASGGIFGKGF--LHGTQ----
A5HZF9_CLOBH          -YVLKAYQKNRILIFINPDS---DPMGGGYHVLQSKIAVGSGEFFGTGL--FKGS-----
A6TMZ7_ALKMQ          -VVLKGYQQQRILTFLNPEL---DPQGAGYHIIQSKITVGAGRTLGMRLENFLGINPPST
Q2RL15_MOOTA          PLPLQDYQMRRLVVFLNPYNDGKGGTGEGYHVIQSQIAIGSGGWWGVGL--HQGSQ----
B2A6A7_NATTJ          -LLLHEYQRQRLIVFLNPSN--IDPLGDGFHLWQSMVAIGSGGITGKGL--FEGTQ----
Q97JM3_CLOAB          TSLMQQYWKARLTSFLNPEKY---SSSTGLQLIQSKIAIGSGGIFGKGF--LKGTQ----
RODA_BACSU            SVGIQDYQIKRVTSWVSASNETQEDSNDSWQVDQAIMAIGSGGILGNGI-----------
                            :   *.   .              :  *:   :.:*   *              

RODA_HELPY            ---TKFKFLPIATSDFIFAYFVERFGFLGAMLLFAIYIGLSLHLFFYLFESNS-DWFLKI
RODA_HELPJ            ---TKFKFLPIATSDFIFAYFVERFGFLGAILLFAIYIGLSLHLFFYLFESNS-DWFLKI
B2V6L7_SULSY          ---SKYYFLPEQHTDFIYATIGEEWGFVVSFLILTVYFILSLRIFYIGMKTN--ELFGKF
RODA_ECOLI            ---SQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQ--TTFGRV
Q32IU6_SHIDS          ---SQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQ--TTFGRV
Q7CQZ3_SALTY          ---SQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQ--TTFGRV
A9MKD7_SALAR          ---SQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQ--TTFGRV
A8AJG9_CITK8          ---SQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQ--TTFGRV
B2VBJ6_ERWT9          ---SQLEFLPERHTDFIFAVLAEELGLVGVLVLLILYVLLILRGLVMAARAQ--TTFGRV
A0A5P8YIV2_YERPE      ---SQLEFLPERHTDFIFAVLAEELGLIGVLVLLGLYLCLIMRGLVIAANAQ--TTFGRV
RODA_HAEIN            ---SQLEFLPEPHTDFIFAVMGEEHGMIGFLILMAIYLFIIVRGLMIAVNAQ--TSFGRI
Q5E6V4_ALIF1          ---SQLEFIPERHTDFIFAVIAEEWGLIGVIALLALYLFIIGRGLFLASQAQ--TAFGRM
Q9KTF3_VIBCH          ---SQLEFLPERHTDFIFAVIAEEWGMIGILVLLSLYLFIIGRGLYLASHAQ--TSFGRM
Q6LN92_PHOPR          ---SQLEFLPERHTDFIFAVIAEEWGLIGVACLLSIYLFIIARGLMLASRAQ--TAFGRM
Q8EHQ0_SHEON          ---SQLEFIPERHTDFIFAVIGEEFGLIGSIILLLMYLYIIGRGLVIASNAQ--TSFARL
G3XD88_PSEAE          ---SHLDFLPESHTDFIIAVLGEEFGLVGVCLLLVLYLLLISRGLVITAQAQ--TLYGKL
Q83DY9_COXBU          ---SHLQFLPAHATDFIFAVTGEELGLIGCLALLILFLAVFGRGFYISSQAQ--DTFTRL
Q7VSM6_BORPE          ---THLDFIPERTTDFIFAVYAEEFGLYGGVALLVLYGLFMARGLAIASRAS--SQFGRL
Q63YK5_BURPS          ---AHLEFIPEKHTDFIFAVFSEEFGLVGGLVLLTLYMALIARGLYIAAQGA--TLFGRL
Q5GVQ2_XANOR          ---SHLNFIPEQTTDFAFSVLSEEFGWIGVATVLTLYLIVIGRCLWIASQAR--DTYSRL
Q8P576_XANCP          ---SHLNFIPEQTTDFAFSVLSEEFGWIGVATVLTLYLVVIGRCLWIASQAR--DTYSRL
A5EY25_DICNV          ---SQLAFLPESSTDFIFAVLAEEHGLIGVTILLTIYLLIILRGLYLSTRLT--DRFACI
Q5E093_ALIF1          ---GHLGFIPESHTDFIFSTYAEEWGFFGCALLLSLYLFITGRVIWLAYQSE--STFTRL
Q9A817_CAUVC          ---SQLNFLPEKQTDFIFATLAEEFGFVGCFAVLFLYGAVIFMALRIASISH--SHFGRL
Q2RN22_RHORT          ---SQLGFLPEKHTDFIFVVIAEELGMFGGMLILGACCAIVIYGYIVAARTK--YVFGRL
Q5FQ66_GLUOX          ---GQLNFLPEKQTDFIFTMIGEEWGFVGGIAVITLLGTLVMGGMLIAIRSR--NQFGRL
Q3J405_CERS4          ---SRLNFLPEKHTDFIFNTLAEEFGFVGAASLLVLYALVIAFCVASAMQNR--DRFSSL
Q5NQM0_ZYMMO          ---SHLDYLPERHTDFVFATMAEEWGLIGGLFIIVSFMIIISWGMKVALNAP--SRFAKL
Q9ZDP7_RICPR          ---SHLDFLPEHQTDFIFATFAEEFGFIGSMLLLILYFALITISLLIGINCR--EIFSKL
Q5SIX3_THET8          ---AQLGFIPFRHTDFVFSVWAEEWGFVGVVGLLGLYGLLLARLFALALACP--RLSDRL
D1B5Z4_THEAS          ---GRLHFLPEPHTDFIFSVFAEEFGFVGGVAAVLLFVALIWRIFQIAFEAR--DLRAKV
D1AAV9_THECD          ---TGGHFVPEQQTDFIFTVAGEELGFIGSALLIGLLGVVLWRGLRIATAAA--DPFGAL
Q1AVU0_RUBXD          ---ANLGFLPEDHTDFIFANLAERVGFAGSFLLLLLFFLLIWRILHIATISR--DRFGVL
Q7NKJ1_GLOVI          ---TQLNFIPEQHTDFIFSALGEEWGFLGAVVLLGLFFCLFARLLLIAQNSA--DDFGSL
Q8DIK2_THEEB          ---TQLGFIPEQHTDFIFSAIGEELGFWGGLLVLGLFWLIGLRLLQIANSAR--DDFGSL
Q7V9T9_PROMA          ---TKLRFIPEQHTDFIFSALGEEIGFFGTMFVSIAFLLFIFRLLTIARNAY--TNFESL
B8E312_DICTD          ---THLNLIPEQHTDFIFSAIGEEFGFIGSLFVVFLYYLLFRYTWEIWGSLK--DKFGKY
Q8RER8_FUSNN          ---GKLKYLPESHTDFIGSVFLEERGFLGGSMLLLIYIVLLVQIIYIADTTE--DKFGRY
Q1IRN2_KORVE          ---TQGSFLPIPQTDFIFAAFSEEHGFVGAIFLLLLYFVVLMRLIHDAQTAP--DRAGTF
RODA_TREPA            ---SHYRFLPQQSTDFIFSILSEEWGFVGGVIVFGLYLLFFLHTLSIMSHVD--DLYGKL
Q72DZ4_DESVH          ---SQLRFLPEKHTDFAVAVFGEEWGFVGCVALLALFSLFLLSIFNTARDAK--DRFGST
Q74BG3_GEOSL          ---SQLRFLPEQHTDFAFSVFAEEWGFVGSLVVLLLYAVLTLWGLQIARRCN--DRFGSL
B5YHQ0_THEYD          ---GPLKFLPERHTDFIFPIFAEEWGFIGCLILLSLYFTFFIRCFQTSIIAK--NNFGKL
Q8KFN2_CHLTE          ---TQLRYIPAQWTDFIFCVIAEELGFLGSTLLLLLFAALVLRLVWMVGAIK--NRFVEL
A5HZF9_CLOBH          ---HAQNFLPEKHTDFIFALIGEELGFIGSIIVVLLLLIIVLRCISIAKSAK--DNLGCY
A6TMZ7_ALKMQ          TFFHHFGFLPEKHTDFIFSVIAQELGFVGSIVLLILYAILLIKCMNVAREAK--DDFGKY
Q2RL15_MOOTA          ---VQLNFLPEAHTDFIFSVVGEELGFVRTVGIIALYFLVLYRMIRIAGQAK--DMFGAL
B2A6A7_NATTJ          ---NKLEFLPEAHTDFVFSVIGEEFGLIGASIVLLLFLILIYRILKIAYLSK--DFYGTV
Q97JM3_CLOAB          ---IQGGYIPENYTDFIFSVVGEEWGLIGAIVLMLLYIILIYRIIKMSKNSK--DAFGKI
RODA_BACSU            --SNLKVYVPESTTDFIFSIIGESFGFIGCAIVVIMFFFLIYRLVVLIDKIHPFNRFASF
                              :*   :**      :  *             .                    

RODA_HELPY            VALGISILIFVYSSVNIAMTLGLAPVVGIPLPLFSYGGSSFITFMILFGILENLLAFRYI
RODA_HELPJ            VALGISILIFVYSSVNIAMTLGLAPVVGIPLPLFSYGGSSFITFMILFAILENLLAFRYI
B2V6L7_SULSY          LCYGIASIIGFQAFINIAMNVGMAPVVGVPLPFLSYGGTALIMFSLMIMMVLNIEYINKK
RODA_ECOLI            MAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKM
Q32IU6_SHIDS          MAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKM
Q7CQZ3_SALTY          MAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKM
A9MKD7_SALAR          MAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKM
A8AJG9_CITK8          MAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKM
B2VBJ6_ERWT9          MAGGMMLIFFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIIMSIHTHRKL
A0A5P8YIV2_YERPE      MVGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALVVLMAGFGIVMSIHTHRKM
RODA_HAEIN            LAGATTLIFFVYVFVNIGMVSGILPVVGVPLPLFSYGGTSYVAIMASFGLLMSIHTHKSQ
Q5E6V4_ALIF1          MGGSVVLSFFVYIFVNIGMVSGILPVVGVPLPLVSYGGTSMVTLMAGFGILMSIHTHRKV
Q9KTF3_VIBCH          MAGSIVLSFFVYVFVNIGMVSGILPVVGVPLPLISYGGTSMVTLMAGFGILMSIHTHRKA
Q6LN92_PHOPR          MAGSIVLSFFVYVFVNIGMVSGILPVVGVPLPLISYGGTSMVTLMAGFGILMSIHTHRKM
Q8EHQ0_SHEON          LAGSITLTFFVYVFVNIGMVSGILPVVGVPLPLVSYGGTSMLTLMTGFGILMSIHTHRRF
G3XD88_PSEAE          LAGGITMTFFVYVFVNIGMVSGLLPVVGVPLPFISYGGTSLVTLLSGFGVLMSIHTHRKW
Q83DY9_COXBU          LSGSLSLTFILCTFINIGMVVGILPVVGVPLPLISYGGSSIITTMAGFGMIMSIHTHRKL
Q7VSM6_BORPE          LAGAITMMMFIYVFVNVGMVTGILPVVGVPLPFMSYGGTALLTMGIACGILMSISR-RRP
Q63YK5_BURPS          LAGSLTLAFFVYAFVNIGMVSGVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRL
Q5GVQ2_XANOR          VAGATGLAFFVYVVVNGGMISGVLPVVGVPMPLMSYGGTSAVSLLAGLGLVMAVKSHRPV
Q8P576_XANCP          IAGATGLAFFVYVLVNGGMISGLLPVVGVPMPLMSYGGTSAVSLLAGLGLVMAVKSHRPV
A5EY25_DICNV          LSGSVFLTFFINVFVNIGMVSGFLPVVGLPLALISYGGSSILSLMVAFALAMNVHAGFMS
Q5E093_ALIF1          VSSTFALSFFLYAFINMGMVSGLLPVMGSPLPFFSYGGTAMITQGICFGIVMSLCLYKPY
Q9A817_CAUVC          AAGGTISTFAVYVLINGAMVMGMAPVVGVPMPMLSYGGTVMLTVMIGFGLIQAVRVHRYT
Q2RN22_RHORT          CAVGVASSFFLYVFVNLAMVMGLIPVVGIPLPLVSYGGTVMIAVMVSAGLLLNISIRPRL
Q5FQ66_GLUOX          LGLGIAMDFFLYCAVNLSMVMGAIPVGGVPLPLISYGGSAMLTMMFGFGLLMSAWVHRNE
Q3J405_CERS4          LILGIAANFFFYLAVNLSMVMGMAPVVGVPLPLVSYGGSAMLVLMVAFGLVQSAHVHRLR
Q5NQM0_ZYMMO          TAAGLSSTIFFYVAINLAMVMGMAPVVGIPLPLVSNGGSAMMNVMICLGLLMAIDRWTRY
Q9ZDP7_RICPR          MVIGITSILFSHVFINIAMVMGLLPVVGVPLPFISYGGTMMASMLIGFGLVMNAQVHVHT
Q5SIX3_THET8          FLSGFAGMLGFQVVVNLGVALGVMPVTGLTLPLFSYGGSSLIATLAGLGLVLLVHRDRYQ
D1B5Z4_THEAS          LCSMLGAWMFFQTFESIAMSMGLAPVTGLPLPLFSYGGSSLVAEMLALGLVQSVAVESRR
D1AAV9_THECD          VAAGVVCWLGFQTFENIGMTLGIMPITGLPLPLVSYGGSATFANMIALGLLQAVHLRARP
Q1AVU0_RUBXD          ISVGVATIFLFHVFVNVGMTMGIMPVTGIPLPFISYGRSSLVVSVLSLGLLQSVAMRSRA
Q7NKJ1_GLOVI          LTIGVFTMLLFQTVVNIGMTIGLAPVTGIPLPFVTFGRSFLITCFTAIGLVESVALHRTK
Q8DIK2_THEEB          LAIGLFAMLMFQAVVNIGMTINLFPVTGIPLPFLSYGRSALLATYIGLGLVQAVANHRPR
Q7V9T9_PROMA          IVIGIATMILFQVAVNIFMTIGLGPITGIPLPFMSYGRTALIASFIGLGLCLSVS-RRAK
B8E312_DICTD          IVGGILFCWFFQTFINLCMVSGISPVVGIPLPFISFARTSLITNYAMLGLIVNIYVRGER
Q8RER8_FUSNN          ICYGIATIFFFHIFVNMGMIMGIMPVTGLPLLLMSYGGSSLVFSFLILGVVQSVRIHRGS
Q1IRN2_KORVE          IVMGVVAVLAFHILVNVGMVVGFMPVTGIPLPLMSYGGSSVLFMFLALGIVMNVRMRRFV
RODA_TREPA            IASGVLGMFLFHFVVNVGMTMGIMPITGIPLLLLSYGGSSLWTAMIATGLLMSINARQL-
Q72DZ4_DESVH          LAAGVFFYFFWQILINTGMVVGIMPVVGIPLPFISYGGSATLVNFSLIGLVLNVSMRRFV
Q74BG3_GEOSL          VAVGVTAMLFWHIIINIGMVIGLFPVVGVPLPLFSYGGTSMITSMTGIGILLNISMRRFM
B5YHQ0_THEYD          LALGFTSIFILYFFINIGMTLGIMPVVGIPLPFMSYGGTTLLANFIGIALVINVRMRRFE
Q8KFN2_CHLTE          LLAGYASLLLTHVVINIGMTIGVMPVIGVPLPFISYGGSSLVANMMMVGLAMNFSKNRRH
A5HZF9_CLOBH          ICVGVASMIIFQTFINIGMCIGIMPVTGIPLPFISYGGSSLITNFVAMGLVLNVGLRHKP
A6TMZ7_ALKMQ          IVTGITFMLAFHIIANIAMTIGLMPVTGKPLPFVSYGGTFMLSNMIALGLVLNVNMRRDK
Q2RL15_MOOTA          LVGGVASMFAFHILVNVGITTGIMPVTGIPLPLFSYGGSAMLANMLALGLVLNVNLRRQK
B2A6A7_NATTJ          ICGGVATMLLFQMVVNVAMTVSMMPVTGLPLPFISYGGSGYLMNMMAIGLVLNVGMRRHK
Q97JM3_CLOAB          FCVGMASTFLFSVYQNMGMTIGIAPISGLTLPFMSYGGSSMFTAFIAIGIILSIGVRKNK
RODA_BACSU            FCVGYTALIVIHTFQNIGMNIGIMPVTGIPLLFVSYGGSSTLSTLIGFGIVYNASVQLTK
                                     .  :  .  *: * .: :.: . :          :          

RODA_HELPY            FGYNSKPSFGNFGFLAQLVRALGS
RODA_HELPJ            FGNNSKPSFGNFGFLAQLVRALGS
B2V6L7_SULSY          EG---------FRFHSQDALNY--
RODA_ECOLI            LSKSV-------------------
Q32IU6_SHIDS          LSKSV-------------------
Q7CQZ3_SALTY          LSKSV-------------------
A9MKD7_SALAR          LSKSV-------------------
A8AJG9_CITK8          LSKSV-------------------
B2VBJ6_ERWT9          LSKSV-------------------
A0A5P8YIV2_YERPE      LSKNL-------------------
RODA_HAEIN            FMKRS-------------------
Q5E6V4_ALIF1          HSKAN-------------------
Q9KTF3_VIBCH          FSKTI-------------------
Q6LN92_PHOPR          LSKAT-------------------
Q8EHQ0_SHEON          VDR---------------------
G3XD88_PSEAE          IAQV--------------------
Q83DY9_COXBU          WTS---------------------
Q7VSM6_BORPE          APA---------------------
Q63YK5_BURPS          MKS---------------------
Q5GVQ2_XANOR          HGY---------------------
Q8P576_XANCP          HGY---------------------
A5EY25_DICNV          DKEQEQL-----------------
Q5E093_ALIF1          KPNRPDRL----------------
Q9A817_CAUVC          EVTSGKGSLV--------------
Q2RN22_RHORT          R-----------------------
Q5FQ66_GLUOX          RDPGTEDDDDD-------------
Q3J405_CERS4          ------------------------
Q5NQM0_ZYMMO          PKKGF-------------------
Q9ZDP7_RICPR          TLN---------------------
Q5SIX3_THET8          D-----------------------
D1B5Z4_THEAS          ERFDLPGS----------------
D1AAV9_THECD          FPA---------------------
Q1AVU0_RUBXD          EVAKHPKP----------------
Q7NKJ1_GLOVI          MVFPN-------------------
Q8DIK2_THEEB          SRY---------------------
Q7V9T9_PROMA          LFHRN-------------------
B8E312_DICTD          QLI---------------------
Q8RER8_FUSNN          K-----------------------
Q1IRN2_KORVE          N-----------------------
RODA_TREPA            ------------------------
Q72DZ4_DESVH          FKTN--------------------
Q74BG3_GEOSL          F-----------------------
B5YHQ0_THEYD          LFYP--------------------
Q8KFN2_CHLTE          IGY---------------------
A5HZF9_CLOBH          INFFKGSINN--------------
A6TMZ7_ALKMQ          INF---------------------
Q2RL15_MOOTA          ILF---------------------
B2A6A7_NATTJ          IMF---------------------
Q97JM3_CLOAB          INF---------------------
RODA_BACSU            YRSYLFNS----------------