CLUSTAL format seed alignment for MF_02080

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D0KXX8_HALNC          ----------MSRIIPAANQRRPAPMEKGALGRFFAWVGGCWRTVMVLGLFGVLALILVG
B7J3V8_ACIF2          ------------------MTQPGAPLLPLPTVMLPAWRATALWVIVALGLAAVME-----
Q83F33_COXBU          ----------------------------MSNPVQRAWRFYALWFLLSVAVAGLLW-----
A0A0P9SFL7_9PSED      -------------------------------MMKLDGALYPWRFRVVVGLLVSLVLAICW
Q87WX9_PSESM          --------------------------------MKLEGALYPWRFRVVVGLLVSLVLAICW
I4K1J3_PSEFL          -------------------------------MMKLEGALFPWRFRLVLGLLGIMVAAISW
B1J1Y4_PSEPW          -------------------------------MMKLEGALYPWRFRVVIGLLALMVGAICW
FTSI_PSEAE            -----------------------------MKLNYFQGALYPWRFCVIVGLLLAMVGAIVW
Q8PCK5_XANCP          -----------------------MCAMKAGRNRPRSNFNLRGRLTLVGVALGLCSVTLIG
Q5GW36_XANOR          -----------------------MGAMKTGRNRTRSNFNLRGRLTLVGIALGLCSVTLIG
H8L356_FRAAD          -------------------------------------------MALVMGLFGLIALGLVA
C5BP40_TERTT          -----------------------------------------MVFVMASLPLALVWHLAKL
K0BZN7_CYCSP          --------------------MKYSHQQSNNTVQKVIVPELAGRRRFILACFMLMMCVLIY
Q604V2_METCA          --------------------MMYITNPQR-------ESDYGARWSLLLIGMMASMLVLVG
PBP2_NEIMB            -----MLIKS-----------EYKPRMLPKEEQVKKPMTSNGRISFVLMAIAVLFAGLIA
Q5F6K9_NEIG1          -----MLIKS-----------EYKPRMLPKEEQVKKPMTSNGRISFVLMAMAVLFACLIA
A0A1E9M4S0_9NEIS      -----MLIKN-----------EYKPQMLSGTTKTKKPLTSNGRIGLVLGAVALAFTGLLV
B1YSR8_BURA4          -------MKP---------SQKR-QDVKFSSSPVLGVHLPMWRSKLVVFMLFMAFVALAA
Q63QJ1_BURPS          -------MKP---------ASKRTQGVKFASSPVLSVHLPMWRSKLVVFMLFIAFVALAM
Q0K6L8_CUPNH          ----MSMARPNPPRRDRNGTASRPRSGQFSASPVLGLRLPMWRSKLVVFLMFAAFGALAL
U3QLX4_RALPI          ----MSMARPNPPRRDRNGTASRPRSGQFSASPVLGLRLPMWRSKLVVFLMFAAFAALAV
A4SV68_POLAQ          -------MRP----------------VGFSTTPNLVLRLPMWRSRLMLFLLFFVFMLLLI
B1XT03_POLNS          -------MRP----------------VGFSTTPNLVLRLPMWRSRLMLFLLFFVFMMLLL
I0HMQ2_RUBGI          ----MSSRRKS--------GGASVRSVNYATSPLLASKTPPWRSRFVVAMVAASFALLLG
Q63KZ4_BURPS          ----MRLNKK---------PKSSDPYVAVAKNPMLSSSLPMWRSKFVVILVFLAFGALIA
Q7VUP8_BORPE          -------MRR----------------VPFFDNPVLRGQLPMWRARLVLILLFGGFVVLAG
N8X3T7_ACIGI          ------------MADKQTKPTRQPRKKQPSITQKSTVSIDMWRFYLMWGVVLLCFVGLVG
N9HFX1_ACILW          ------------MVDKRKK---QPVRKKQSVTDKNASNVYINRFYIMWAVVLLCFVTLIC
FTSI_ECOLI            ------------------MKAAAKTQ--KPKRQEEHANFISWRFALLCGCILLALAFLLG
Q32K08_SHIDS          ------------------MKAAAKTQ--KPKRQEEHANFISWRFALLCGCILLALAFLLG
Q7CR83_SALTY          ------------------MKAAAKTQ--KSKRQEEQTNFISWRFALLCGCILLALVFLLG
A9MQC8_SALAR          ----------------------MTRI--NSKRQEEQTNFISWRFALLCGCILLALVFLLG
A8ALL2_CITK8          ------------------MKAAAKTL--KPKRQEEQANFVSWRFALLCGCILLALGFLLG
A0A3N4B5A3_YERPE      ------------------MKTARPG---KLKRQEEQASFISWRFALLCGCILLALVGLIM
B2VD88_ERWT9          ------------------MRAAKKTQKQKAKRTEDQASFVSWRFALLCGCIFLGLVGLLL
Q7CQD7_SALTY          ---------------------------MKKKSDGDTRNFTPIRFALLCTAILLSMALLLG
A9MNI7_SALAR          ---------------------------MKKKSGGDTRNFTPIRFALLCTAILLSMALLLG
A8AFN2_CITK8          ---------------------------MKKKSDGAVRNFAPIRFVLLCVAILLSMGLLLG
A6TAZ4_KLEP7          --------------------------MVLKKKTKSAASFTPIRFGLLCVAILGCLGLLLV
E3DGY1_ERWSE          ----------------------MPPLRQSLAKSQTAPTFNPLRFRLVCLGVFSCLVFLLL
B2VFT4_ERWT9          ----------------------MPPLRKSLDKSQPAPTFNPLRFRLVCLGVLTCLVFLLL
H2IPU0_RAHAC          ----------------------MPP---SLKKSSAQPNFYTKRFALICLGIVCCLALLLG
D4E674_SEROD          ----------------------------------------------------------MF
FTSI_BUCAI            ----------------------MYKKEKNRFLKSKQINYINWRFFLLYGFIFLSLFILTL
FTSI_BUCAP            ---------------------MNLFKEK----KIKKIIYINWRFVTLCSIVFLFLVILTL
FTSI_BUCBP            ---------------------MKYFFQNKKNIHIKNETFNN-RITILLSLIIITIILVLS
FTSI_HAEIN            MVKFNSSRKSGKSKKTIRKLTAPETVKQNKPQKVFEKCFMRGRYMLSTVLILLGLCALVA
Q9KPG1_VIBCH          --------------MKKKAPAKASRVSPRVTTAEPAPIFIRWRFYLLLFFVLTAFCALVA
Q5E2P4_ALIF1          --------------MKLPNRKKNNK---RITKAPPT--FIQWRFGVIVFFVFLALAILIA
Q6LMF0_PHOPR          --------------MALFKSAKTKN--QRRQKAPSA--FIPWRFGVICGCIFLALVGLIG
W0A3X2_AERHY          --------------MTRKAATKAPAKDKAKAKAPSL---YPWRFRTLVFFIGIAFAGLIL
B1KKY3_SHEWM          ------------------------MSKQAKRKKKPQ--LIQWRLYVVVAFVCLLFTSLIG
Q8E9P2_SHEON          -------------------MIRQAKTKQASKKQKPQ--LIHWRLYVVVGFVFAMFTCLVG
E1SMJ9_FERBD          -------------MTRRKINKPSNKSKQAKQKLKPT--PFLWRLRLVTFAIALVFSGIVA
K0D3G6_ALTMS          --------------MSTTALSRQRKKTGAKQNVTPS--LVHWRFVVVLVVIMLVFSVLAA
F5ZBR0_ALTNA          --------------MTTSTVKRSRKASGAKQNVTPS--LVHWRFVVVLIVVISVFAALAA
Q47VQ3_COLP3          -----------------------MNKKAAKNNNPLN--TAPWRYYLVLAVVALIYISLMA
A1SU13_PSYIN          --------------MKIKRHLKKQKMALKTPGKNVYETFSSWRYIFVSITVATIALLLIS
Q5NGX9_FRATT          ----------------------------------MSSYRPKLRHFVVIILLLLSFIVLFI
                                                                                  

D0KXX8_HALNC          RAVQLQVSEQGFYVQQGGDRQQRAQVIPAHRGMITDRNGDPLAISVPMDAVWVNPTELTR
B7J3V8_ACIF2          EAWQAQVERGPFLRSQGAQRYLRHFALPAQRGAVLDRSGKPLALSVPVQTLWVDPRLFDA
Q83F33_COXBU          RLIDLNVLDRSFLLRQSKARVLRVVNIPAYRGMITDRLGVPLAISTPVDSVWINPQLFQA
A0A0P9SFL7_9PSED      RIVDLQVIDHTFLKEQGDARSLRHIPIPAHRGLITDRNGEPLAVSTPVTTLWANPREMQQ
Q87WX9_PSESM          RIVDLQVIDHTFLKEQGDARSLRHIPIPAHRGLITDRNGEPLAVSTPVTTLWANPREMQQ
I4K1J3_PSEFL          RIIDLQVVDRDFLKGQGDARSVRHIPIPAHRGLITDRNGEPLAVSTPVTTLWANAKEMQL
B1J1Y4_PSEPW          RIIDLQVVDRDFLKGQGDARSLRHIPIPAHRGLITDRNGEPLAVSTPVTTLWANPKEMQA
FTSI_PSEAE            RIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTTLWANPKELMT
Q8PCK5_XANCP          RAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGEPLAVSTPVESIWVNPQELLR
Q5GW36_XANOR          RAAFVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGEPLAVSTPVESIWVNPQELLR
H8L356_FRAAD          RAFDLQVVSKGFYQAQGDSRFLRVMPISVSRGAIFDRNGEPLAVSTPVVSIWAIPGEVLG
C5BP40_TERTT          QVVPAQDKGYEFLQSEGEARTQRSEVLNAYRGVITDRNGELLAVSTPVTSIYANPQRLN-
K0BZN7_CYCSP          RAIDLQVLNNSYLQKRGEAVHLRDIKLPAYRGKITDVGGHALAISAPVSSVWVNPQELEL
Q604V2_METCA          RAVDLQVVDRQFLKHQGDLRHMGVVPLPAHRGRILDRNGDLLATSCPVKSIWVNPKEFEA
PBP2_NEIMB            RGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTVSDRNGAVLALSAPTESLFAVPKEMKE
Q5F6K9_NEIG1          RGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPTESLFAVPKDMKE
A0A1E9M4S0_9NEIS      RGVYLQTSQHEFLKNQGDQRFVRTLPLPASRGMITDRNGATLALSAPTESLYAMPSGMEE
B1YSR8_BURA4          RAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPDAVPD
Q63QJ1_BURPS          RAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPADVPD
Q0K6L8_CUPNH          RAAWIQGPGNQFYEAEGKKRFQRTLELPATRGKILDRNGLVLATSLPVKAVWAVPEDVPN
U3QLX4_RALPI          RAAWIQGPGNQFYEAEGKKRFQRTLELPATRGKILDRNGLVLATSLPVKAIWAVPEDVPN
A4SV68_POLAQ          RAFWIQGPGNAFYEAKGVRGTQRELELPASRGKILDRNGQVIATSLEAKSVIAYNDTVPD
B1XT03_POLNS          RAFWIQGPGNAFYEAKGVRGTQRELELPASRGKILDRNGQVIATSLEAKSVIAYNDAVPD
I0HMQ2_RUBGI          RAVWVQVVGNDFYQKQGEKRYAHTLSLQASRGRVLDRNGLVLASSVPSPSIWAIPKDLQA
Q63KZ4_BURPS          RAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALLAVSLTTYEIWANPKQVDE
Q7VUP8_BORPE          RALFLQGLSTEFLQQQGERRYERTLTLAATRGKILDRNGVVLASSVPARAIWAIPEDAKP
N8X3T7_ACIGI          RAFYVQVINKDFLQNKANANILRSETLKAMRGVISDRHGVPLAISSPIMKVVIDPREYFE
N9HFX1_ACILW          RAFYVQIINKDFLQNKANANILRTNTIKAMRGVIYDRNGIPLAISTPIMKIVIDPRDYFD
FTSI_ECOLI            RVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHD
Q32K08_SHIDS          RVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHD
Q7CR83_SALTY          RAAWLQIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHD
A9MQC8_SALAR          RAAWLQIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHD
A8ALL2_CITK8          RVAWLQIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKELHD
A0A3N4B5A3_YERPE      RTAYLQVINPDKLVREGDMRSLRVQEVPTARGMISDRSGRPLAVSVPVNAVWADPKELIE
B2VD88_ERWT9          RVAYLQVINPDRLVREGDMRSLRVQAIPTSRGMISDRAGRPLAVSVPVNAIWADPKELHD
Q7CQD7_SALTY          RVAWLQIVTPSKLVKQEDMRSLREVTTASPRGMITDREGRPLAVSVPVNAVWADPKTIIS
A9MNI7_SALAR          RVAWLQIVTPSKLVKQEDMRSLREVTTASPRGMITDREGRPLAVSVPVNAVWADPKTIIS
A8AFN2_CITK8          RVAWLQIITPTNLVKQEDRRSLREVTTASPRGMITDREGRPLAVSVPVNAVWADPKTIVS
A6TAZ4_KLEP7          RVGWLQIISPDNLVKQEDMRSLREEPVAVERGMISDREGRPLAVSVPVSAIWIDPQTTME
E3DGY1_ERWSE          RVADLQLINHPMLEKEADQRSLRTVTLPTSRGTLLDRNGEALALSVPSRDIIADPQRVLG
B2VFT4_ERWT9          RVADLQLINHPMLEKEADQRSLRTVTLPTNRGTLLDRNGEALALSVPSRDIIADPQRVLE
H2IPU0_RAHAC          RVGYLQLLNQPMLEKEADSRSLRSTVIPAGRGTIVDRNGHPLALSVASKDIIADPFRVLE
D4E674_SEROD          RVGYLQLMEHQQLTNQADQRSVRTQVIPTNRAIITDRNNEALAVSVSSKDIVLDPKHIID
FTSI_BUCAI            RVIFLQIISSNRLITEGDRRTLRTQSLLSTRGAIKDRRGYPLAVTVLVNAICADPSVILK
FTSI_BUCAP            RIIFLQIINSKKLAYEGDRRTLRIQSVINRRGIINDRLGYPLAVAVPVNAVFIDPTMITN
FTSI_BUCBP            RITFLQIIVSKKLIYKSNLRSLRTQIEFNQRGNITDRLGYPLAINIPVKNICIDPKLLFS
FTSI_HAEIN            RAAYVQSINADTLSNEADKRSLRKDEVLSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
Q9KPG1_VIBCH          RVAYIQIIEPDNLIKEGDLRSIRAKTLQSARGIISDRNGEALAVSVPVEAVWADPVAIYK
Q5E2P4_ALIF1          RAAYIQVIEPDNLVKQGDMRSIRVKSLPSARGIISDRNDEQLAVSVPVDAVWADPVTIYK
Q6LMF0_PHOPR          RAAYIQVLEPGRLIQEGDLRSLRVKAMPSARGIISDRNGEQLAVSVPVQAVWADPVQIYK
W0A3X2_AERHY          RLAWIQVIDPDRLRQEGDMRSLRTTSTQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHE
B1KKY3_SHEWM          RAAYIQIVEPEKLRHESDMRTLRTTSREVQRGLITDRNGEMLAVSVPVKAVYADPKVVHD
Q8E9P2_SHEON          RAAYIQIIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVND
E1SMJ9_FERBD          RAAYIQVIAPDRLRHESDLRTLRLETRDVQRGMITDRNGEMLAVSVPVQAVWADPKRVFE
K0D3G6_ALTMS          RAAYIQVIEPDELIQQGDNRTLRTRDMPTYRGLITDRNGVELAVSVPVRAIYADPKVIHE
F5ZBR0_ALTNA          RAAFIQVIEPDELIQQGDSRTLRTRNMPTYRGLVTDRNGVELAVSVPVRAIYADPKIIHE
Q47VQ3_COLP3          RTAYIQIIEPEMLKKQGDLRSLRVAANTVQRGSIVDRNGAELAISVPVETVWADPKIIMD
A1SU13_PSYIN          RLAYLQIIEPEYLTNEADKRSLRITESVAHRGNIQDRNGEELAISVPAYAIWADPKRVKA
Q5NGX9_FRATT          KLIYMETIQYPKLKQEGDNRSDRSIDIKAYRGIILDRNGNPLAISTPVDTIWVDPFYISA
                      .    .         .              *. : *  .  ::       :         

D0KXX8_HALNC          FYAARTQGSARKYVDQDP-----------------IKTLASLLKIPDANLRSLVANNRSK
B7J3V8_ACIF2          QQALWPQ-------------------------------IASLLGVSAATLATRIHSGGSR
Q83F33_COXBU          TPIQLKQ-------------------------------LAHLLHLPLSFIKKRAKKMGDR
A0A0P9SFL7_9PSED      DKSKWPM-------------------------------LAAALGQDLKALTERLDSQANK
Q87WX9_PSESM          DKSKWPM-------------------------------LAAATGQDLKALTDRLESQATK
I4K1J3_PSEFL          AKEKWPA-------------------------------LAAALGQDPKALAERLEAQANK
B1J1Y4_PSEPW          SKERWPQ-------------------------------LAAALGQNAQQLNERLTQQASK
FTSI_PSEAE            AKERWPQ-------------------------------LAAALGQDTKLFADRIEQNAER
Q8PCK5_XANCP          NPDRIPE-------------------------------LATALGQPLDELNAKLAQKAGK
Q5GW36_XANOR          NPDRIPE-------------------------------LAKALGQPLDELNAKLAQKAGK
H8L356_FRAAD          EPERIPE-------------------------------LAKALQMDPSDLKQKLQQHADR
C5BP40_TERTT          -PEQHNA-------------------------------LAKALGESPKKLSARIAKYTNK
K0BZN7_CYCSP          GTKK-KE-------------------------------FAKLLGLKVSALDKKLKKVASR
Q604V2_METCA          TEAQYQT-------------------------------LAALIGETPEDLKRRLGEAGTN
PBP2_NEIMB            MPSAAQL-----------------------------ERLSELVDVPVDVLRNKLEQ--KG
Q5F6K9_NEIG1          MPSAAQL-----------------------------ERLSELVDVPVDVLRNKLEQ--KG
A0A1E9M4S0_9NEIS      MPTDEQL-----------------------------EKLSAIADVPVEVLKNKLSK--KD
B1YSR8_BURA4          DLGADKI-----------------------------NQLGKLLGMTPKELRVKLS---ED
Q63QJ1_BURPS          DLGADKL-----------------------------DALGKLLGMTTKELKAKLS---ED
Q0K6L8_CUPNH          QVEAAKI-----------------------------RQLAKLLGMSEKDLGKKLS---ED
U3QLX4_RALPI          QVEADKI-----------------------------RQLARLLGMSEKDLGKKLS---ED
A4SV68_POLAQ          DLAADKV-----------------------------QKLASLLQISEAELRKKLK---EE
B1XT03_POLNS          DLAADKV-----------------------------QKLASLLQISEADLRKKLK---EE
I0HMQ2_RUBGI          DAGERR-------------------------------ALARVLGITPTELDTRLS---GN
Q63KZ4_BURPS          AA----H-----------------------------APLAKLLDMPLAEVRRRLT---GD
Q7VUP8_BORPE          IP-PEQV-----------------------------AALAQLLQTPVAELRRRLAD--ED
N8X3T7_ACIGI          TKKQFDTITAELQKTPNSRKLKRQLPDEN----LNLDELADAVGLDRADLKKRLNERPRS
N9HFX1_ACILW          NKKLYDETMLALEKEPNSRKLKRQLPDKN----LNLDELADAVGMDRAELRKKMEERPRS
FTSI_ECOLI            AG-GISVG-------------------------DRWKALANALNIPLDQLSARINANPKG
Q32K08_SHIDS          AG-GISVG-------------------------DRWKALANALNIPLDQLSARINANPKG
Q7CR83_SALTY          AG-GISVG-------------------------DRWKALSTALNIPLDQLSARINANPKG
A9MQC8_SALAR          AG-GISVG-------------------------DRWKALSTALNIPLDQLSARINANPKG
A8ALL2_CITK8          AG-GITLD-------------------------NRWKALADALKMPLDQLAARVNANPKG
A0A3N4B5A3_YERPE      QG-GISLD-------------------------TRWKALSDALEIPLDQLATRINANPKG
B2VD88_ERWT9          KG-GITLD-------------------------SRWKALSDALSIPLDQLAARVNANPNG
Q7CQD7_SALTY          KG-GVGYN-------------------------ERWQALASALHLSLSTLAERVNSNPAG
A9MNI7_SALAR          KG-GVGYN-------------------------QRWQALASALHLSLSTLAERVNSNPAG
A8AFN2_CITK8          KG-GVGYN-------------------------QRWQALAQTLHLSLATLAERVNSNPTG
A6TAZ4_KLEP7          KG-GVGYG-------------------------PRWQAMAEALHLNLGELAQRVQSHPHA
E3DGY1_ERWSE          AH-PDFTS-------------------------AKWQYLANALEQRPEQIAAQIGANPNR
B2VFT4_ERWT9          AH-PDFTS-------------------------AKWQYLANALELRPEQIAAQIGANPDR
H2IPU0_RAHAC          LH-SDLNS-------------------------PKWQYLASALNMPLSQLQQTITSDPQR
D4E674_SEROD          SQ-TNTDD-------------------------ARWQSMANVLKMPLADIQALIRHNARK
FTSI_BUCAI            TK-NIKNH-------------------------KRWQALSEILSIPLKKMFLRINSHKKS
FTSI_BUCAP            KN-DIKNN-------------------------IRWKALSEILSIPLNKLIFFINSDKNI
FTSI_BUCBP            KQTHIYPN-------------------------LKWKMLSTVLSIPLSEIFYRIKYSKNN
FTSI_HAEIN            EN-SLADK-------------------------ERIAALAEELGMTENDLVKKIEKNSKS
Q9KPG1_VIBCH          EG-GLVEK-------------------------DRWYALADVLGLDRQEMMKKIEDNRSR
Q5E2P4_ALIF1          EG-GLAEI-------------------------ERWYALADVLGLKRKELISKIEKNKKR
Q6LMF0_PHOPR          NG-GMQQV-------------------------ERWHALADVLGLNRQELLARVEKNKKR
W0A3X2_AERHY          SG-AIHNE-------------------------RAWLALSAVLKLDINTLKHRIS-NPSK
B1KKY3_SHEWM          KN-GFVDM-------------------------RRWQALADVLHEPKDEILKRVQSNPRK
Q8E9P2_SHEON          NN-GFADM-------------------------RRWQALADVLHEPVEDVLDKVRSNPTK
E1SMJ9_FERBD          GN-GFDDP-------------------------RRWRALADVLEVPEAELVERVKQDPKR
K0D3G6_ALTMS          NN-GFEEE-------------------------RRWEALADVLRQDVNELKEKVA-NPKR
F5ZBR0_ALTNA          ND-GLAEP-------------------------RRWQALADVLGQSVDSLQEKVS-NPKR
Q47VQ3_COLP3          NN-AIAMT-------------------------KHWQALADVLDQDINKLIARVVKNPRK
A1SU13_PSYIN          AF-AFTEQEWLDSIVVNPETGKETVNKTFFYESKKWAALADVLDIELDQLAEILQ-KPNS
Q5NGX9_FRATT          DSPELNKV----------------------------MNILNLPEKTREKIKSQVKVREGR
                                                            :          .          

D0KXX8_HALNC          Q-FIYVQRQVRPSVAAVIRAARLPGVGLQREYQRFYPTGDVTASLVGFTNIDDHGQAGLE
B7J3V8_ACIF2          --FAFLARQIAPERAAAILALHIPGLYSFNENRRYYPSGSIAAPLLGFTNVDGRGIEGLE
Q83F33_COXBU          Q-FVYLKRGNPPFVAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLE
A0A0P9SFL7_9PSED      E-FIYLVRGLTPEQGQSVIDLKVPGVYGIEEFRRFYPAGDVTAHMVGFTDLDDHGREGVE
Q87WX9_PSESM          E-FIYLVRGMTPEQGQAALDLKVPGVYGIEEFRRFYPAGDVTAHMVGFTDLDDHGREGVE
I4K1J3_PSEFL          E-FIYLVRGLTPEQGQSVLDLKVPGVYGIEEFRRFYPAGEVTAHMVGFTDIDDRGREGVE
B1J1Y4_PSEPW          E-FIYLVRGLTPEQGQHVLDLKVPGVYGLEEFRRFYPAGDVTAHMVGFTDLDDHGREGVE
FTSI_PSEAE            E-FIYLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIE
Q8PCK5_XANCP          E-FMYLKRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLE
Q5GW36_XANOR          E-FMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLE
H8L356_FRAAD          E-FMYLRRRMQPEAADAVLAMNIPGVNGQREYRRYYPSGEVTSHVLGFTNIDDHGQEGLE
C5BP40_TERTT          Q-FMYLARHLPPQEAETILRHRFAGVFSETEYQRFYPAGEVAAHVVGFTNINDHGQEGIE
K0BZN7_CYCSP          R-FVYLRRHMDPQVTAMIDQLQLPGVYLQKEYRRYYPDGEVAAHLVGFTNIDDEGQEGLE
Q604V2_METCA          RAFVYVRRRVSPELADQVTSLGLPGVYAEEESRRYYPTGEVTAHVLGFTDIDDNGQEGLE
PBP2_NEIMB            KSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLE
Q5F6K9_NEIG1          KSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLE
A0A1E9M4S0_9NEIS      KGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGLE
B1YSR8_BURA4          KGFVYVKRQVPIDVADKVAALDIPGIYQRNEYKRFYPEGEITAHLIGFTNVEDEGQEGVE
Q63QJ1_BURPS          KTFVYVKRQVSLDVAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGFTNVEDEGQEGVE
Q0K6L8_CUPNH          KGFVYLKRQVLPDVADKIAALKIEGIHQTREYKRFYPEGEAMAHIVGFTNVEDRGQEGVE
U3QLX4_RALPI          KGFVYLKRQVLPDIADKIAALKIEGIHQTREYKRFYPEGEAMAHIVGFTNVEDRGQEGVE
A4SV68_POLAQ          RKQVFLKRQVDPDVAQQIKQLEIPGIGLNNEYRRFYPEGEAMAHVVGFTNVNDKGQEGME
B1XT03_POLNS          RKQIFLKRQVDPAVAQQIKQLEIPGIGLNNEYRRFYPEGEAMAHVVGFTNVNDKGQEGME
I0HMQ2_RUBGI          PNFVWLRRQADDATWDAVKAMGLKGVYQVREYKRSYPEGESAAHVVGFTNVEEHGQEGIE
Q63KZ4_BURPS          RSFVLLKRQVDPETAARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVE
Q7VUP8_BORPE          RNFVYLKRQVPMDVADKIKQMALPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQGQEGVE
N8X3T7_ACIGI          R-YLVLKKEVPPPQADFITQHKFAGVYAEKTYKRYYPQPQPNAQIIGLTNSEGTGIEGLE
N9HFX1_ACILW          R-YLILKKEVPPQQAELIMKRNFQGVYTEKNYKRYYPQPQPNSQIIGLTNSEGSGIEGLE
FTSI_ECOLI            R-FIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVE
Q32K08_SHIDS          R-FIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVE
Q7CR83_SALTY          R-FIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVE
A9MQC8_SALAR          R-FIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVE
A8ALL2_CITK8          R-FIYLARQVNPDLGDYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVE
A0A3N4B5A3_YERPE      R-FVYLARQVNPAIGDYIRKLKLPGIHLRQESRRYYPAGQVMAHIIGVTNIDGQGIEGVE
B2VD88_ERWT9          R-FVYLARQVNPAIGDYIRKLKLPGIFLREESRRYYPAGEVTSHLIGFTNIDGQGIEGVE
Q7CQD7_SALTY          R-FIYLARQVSPQQAEWIDKLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQGIEGIE
A9MNI7_SALAR          R-FIYLARQVSPQQAEWIDKLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQGIEGVE
A8AFN2_CITK8          R-FIYLARQISPQQAEWIDKLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQGIEGIE
A6TAZ4_KLEP7          R-FLYLARQINPEQAEWIDKLHLPGVYLRDESRRFYPAGHVAANLLGFTNVDNQGIEGVE
E3DGY1_ERWSE          R-FLYLGHKIELGIAKDIGKLHLAGISTVYNDSRFYPMSEATAPLIGIVGAENSGLSGLE
B2VFT4_ERWT9          R-FLYLGHKIELGIAKDIAKLHLAGISTQYNDSRFYPMSEATAPLIGIVGAENAGLSGLE
H2IPU0_RAHAC          R-FVYLGRKIEEGIAADISQLHLGGISSQLDDSRYYPMSEAAANLVGVVGTDNEGLTGVE
D4E674_SEROD          R-FVYLARKVEDENAAYIQKLHLTGVSSEQDFSRFYPMGQDAAGLIGIVGQDNQGLEGIE
FTSI_BUCAI            K-FIYLARQINPEISEYIKKLQLPGIFLLEESKRYYPFKEISAQLVGFTNIDGIGIEGIE
FTSI_BUCAP            K-FIYLARQINPEIGDYIKALKLPGVFLIEESKRYYPTGAIAAQLIGINNIDGEGIEGIE
FTSI_BUCBP            H-FIYLAHKVNPEISEYISQLHIPGIYILDDFKRFYPFGKLTSQLIGFTNIDNEGIEGVE
FTSI_HAEIN            G-YLYLARQVELSKANYIRRLKIKGIILETEHRRFYPRVEEAAHVVGYTDIDGNGIEGIE
Q9KPG1_VIBCH          R-FIYLQRQVSPAMAKYIRELKLAGIGLKEESRRYYPAGEVSAHLVGVTGIDGHGLEGVE
Q5E2P4_ALIF1          R-FIYLQRQISPAVAAYIKKLKLAGIGLKAESRRYYPTGEISAHVIGVTGIDSHGLEGVE
Q6LMF0_PHOPR          R-FVYLARQVSPAMADYVSKLKLPGIGLKDESRRFYPSGEVSAHLIGVTGIDGHGLEGVE
W0A3X2_AERHY          R-FVYLQRQVTPAVAEYIKGLKLGGIYLRPEARRFYPTGEISAHLVGVTNIDGSGIEGIE
B1KKY3_SHEWM          R-FTYLKRQVTPAVAEYIKQLRLPGVYLKSESRRYYPTSEISAQLVGITNIDDVGIEGIE
Q8E9P2_SHEON          R-FTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGITNIDDVGIEGVE
E1SMJ9_FERBD          R-FLYLRRQVTPAVAEYIAKLRIPGVGLKPESRRYYPAGEATGQLIGLTNIDDKGIEGLE
K0D3G6_ALTMS          R-FVYLQRQVSPAMAEYVDKLDIPGIYLRRESRRYYPTGEVSAQLIGVTDVDDTGVEGLE
F5ZBR0_ALTNA          R-FVYLQRQVSPAMAEYVDKLDIPGIYLRRESRRYYPTGEVSAQLIGVTDVDDTGVEGLE
Q47VQ3_COLP3          R-FIYLERKISPAMASYIKELKIPGIHLRKESKRFYPTGEISAHLIGFTNVDDKGIEGIE
A1SU13_PSYIN          R-FSYLKRQVNQQIVEYINQLNLAGISEQLESHRFYPTGEINANILGLTDLDSQGIEGIE
Q5NGX9_FRATT          SGFVYIERKVQPYLSQKVKDLDITGIHVIREFKRYYPMAEVASHIVGFTNVDGKGQEGLE
                           : :              . ..       * **     .  :*  . :  *  *:*

D0KXX8_HALNC          ASYNNYLAGVAGRRLILKDAYGHEVDDLGVQK--EA--QPGHDLVLSIDKRLQYLTYSEL
B7J3V8_ACIF2          LAYDQWLRGKAGEETGLRDNLGHPLAILGTAR--PA--QPGQTLTLSIDRNIQYVAYTAL
Q83F33_COXBU          LAYNRWLGGTPGKMEVLKDRLGHVIADVAVLQ--KP--AQGHDLNLSIDHRIQYLAYKAL
A0A0P9SFL7_9PSED      LAYDDWLAGVPGKRQVIKDRRGRLIKDVQVTK--NA--KAGKTLALSIDLRLQYLATREL
Q87WX9_PSESM          LAYDDWLAGVPGKRQVIKDRRGRLIKDVQVTK--NA--KAGKTLALSIDLRLQYLATREL
I4K1J3_PSEFL          LAYDEWLAGVAGKRQVIKDRRGRLIKDVQVTK--NA--KAGKPLALSIDLRLQYLANREL
B1J1Y4_PSEPW          LAYDEWLAGVPGKRQVIKDRRGRLIKDIQVTK--NA--KAGKTLALSIDLRLQYLATREL
FTSI_PSEAE            LAFDEWLAGVPGKRQVLKDRRGRVIKDVQVTK--NA--KPGKTLALSIDLRLQYLAHREL
Q8PCK5_XANCP          LAFDEWLRGKPGSKKVVRDARGAIVESVDLVR--PA--QPGKDLTLSIDRRIQFLAYKEL
Q5GW36_XANOR          LAFDEWLRGKPGSKKVVRDARGAIVESVDLVR--PA--QPGKDLTLSIDRRIQFLAYKEL
H8L356_FRAAD          LAYDNWLAGKAGAKRVVRDRQGHVVEDLEQVK--DP--QPGRDLTLSIDRRIQFLAFNEL
C5BP40_TERTT          LAFDQYLAGSPGAKQVVKDLKGNIVREDGLLK--AP--VSGQDITLSLDLRLQYLAYREL
K0BZN7_CYCSP          LAWDESLKGSAGAERVLRDGKRRMVKHVDNIR--AP--IPGQDIRLTIDRRLQYLAYREL
Q604V2_METCA          LAFDGHLKGIEGARRIIRDGKRRVIEDVENVR--PP--VPGKDLSISIDQRLQYLAHREL
PBP2_NEIMB            LSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAP--KNGKDIILSLDQRIQTLAYEEL
Q5F6K9_NEIG1          LSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAP--QNGKDIILSLDQRIQTLAYEEL
A0A1E9M4S0_9NEIS      LSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVP--KNGQDMILSLDQRIQTLAYEEL
B1YSR8_BURA4          LGDQKLLSGTSGVRRVIKDRLGHIVEDVAEQ--VPP--HNGTDVGLSIDSKIQYIAYANL
Q63QJ1_BURPS          LADQKLLVGTPGSRHVIKDRVGHIVEDVDAQ--VPP--HNGADVGLSIDSKIQYITYTNL
Q0K6L8_CUPNH          LAREPGLAGRAGARQVIKDRLGRVVEDVGVL--KTP--RDGEDIQLSIDAKIQYLAYNEL
U3QLX4_RALPI          LAREPGLAGRPGARQVIKDRLGRVVEDVGIL--KTP--RDGEDIQLSIDAKIQYLAYNEL
A4SV68_POLAQ          LSREQDLAAHPGQRRVVVDRLGRVVEDVAIE--QLP--QNGKDLQLSIDSKIQFLAYNAV
B1XT03_POLNS          LSRENDLASHPGQRRVVVDRLGRVVEDVAIL--QLP--QNGKDLNLSIDSKIQFLAYNAV
I0HMQ2_RUBGI          LRFDKELQGRDGLRAVVRDRLGRVVEDIGDQ--TAA--LDGRDVTLAIDSKVQFFAYQRI
Q63KZ4_BURPS          LAANGRLSGTAGQRQVIRDRLGRIVSDTGPL--VPA--QHGATIELTIDRRIQQLAYAQL
Q7VUP8_BORPE          LTFNQQLSGQPGSRRVIKDRLGRVIEDVQAV--TLP--VDGRDLRLSIDTRLQYLVYKEL
N8X3T7_ACIGI          MQLNSRLAGEDGEQKISRDKHGNRITTPEVVK--EV--KAGENITLSIDSRLQYIMYREL
N9HFX1_ACILW          MQLNSRLSGKDGEQQIIRDKKGNRVKEPEVIK--EV--EPGENITLSIDSRLQYIMYREL
FTSI_ECOLI            KSFDKWLTGQPGERIVRKDRYGRVIEDISSTDS-----QAAHNLALSIDERLQALVYREL
Q32K08_SHIDS          KSFDKWLTGQPGERIVRKDRYGRVIEDISSTDS-----QAAHNLALSIDERLQALVYREL
Q7CR83_SALTY          KSFDKWLTGQPGERIVRKDRYGRVIEDISSTDS-----QAAHNLALSIDERLQALVYREL
A9MQC8_SALAR          KSFDKWLTGQPGERIVRKDRYGRVIEDISSTDS-----QAAHNLALSIDERLQALVYREL
A8ALL2_CITK8          KSFDKWLTGQPGERIVRKDRYGRVIEDISSTDS-----QAAHNLALSIDERLQALVYREL
A0A3N4B5A3_YERPE      KSFDRWLTGQPGERTVRKDHYGRVIEDISSVDS-----QAAHNLVLSVDERLQALVYREL
B2VD88_ERWT9          KSFDKWLTGQPGERTVRKDRFGRVIEDISSVDS-----RAAHNLALSIDERLQAQVYREL
Q7CQD7_SALTY          KSFNAQLTGKPGSRLVRKDKFGHVIENITEVNP-----VPAHELQLSIDERLQTVTEDAL
A9MNI7_SALAR          KSFNAQLTGKPGSRLVRKDKFGHVIENITEVNP-----VPAHELQLSIDERLQTVTEDAL
A8AFN2_CITK8          KSFNAQLTGKPGSRLVRKDKFGHVIENITETNP-----VPAHELQLSIDERLQTVTEDAL
A6TAZ4_KLEP7          KSFNAQLTGKPGRRLVRKDKHGNVIENITEVPP-----VPAHNLQLSIDERLQTVTEDAL
E3DGY1_ERWSE          KGFDKLLRGTPGVEKYRQDASGNIVAMINYEPP-----QQPPTVQLSIDKFDQYTLYSKL
B2VFT4_ERWT9          KGFDKLLRGTPGVEKYRQDASGNIVAMINYEPP-----QQPPTVQLSIDKFDQYTMYSKL
H2IPU0_RAHAC          KGFNALLQGKPGMREYRQDRHGNVIGILKEVAP-----QQPPTINLSIDSFMQYVLYSRL
D4E674_SEROD          LGFNHLLQGKNGLRVYQKDGSGAVINVLKNVDP-----VPPPNVTLSIDKFIQYVLFAQI
FTSI_BUCAI            KSFDLLLTGKPGKRKIRQDNKGHVIEKISLVHK-----RASNNLNLSIDTKLQTIVYNEL
FTSI_BUCAP            KSFNSYLTGTPGKRKIRKDNQGQIIENESLINK-----SNSNNLILSIDKKLQTIVYQKL
FTSI_BUCBP            KSFNKLLMGKPGKKQIITDRYGRIIEQHNLVNK-----IQSHDIILSIDCSFQKFIYHIL
FTSI_HAEIN            KSFNSLLVGKDGSRTVRKDKRGNIVAHISDEKK-----YDAQDVTLSIDEKLQSMVYREI
Q9KPG1_VIBCH          RSFDSTLTGESGKSVTRKDKFGRVVENIALEER-----EEGKPIQLTIDQRLQAIAFRAV
Q5E2P4_ALIF1          RSYDGWLTGEPGRRTVRKDRYGRVVENISLKEK-----QEGKPLTLSIDQRLQAIAYRAI
Q6LMF0_PHOPR          RTYDGWLTGEPGRRTVRKDRYGRVVENISLQKR-----EPGKPLELSIDQRIQAVAYRAM
W0A3X2_AERHY          RSYNEWLTATPGEMRVRKDRQGRVIERLGLVKE---G-KHANDLQLSIDQRVQALAYRAL
B1KKY3_SHEWM          NSYNDWLTGTPSKQKVRKSRDGHVVERLDMVHE---G-ESPNDLVLSIDQRIQQLAYREI
Q8E9P2_SHEON          NAYNSWLTGTPSKQKVRKSRDGHVVERLDIVQE---G-ESPNDLVLSIDHRIQQLAYREL
E1SMJ9_FERBD          RNYDDWLTGSPEKVRVRKGLGGEVVENLSVVAE---G-EHPNDLVLSLDMRLQSLAYRAL
K0D3G6_ALTMS          RMYNEWLTGTPGSRKIRRDAKGRQVEILETKSG-----EKAGDLQLTIDQRIQALAYKEI
F5ZBR0_ALTNA          RMYDEWLTGTPGSRKIRRDAKGRQVEILETTTG-----EDAGNLQLTIDQRIQALAYKEI
Q47VQ3_COLP3          RMYDDLLTGTGGAKRFRKDAKGRKIEIISVEEP-----EQAQDITLSIDQRIQAIAYKEL
A1SU13_PSYIN          KSYNNYLQGQSGQKRVRQDRLGNVIDNIEVLKV---K-KAAGNLQLSIDQRIQAVAYSEL
Q5NGX9_FRATT          LEFNKFLSGQDGYFEYKKDLHGGVASKIEDKYV---EPKNGRNLQISIDSRLQYIAYKYL
                         :  * .         .                        : :::*   *      :

D0KXX8_HALNC          ARGVAAHHAEYGSAVLMNVTTGEVLAMATVPSFNPNNRATM-KPAL-TRNRALVDQFEPG
B7J3V8_ACIF2          ASAVQRFQARSGAAVLMNVRTGEILAMASYPSFNPNDRGDF-QPSL-YNNRAVADTLEPG
Q83F33_COXBU          EETVSTYHAQSGSVVVLDVKTGEILAMVNQPSYNPNNRPTD-HDGR-YRNRAVTDMFEPG
A0A0P9SFL7_9PSED      RNAIVENEAKAGSMVIMDVKTGEVLAMVNQPTYNPNNRRTM-VPAA-MRNRAIIDVFEPG
Q87WX9_PSESM          RNAIVENEAKAGSMVIMDVKTGEVLAMVNQPTYNPNNRRTM-VPAA-MRNRAIIDVFEPG
I4K1J3_PSEFL          RNAIVENGAKAGSLVIMDVKTGEILAMVNQPTYNPNNRRNL-QPAM-MRNRAMIDVFEPG
B1J1Y4_PSEPW          RNAIAEQDAKAGSLVIMDVKTGEVLAMVNQPTYNPNNRRTM-FPAA-MRNRAIIDVFEPG
FTSI_PSEAE            RNALLENGAKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNL-QPAA-MRNRAMIDVFEPG
Q8PCK5_XANCP          RNALVENKAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGI-NPSA-RRNRAVTDLVEPG
Q5GW36_XANOR          RNALVENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGI-NPSA-RRNRAVTDLVEPG
H8L356_FRAAD          RATVERTGADFASMVILDVATGEVLAMVNLPTYNPNAKLSN-NPGE-RRNRAATDVFEPG
C5BP40_TERTT          ASAVKKQGAKSGSVVVMDVKTGEVLAMANQPAYNPNDRSSI-KPAQ-LRNRALTDVFEPG
K0BZN7_CYCSP          KAAVAQQKATSGSLVLLNAETGQLLAVANQPAFNPNDRSKI-KASH-VRNRAFVDLFEPG
Q604V2_METCA          KRTVQQHRAKAGALVMLDAKTGEVLAMVNQPAFNPNSRNGT-VPGS-TRNRAITDLFEPG
PBP2_NEIMB            NKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRA-DSEQ-RRNRAVTDMIEPG
Q5F6K9_NEIG1          NKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRA-DSEQ-RRNRAVTDMIEPG
A0A1E9M4S0_9NEIS      NKAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQA-NSEQ-RRNRAVTDMIEPG
B1YSR8_BURA4          KAAVEKFKAKAGAAMVVDVRTGEVLALVNYPTYNPNDRTRL-TGEQ-LRNRILTDVFEPG
Q63QJ1_BURPS          KAAVEKFHAKAGAAMVIDVQTGEVLSLVNYPTYNPNDRSHL-TGEQ-LRNRVLTDVFEPG
Q0K6L8_CUPNH          KAVVEKHKAKAASAVVLDAQTGEVLALANWPTYNPNDRTRL-SGEQ-LRNRVLTDTFEPG
U3QLX4_RALPI          KAVVERHKAKAASAVVLDAQTGEVLALANWPTYNPNDRTRL-SGEQ-LRNRVLTDTFEPG
A4SV68_POLAQ          KNAVEEHHAKAGGAVVLDTQTGEILALANYPSYNPNDRRFL-SGEQ-LRNRVMTDTFEPG
B1XT03_POLNS          KDAVEKHHAKAGGAVVLDTQTGEILALANYPSYNPNDRRFL-TGEQ-LRNRVLTDTFEPG
I0HMQ2_RUBGI          RDMVTQQAAKAGSVVVLDAQTGEVLALANYPSYDPGQRRNL-SGAQ-LRNRALTDTFEPG
Q63KZ4_BURPS          KSTIIANNAQAGSVVVLDAQNGEILALANYPTFDPNDRARL-TGQQ-LRNRAVIDTFEPG
Q7VUP8_BORPE          QDARVAHQAKSATAVVIDVHTGEVLALVNLPSFDPNHRETF-QVST-LRNQAITDTFEPG
N8X3T7_ACIGI          TAVGVANNARSASAIAVDVKTGEILAMASWPSYNPNDKNGLSNKDA-MRNRGAIDMFEPG
N9HFX1_ACILW          TAAGVANNARSATAIAVDVKTGEILALSSWPSYNPNDKNSLLNKDA-MRNRGAVDSFEPG
FTSI_ECOLI            NNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEA--MRNRTITDVFEPG
Q32K08_SHIDS          NNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEA--MRNRTITDVFEPG
Q7CR83_SALTY          NNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDA--MRNRTITDVFEPG
A9MQC8_SALAR          NNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDA--MRNRTITDVFEPG
A8ALL2_CITK8          NNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLTGTPKDA--MRNRTITDVFEPG
A0A3N4B5A3_YERPE      NNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYNPNNLTGTPKDA--MRNRAITDIFEPG
B2VD88_ERWT9          NNAVAFNKAESGTAVLLDINTGEVLAMANSPAYNPNNLTGVTKDV--MRNRAITDMFEPG
Q7CQD7_SALTY          DNAVIWNKAESGAAVLINIPTGEILSMASYPDFNPNNREGAQLDD--FRNRAISDTFEPG
A9MNI7_SALAR          DNAVIWNKADSGAAVLINIPTGEILSMASYPDFNPNNREGAQLDD--FRNRAISDTFEPG
A8AFN2_CITK8          DNAVTWNKAESGAAVLVNIATGEILSMASFPDFNPNNREGAVLDD--FRNRAISDTFEPG
A6TAZ4_KLEP7          DNAVRWNKAESGAAVLIKIDTGEILAMASYPDFNPNNRDSATLDD--FRNRAISDTFEPG
E3DGY1_ERWSE          RDGVLLNKADSGAAVLIKIDTGEILGMASYPSFNPNHFVDVSPAQ--MRNAAINDSYEPG
B2VFT4_ERWT9          RDGVLLNKADSGAAVLIKIDTGEILGMASYPSFNPNHFVDVSPAQ--MRNVAINDSYEPG
H2IPU0_RAHAC          RDGVTLNQAESGAAVLVDVNTGEILGMASYPSYNPNNYAGVQAKD--MRNVAISDSFEPG
D4E674_SEROD          RDGVIANQADSGCAVLVRVNTGEVLGMASYPSFNPNNYANTPSKD--IRNVCSSDSFEPG
FTSI_BUCAI            QEGVKKSQSDSGTAILINIKSGEVLAMANSPSYNPNNIRHIIQKN--VRNKAITDLFEPG
FTSI_BUCAP            NNAVNENQADFGIAILINIETGEILAMANSPSYNPNNMQYMINKN--LRNKAITDIFEPG
FTSI_BUCBP            NQAVMSNKAKFGVAILVNIPTGEILSMVNTPSYDPNNSSELFKNNPLIRNKAITDIFELG
FTSI_HAEIN            KKAVSENNAESGTAVLVDVRTGEVLAMATAPSYNPNNRVGVKSEL--MRNRAITDTFEPG
Q9KPG1_VIBCH          KQAMADYRATSASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFK--MRNRVITDAFEPG
Q5E2P4_ALIF1          KQAVSDFRAMSGSVVMIDIKTGEVLAMVNAPSYNPNNREQLQSFR--MRNRVITDTLEPG
Q6LMF0_PHOPR          KEAIVNLPATSASLVLVDVNTGEILAMVNAPSFNPNNRNDRQSYK--MRNRVITDSFEPG
W0A3X2_AERHY          KRATDENKATSGSMVMLDVKTGEVLAMVNTPSYNPNNRGQYQSFR--VRNRVVTDTYEPG
B1KKY3_SHEWM          KRVTEINQATSASIVVLDVHTGEVLAMANTPSYNPNSRENLQSYR--MRNRALTDAYEPG
Q8E9P2_SHEON          KRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSFNPNSRDNFQTFR--MRNRAMTDTFEPG
E1SMJ9_FERBD          KKATQYHMATSGSLVIIDIPTGEILAMANTPSFNPNQRSGIQAYQ--MRNRAITDAYEPG
K0D3G6_ALTMS          KEAMIYYQSSSASAIVIDVKSGDVLAMVNAPSFNPNDRSDISAHR--MRNRVITDAFEPG
F5ZBR0_ALTNA          KEAMIYYQSSSASAVVIDVKTGDVLAMVNAPSFNPNDRSNISPHR--MRNRVITDAFEPG
Q47VQ3_COLP3          KGAVQAFKATSGSVVVANIHTGEILAMTNSPSYNPNNRRNTAIHR--FRNRAITDIYEPG
A1SU13_PSYIN          KRAIKINDATSGSIVVLDVNTGELYAMANWPSFNPNDRAQYQPYK--LRNRAITDTFEPG
Q5NGX9_FRATT          KEGVIRTNSEAGSVIVEDIHIGEILAMANYPSYNPNSMADAYPDR--RRNRAITDVYELG
                              :  .  :      * : .: . * ::*.            .*    *  * *

D0KXX8_HALNC          SSMKPFTITAALESGRWQPDS--TVNTAPGWVRIGGYTIRD-HRNY--GV-LDLRGILEK
B7J3V8_ACIF2          SVMKPFTIAAALDDGSIQPDS--TFDVDTNCFRVAHYCIQD-DVRH--GT-LDLAQVLKY
Q83F33_COXBU          SVNKPFTIALALESGRYKPDT--QINTNPGWMKIGGYRIHD-DLNY--GV-VTLTQLLQK
A0A0P9SFL7_9PSED      STMKPISMTAALDSGRWKPTD--KVEVYPGTLQIGKYTIRD-VTKTEGPI-LDLTGILIN
Q87WX9_PSESM          STMKPISMTAALDSGRWKPTD--KVEVYPGTLQIGKYTIRD-VTKTEGPV-LDLTGILIN
I4K1J3_PSEFL          STMKAVSMAAALETGRWKPSD--TVEVYPGTLQIGKYTIRD-VSKTEGPV-LDLTGILIN
B1J1Y4_PSEPW          STVKPISMSAALESGRWKPTD--KVEVYPGSLQIGRYTIKD-VSRSEGPI-LDLTGILIN
FTSI_PSEAE            STVKPFSMSAALASGRWKPSD--IVDVYPGTLQIGRYTIRD-VSRN-SRQ-LDLTGILIK
Q8PCK5_XANCP          STMKPLTVATALTAG-VVTKDT-IIDTNPGYMAVGRFTIRD-VPRN-NGV-LNVTGVITR
Q5GW36_XANOR          STMKPLTVATALTAG-VVTKDT-VIDTNPGYMSVGRFTIRD-VPHN-NGV-LNVTGVITR
H8L356_FRAAD          STMKAFTLAAALSSGKYTPTSP-LIDTTGGHFMYLGHDIHD-VERGGNGW-LTPTGVITK
C5BP40_TERTT          STVKPLTMMAALESGKYHLND--TINTSPGYVMVGRKALLD-PKDY--GV-MSLTKIITK
K0BZN7_CYCSP          STMKPFTVAAGMESGVFDAST--VIDTNPGYMRVGRSQVRD-HRNY--GE-IDLATLLLK
Q604V2_METCA          STMKPFAVACALEMGAFRPNA--VINTSPGLMHVGSNVVKD-VHNY--GV-LDVAGVLRK
PBP2_NEIMB            SAIKPFVIAKALDAGKTDLNE--RLNT--QPYKIGPSPVRD-THVY--PS-LDVRGIMQK
Q5F6K9_NEIG1          SAIKPFVIAKALDAGKTDLNE--RLNT--QPYKIGPSPVRDDTHVY--PS-LDVRGIMQK
A0A1E9M4S0_9NEIS      SAMKPFTIAKALDSGKVDATD--TFNT--LPYKIGPATVQD-THVY--PT-LDVRGIMQK
B1YSR8_BURA4          SIMKPFTVSLALDLHRVTPNT--LVETGNGHFVLDGAPITD-DAGF--GT-LTVGGVIQK
Q63QJ1_BURPS          SIMKPFTVSLALDLHRVTPNT--LVETGNGHFVLDGAPITD-DSGF--GT-LTVGGVIQK
Q0K6L8_CUPNH          SMMKPITVGLALQLKRVTPST--VITT-TGKYNFEGATISD-THNY--GA-LTVSGVIQK
U3QLX4_RALPI          SMMKPITVGLALQLKRVTPST--VIAT-TGKYQFEGATISD-THNY--GA-LTVSGVIQK
A4SV68_POLAQ          STIKPLTISIALEKGAVTPNT--NMVI-GAKYLVGPKPITD-THPY--GN-LTVAQIIQK
B1XT03_POLNS          STMKPLTIAIALEKGSVKSDT--NMVI-GAKYLVGPKPITD-THPY--GN-LTVAQIIQK
I0HMQ2_RUBGI          STMKPFVACLAMETGRVTPST--VIDTAPGSITITGSTIRD-SHPH--GA-LTVAQVIQK
Q63KZ4_BURPS          STIKPVVVALSIDAGKVRPQT--IIDTSPGAYKIGPNVIHD-TSNH--GA-ITVAQALQM
Q7VUP8_BORPE          SIMKPFTAALALDLGRISTAT--MFETGNGRFQYQGSTISD-VSRN--GT-LDLAGVLLK
N8X3T7_ACIGI          STMKPFTIAAGLESGKYTPNS--VISTSPGSMRLGSHTIRD---THNYGS-LTVTGVIIK
N9HFX1_ACILW          STMKPLTVAMALESGKYTANS--VVNTTPGSMRVGNHTIRD---THNYGQ-LTLGGIIQK
FTSI_ECOLI            STVKPMVVMTALQRGVVRENS--VLNTIPYRIN--GHEIKDVARYSE----LTLTGVLQK
Q32K08_SHIDS          STVKPMVVMTALQRGVVRENS--VLNTIPYRIN--GHEIKDVARYSE----LTLTGVLQK
Q7CR83_SALTY          STVKPMVVMTALQRGIVNENT--VLNTVPYRIN--GHEIKDVARYSE----LTLTGVLQK
A9MQC8_SALAR          STVKPMVVMTALQRGIVNENT--VLNTVPYRIN--GHEIKDVARYSE----LTLTGVLQK
A8ALL2_CITK8          STVKPMVVMTALQRGVVRENT--VLNTVPYRIN--GHEIKDVARYSE----LTLTGVLQK
A0A3N4B5A3_YERPE      STVKPMVVMTALQHGVVKENS--VLNTLPYFVN--GHQIKDVARYAE----LSVTGILQK
B2VD88_ERWT9          STVKPMVVMTALQRGVVHESS--VLNTVPFRIN--GHEIRDVARYNE----LTLTGVLQK
Q7CQD7_SALTY          STVKPLVIMTALQQGIVQPDS--VIDTHPFTLD--GHRIRDVGYYPE----LTLTGILQK
A9MNI7_SALAR          STVKPLVIMTALQQGIVQPDS--VIDTHPFILD--GHRIRDVGYYPE----LTLTGILQK
A8AFN2_CITK8          STVKPLVIMTALQQGIVQPDS--VIDTHPFNLD--GHRIRDVGYYPE----LSLTGILQK
A6TAZ4_KLEP7          STVKPLVIMTALQQGIVQPDS--VVDTHPFVLD--GHRIRDVGYYPE----LSLTGILQK
E3DGY1_ERWSE          STVKPLVVMEGLARKLVRPDS--VLDTIPYRVN--GHLIRDVGHWSR----LTMTGILQK
B2VFT4_ERWT9          STVKPLVVMEGLVRKLVRPDS--VLDTTPYRVN--GHLIRDVGHWSR----LTMTGILQK
H2IPU0_RAHAC          STVKPLVVMAGLNRHMIRPDS--VLDTHPYTVN--GHLIRDVGHWPA----LTITGILQK
D4E674_SEROD          STVKPVVVMVGLDRHLIQPDT--VLDTTPYRVN--GHLIRDVGHWSK----LTITGVLQK
FTSI_BUCAI            STVKPIVIIEALKLGIIQENS--IIDTKPFLIQ--KHQIKDVSYHEK----LTITGILQK
FTSI_BUCAP            STVKPIVIMEALKRGIIKKNS--IINTKPYFIK--KHKITDVAYHEK----LNITGILKK
FTSI_BUCBP            STVKPMIIMKALEKKIITPET--VINTSSLVVN--KHIIHDVSYHHA----LTASDILKK
FTSI_HAEIN            STVKPFVVLTALQRGVVKRDE--IIDTTSFKLS--GKEIVDVAPRAQ----QTLDEILMN
Q9KPG1_VIBCH          STVKPFVVLAALANGIADKNT--IIDTGDGTMQIGGSRVRDTSKVGK----ADLTLILKK
Q5E2P4_ALIF1          STVKPFVVLAALDGGTANLDT--IIDTGNGIMRIGGSRVRDSSKVGK----ADLTTILKK
Q6LMF0_PHOPR          STVKPFGVLEAMESGIVDENT--LIKIPGRRLRVGSNYVSDVSRIEK---EATVGRILQK
W0A3X2_AERHY          STVKPLILLSALQAGVTSWKD--TIP--GGPLFIGAKQIRDVS-IHK---ATNLYDILRY
B1KKY3_SHEWM          STIKPFVVAAALDAGTIKEDQ--IFKTYPGRMRIGGKIVRDGRDYGD----LSLSGILVH
Q8E9P2_SHEON          STIKPFVVAAALEAGTVKSTD--VIPTSPGWMRLGGRQVRDASNYGD----MTLARILAK
E1SMJ9_FERBD          SVVKPLVVAAAMEKGLVTPDT--VMDTSPGWMRVSGGLVRDTRNFGK----QDVTHLLVK
K0D3G6_ALTMS          SALKPLAVLTALEFGEVEPED--SVNTHPGWMRLGGSLVKDSRNYGE----LTLEEIIQH
F5ZBR0_ALTNA          SALKPLAVLTAMEFGEVGAED--VVDTNPGWMRLGGSLVKDSRNYGE----LTLEEIIQH
Q47VQ3_COLP3          STMKPLTALTALEFGSAKANS--IINTSPGWMRLGGRRVSDPINRGK----LSIEEILVT
A1SU13_PSYIN          STVKPLVVSSALIYKKADVDE--VIDTSPGWMNIGGRRIHDGHNLGK----LDLAMILKK
Q5NGX9_FRATT          SVMKTFAAATALTYGDNVTSDEPVIDTHPGFYRIGKNTVRDERDYGD----INLRHILMK
                      *  *..    .:            .             : *                :  

D0KXX8_HALNC          SSNVGASHIGEDLG-AEVLWKNMRAFGFGQDTGVGFPGEVAGRLE-NWRQWSVSGTAAHS
B7J3V8_ACIF2          SSNIGAAKISLRTP-PADLYQMLRNAGFGQVSGLGLPGEAGGTVP-AWQGWDIARRAAMA
Q83F33_COXBU          SSNIAAAKILLSLT-PQHYYTLLHAFGFGERTTSGFPGESNGALI-PYETWVPSVVATLA
A0A0P9SFL7_9PSED      SSNVGMSKVAFDVG-GEAIFRAMQRVGFGQYTGLGFPGERVGNLP-NYREWRKAETATLS
Q87WX9_PSESM          SSNVGMSKVAFDVG-GEAIFRAMQRVGFGQYTGLGFPGERVGNLP-NYREWRKAETATLS
I4K1J3_PSEFL          SSNVGMSKIAFDIG-GETIYRLAQKIGLGQDTGLGFPGERVGNLP-NYRDWRKAETATLS
B1J1Y4_PSEPW          SSNVGMSKIAFDIG-GEAIYRVMSQVGLGQYTGLGFPGERVGNLP-NHREWRKAETATLS
FTSI_PSEAE            SSNVGISKIAFDIG-AESIYSVMQQVGLGQDTGLGFPGERVGNLP-NHRKWPKAETATLA
Q8PCK5_XANCP          SSNIGAAKIAAKVP-DQTFYQSIRNFGYGSAPQSGFPGESSGMVL-QPQKWSGPSKTTMS
Q5GW36_XANOR          SSNIGAAKIAAKVP-DQTFYQSIRNFGYGSAPHSGFPGESAGVVL-QPARWSGPSKTTMS
H8L356_FRAAD          SSNIGAAKIAISLD-TMLMYNTYRAFNFGSSTDSGFPGEASGYLK-NGATWGQREKAIFA
C5BP40_TERTT          SSQVGITKIALSLE-PVQIRDMFYRMGLGQSSGTGFPGESIGVLP-NRNRWHPIEVATLA
K0BZN7_CYCSP          SSNVASAKIALGIP-GEKLWGMLNSLGFGQSAGLGFPGEARGKLV-GYEQWRPIETATLS
Q604V2_METCA          SSNVGVTKMALALP-PDKFWDFYRDLGFGQVLSTGFPGETQGRMP-DRKGLRPFAQATLS
PBP2_NEIMB            SSNVGTSKLSARFG-AEEMYDFYHELGIGVRMHSGFPGETAGLLR-NWRRWRPIEQATMS
Q5F6K9_NEIG1          SSNVGTSKLSARFG-AEEMYDFYHELGIGVRMHSGFPGETAGLLR-NWRRWRPIEQATMS
A0A1E9M4S0_9NEIS      SSNVGTSKLSAMFT-PKEMYDFYHDLGVGVRMHSGFPGETAGLLR-SWRRWQKIEQATMS
B1YSR8_BURA4          SSNIGATKIAMTMR-PEEMWNMYTSIGLGQAPKVGFPGAAAGRLR-PWKSWRRIEQATMS
Q63QJ1_BURPS          SSNIGATKIAMTMK-PEEMWNMYTGIGLGQAPKVGFPGAAAGRLR-PWKNWRRIEQATMS
Q0K6L8_CUPNH          SSNIGTTKIAMMMK-PQEMWDMYTSIGLGQAPKIGFPGAVAGRVR-PFKSWRPIEQATMS
U3QLX4_RALPI          SSNIGTTKIAMMMK-PQEMWDMFTSIGLGQAPKIGFPGAVAGRVR-PFKSWRPIEQATMS
A4SV68_POLAQ          SSNIGTAKIAMNNLSPEEMWNLYTAVGLGQAPKIGFPGAVAGTVH-PFKKWMPTDQARIA
B1XT03_POLNS          SSNIGTAKIAMNNLSAEEMWDFYTTVGLGQAPKIGFPGAVAGTVH-PFKKWMPTDQARIA
I0HMQ2_RUBGI          SSNVGTVKMAMQMQ-PREMWEVFSGIGIGQRPQIDFPGAVSGRLR-PYKTWRPIEQATMS
Q63KZ4_BURPS          SSNIALAKLALNLP-AETIWNKYQEYGIGRAPELTFPGVASGRLR-PYKRWRPIEQATMA
Q7VUP8_BORPE          SSNIGMTMISEKLQ-SREMWDLFTGLGLGQAPQLGFPGAAPGRLR-PWDRWRLIEKATIA
N8X3T7_ACIGI          SSNVGSAKIALSLP-KETLPSFFRKVGFGQRSAVKFPGESGGLVL-PPEKLNSSQIGTMA
N9HFX1_ACILW          SSNVGVAKLALSLP-YETLPTFYKRLGFGQRSAVKFPGESAGLIL-PPSKWNVSEVATMS
FTSI_ECOLI            SSNVGVSKLALAMP-SSALVDTYSRFGLGKATNLGLVGERSGLYP-QKQRWSDIERATFS
Q32K08_SHIDS          SSNVGVSKLALAMP-SSALVDTYSRFGLGKATNLGLVGERSGLYP-QKQRWSDIERATFS
Q7CR83_SALTY          SSNVGVSKLALAMP-SSALVDTYSRFGLGKATNLGLVGERSGLYP-QKQRWSDIERATFS
A9MQC8_SALAR          SSNVGVSKLALAMP-SSALVDTYSRFGLGKATNLGLVGERSGLYP-QKQRWSDIERATFS
A8ALL2_CITK8          SSNVGVSKLALAMP-SSALVDTYSRFGLGKATNLGLVGERSGLYP-QKQRWSDIERATFS
A0A3N4B5A3_YERPE      SSNVGVSKLALAMP-SSALVDTYSRFGFGKATNLGLVGESSGLYP-KKQRWSDIERATFS
B2VD88_ERWT9          SSNVGVSRLALAMP-SNALVDTYSRFGLGKATNLGLVGESSGLYP-QKQRWADIERATFS
Q7CQD7_SALTY          SSDTGVSHLSLAMP-VQKLMDTYKSFGFGVPTGLGLTGESSGLLP-KRRYWSDLDRATFA
A9MNI7_SALAR          SSDTGVSHLSLAMP-VQKLMDTYKSFGFGVPTGLGLTGESSGLLP-KRRYWSDLDRATFA
A8AFN2_CITK8          SSDTGVSRLSLAMP-VQRLLDTYKGFGFGQSTGLGLTGESSGLLP-QRRYWSDLDRATFA
A6TAZ4_KLEP7          SSDTGVSHLSLAMP-VQHLIDTYKAFGFGEPTGLGLTGESAGLMP-HRRYWGQLDRATFA
E3DGY1_ERWSE          SSDIGVSHIALAMP-AEVLVNTYQAFGLGKSTGLGLTGESVGYFPLHRQRWADIERATFS
B2VFT4_ERWT9          SSDIGVSHIALAMP-AEVLVNTYQAFGLGKPTGLGLTGESVGYFPLHRQRWADIERATFS
H2IPU0_RAHAC          SSDIAVSHIALAMP-ASVLVQLYQSFGLGKPTDLGIGGESSGYFPAHRDRWADIERATFS
D4E674_SEROD          SSDIAVSHIALAMP-ATVLPAVYQSFGLGKPTELGIGNESSGYLPRHRTRWADIERATFS
FTSI_BUCAI            SSNVGVSKIALSMP-TLKLLDSYIKFGLGKPTQLGLIGEKHGFFPP-KKRWSNLDKATLS
FTSI_BUCAP            SSNVGVSKIALSMN-TSELINSYIKFGLGQPTNLGLIGEQKGFLPK-KKKLSDLEKATFS
FTSI_BUCBP            SSNTGVSRLALSIP-ISELIDIYSKFELGKSTNLGLIGERNGVLNTNKKHWSDLDKVTLS
FTSI_HAEIN            SSNRGVSRLALRMP-PSALMETYQNAGLSKPTDLGLIGEQVGILNANRKRWADIERATVA
Q9KPG1_VIBCH          SSNIGVAKLALEMP-LEALLGMYSSVGLGEMSGLDLVGETIGIFP-NRRRWSQFEIATLS
Q5E2P4_ALIF1          SSNIGVAHLALGMP-LQELLAEYAAVGLADPSGLNLIGEATGIFP-DRRRWSDFEIATLA
Q6LMF0_PHOPR          SSNIGMTKLSLAMP-IEDLIEMYQRVGFDEPSGINLVGEAVGLFP-NRRRWSDIERATFA
W0A3X2_AERHY          SSNIGMSRIALRMP-AQEMINTLSMVGFGMDTGSGLMGESGGMLP-QRRRWSDIERATLS
B1KKY3_SHEWM          SSNVGMAKIGLSMP-VQELLGSYQTMGLGNYSGINLEGESSGLIH-DRRRWSDFERATLS
Q8E9P2_SHEON          SSNVGISKLALSIP-VQQLLGTYQSMGLGSFSGINLTGESAGLIQ-DRHRWSDFERATLS
E1SMJ9_FERBD          SSNIGMAKMALQME-VDELLAFYADFGLGTYSGINLDGETTGNVP-KRRRWSEHERATLA
K0D3G6_ALTMS          SSNMGTSKLALSVP-KQFLLDTYYNMGLMSDTGLNMAGESSGIFH-ERSRWSEFELATLS
F5ZBR0_ALTNA          SSNMGTSKLALSVP-KQFLLDTYYNIGLMSDTGLNMAGESSGIFY-DRSRWSEFELATLS
Q47VQ3_COLP3          SSNMGTTKLALSVP-KDYLLTKFFDAGFADDTGTNLVGESVGMMH-DRSRWSKFELATLS
A1SU13_PSYIN          SSNIGVSKLALRLQ-PDQLQQTFSDFGFGNNTGIGLIGESFGRLP-LRGRWSDFELATMS
Q5NGX9_FRATT          SSNVGVSKMILGLTEPSILESSLRNFGFGSKTGIKLPGERDGYVP-TKDKWGDFQLATLS
                      **: .   :                          : .   *                 :

D0KXX8_HALNC          YGYGLSVTTLQLAAAYAALANHGRYIHPSLLKR------DAPPSYVQVAPAKDCDEVVSM
B7J3V8_ACIF2          YGYGLSVTPLQLAAAYGAIANNGVYVQPTLLRNTG----NTPSHSQQIMPAATAARLRDW
Q83F33_COXBU          YGYGLAVTTLQLAQGYAVLAAGGIRKPVTFVKV------NESPQGVRVLPENVAKTVIKM
A0A0P9SFL7_9PSED      YGYGLSVTALQLVHAYGALANNGRIVPLTILKTD-----KEPE-STQAIPEKTAKTLQGM
Q87WX9_PSESM          YGYGLSVTALQLVHAYGALANNGRIVPLTILKTD-----KEPE-STQAIPEKTAKTLQGM
I4K1J3_PSEFL          YGYGVSVTAIQLVHAFSALANNGRIAPLTLIKTD-----KAPQ-TTQVIPENVAKTMQGM
B1J1Y4_PSEPW          YGYGVSVTALQLVHAYAALANDGKMVPLSILKVD-----KTPE-AVQAIPKDTAETVQGM
FTSI_PSEAE            YGYGLSVTAIQLAHAYAALANDGKSVPLSMTRVD-----RVPD-GVQVISPEVASTVQGM
Q8PCK5_XANCP          YGYGLSVTPLQIAQAYATLGNGGKLTPPTFVRGQ-----HNE--TRQVVTPEVARQVIDM
Q5GW36_XANOR          YGYGLSVTPLQIAQAYATLGNGGKLTPPTFVRGQ-----HNE--TRQVITPEVARQVIDM
H8L356_FRAAD          YGYGENVTALQLANGYATIADNGVMHRPSFIKGV-----DNP--AKAIVAPEVAHELVKM
C5BP40_TERTT          FGYGLNVNTVQLAQAYAAIADGGEFKSASLLKVD-----KSAVAKHSAVNATIAQEVLNM
K0BZN7_CYCSP          FGYGLSTSALQLARAYSVIANEGVLEPISLVVDE------AAAESVRVMSPTVANSVRNM
Q604V2_METCA          FGYGVSASPLHLARAYLALASDGVIPPVSLLKLD------RSPEPVRVMSKKTAMTVRKM
PBP2_NEIMB            FGYGLQLSLLQLARAYTALTHDGVLLPVSFEKQAV------APQGKRIFKESTAREVRNL
Q5F6K9_NEIG1          FGYGLQLSLLQLARAYTALTHDGVLLPLSFEKQAV------APQGKRIFKESTAREVRNL
A0A1E9M4S0_9NEIS      FGYGLQLSLLQLARAYTVLTHDGELLPVSFEKQAV------APKGKRVIKASTAKKVREL
B1YSR8_BURA4          YGYGLSVSLFQLARAYTAIAHDGEMMPVTIFKTDPN----QQITGTQVFTPTTAREVRTM
Q63QJ1_BURPS          YGYGLSVSLFQLARAYTAIAHDGELMPVTIFKTNDA----QPPTGPRVFSPTTAREVRTM
Q0K6L8_CUPNH          YGYGLSVSLFQMAHAYTIFAHDGELIPVSMFRTSG------PATGERILSPQVARDVRAM
U3QLX4_RALPI          YGYGLSVSLFQMAHAYTIFAHDGELIPVSMFRTNG------PATGERILSPQVARDVRAM
A4SV68_POLAQ          FGYGISASLFQVARAYTVFARDGELVPLTIERSPE------FKPGTRVLSAKTAIEMREM
B1XT03_POLNS          FGYGISASLFQVARAYTVFARDGELVPLTIERSPE------FKPGIKVLSPKTAIEMRNM
I0HMQ2_RUBGI          YGYGLSASLLQIARAYTVFARDGDIAPVSILRQDG------PVAGVPIFKPETAQTMRAM
Q63KZ4_BURPS          YGYGLSTSLLQIAQVYTAYAGDGTIHPVSLLKASADPQSADAHRGHRVTTPATAAAIRSM
Q7VUP8_BORPE          YGYGLSVSLLQVARAYTVFARDGDMVSLTLVKRES------APTSVRVYNPKTAATVRAM
N8X3T7_ACIGI          YGYGLNATILQLAQGYAMLANHGVEYPLSLYKLND------QPKGKQVLAPKIADEVLLM
N9HFX1_ACILW          YGYGLNATVLQLADAYAMLANKGVKMPLSLYKLEE------QPQGEQMIDAKIADQVLLM
FTSI_ECOLI            FGYGLMVTPLQLARVYATIGSYGIYRPLSIT------KVDPPVPGERVFPESIVRTVVHM
Q32K08_SHIDS          FGYGLMVTPLQLARVYATIGSYGIYRPLSIT------KVDPPVPGERVFPESIVRTVVHM
Q7CR83_SALTY          FGYGLMVTPLQLARVYATIGSYGIYRPLSIT------KVDPPVPGERIFPESTVRTVVHM
A9MQC8_SALAR          FGYGLMVTPLQLARVYATIGSYGIYRPLSIT------KVDPPVPGERIFPESTVRTVVHM
A8ALL2_CITK8          FGYGLMVTPLQLARVYATIGSYGVYRPLSIT------KVDPPVPGERVFPEATVRTVVHM
A0A3N4B5A3_YERPE      FGYGLMVTPLQLARVYATIGSMGVYRPLSIT------RVDPPVAGERIFPEPLVRTVVHM
B2VD88_ERWT9          FGYGLMVTPLQLARVYATLGSYGIYRPLSIT------KVDPPVAGERVFPEPLVRTVLHM
Q7CQD7_SALTY          FGYGLMVTPLQLAHVYATIGSFGIYRPLSIT------KVDPPVIGTRVMPEELVHEVEHM
A9MNI7_SALAR          FGYGLMVTPLQLAHVYATIGSFGIYRPLSIT------KVDPPVIGTRVMSEELVHEVEHM
A8AFN2_CITK8          FGYGLMVTPLQLAHVYATIGSFGIYRPLSIT------RIDPPVVGTRVMPAELVHQVEHM
A6TAZ4_KLEP7          FGYGLMVTPLQLAHVYATIGGFGIARPLSIT------RIDPPVMGTRVMPESIVHSVEHM
E3DGY1_ERWSE          FGYGLRVTPLQIAREYATLGSFGVYRPLSIT------KVTPPVLGKRVADEQTVRAVVRM
B2VFT4_ERWT9          FGYGLRVTPLQIAREYATLGAFGVYRPLSIT------KVTPPVLGNRVADEETVRAVVRM
H2IPU0_RAHAC          FGYGLRVTPLQIAREYATIGAEGIYRPLSIT------KVTPPVLGTRVMSADVVRTVIHM
D4E674_SEROD          FGYGLRVTPLQMAREYAAIGAFGVYRPLSIT------KITPPVVGQRVMPESVVRSVVHM
FTSI_BUCAI            FGYGLMVTPLQLARLYSTIASYGIYRPLSII------KTDRPTGGKQIFPPKYVKKVINM
FTSI_BUCAP            FGYGLMITPLQLARLYTIIGSYGIYRPLSII------KIDHPLYEKRIFPKRYVKNVIHM
FTSI_BUCBP            FGYGLMATPLQLARIYTTIGRYGLSKPLSIIVKNDT-NLKNDIFSKQVFSKKIIKTVINM
FTSI_HAEIN            YGYGITATPLQIARAYATLGSFGVYRPLSIT------KVDPPVIGKRVFSEKITKDIVGI
Q9KPG1_VIBCH          FGYGLAITPIQLAHAYATLGNHGKYQPIHIIKGD------QHGETRQVVDPKYVNQVLEM
Q5E2P4_ALIF1          FGYGLSVTPIQLAHAYATLGAYGEYRPLSILKTT------GPTPGKQVVNRQHAKAVLEM
Q6LMF0_PHOPR          YGYGLSVTPIQLVHVYATLGAKGLKRPLSILKTE------KVVPGKQVIDPKLVEKVLTM
W0A3X2_AERHY          FGYGLRVTPLQLASAYATLANKGKRVPLSIIKVT------EPPKGEQVIDHNNATAMLQA
B1KKY3_SHEWM          FGYGFMVTPLQLARLYATLGSKGVLYPVSILKLK------QRPEGTQVISPHVAQSVMEM
Q8E9P2_SHEON          FGYGLTATTLQLARMYATLGNGGTLFPVSILKLK------KPPEGERVISEAVAKDVLQM
E1SMJ9_FERBD          FGYGLTSTPLQLARMYAILGANGVARPASILKLRD----GQVPEGEQVLSPKVAKQMLAI
K0D3G6_ALTMS          FGYGISVTTAQLGRLYATLANGGIKTPLNIIKSPE--QPSWQAQSERVISEENAKAIVQM
F5ZBR0_ALTNA          FGYGISVTTAQLGRLYATLANGGIKQPLNIIKSPQ--QTGWQGQPERVISEENAKAIVQM
Q47VQ3_COLP3          WGAGLAITPAQLTRFYMALANGGIKRKLTIVKSSD--KTTDPEDQERIFSAKNSLAITHM
A1SU13_PSYIN          FGYGITTTTLQLARAYAILGSGGVQYPVSILKNA------AAVQGEQVIPNNIAREVVAM
Q5NGX9_FRATT          FGYGMNATDLQLIAGVSAIANNGQYIKPTILKRRP----GEEIETRPIISEKNSKEMISM
                      :* *   .  ::          *      :                          :   

D0KXX8_HALNC          LQAVVSP--EGTAPKAQIAGFQIAGKTGTSR-MIGPDGTYSKDNYNTVFAGIAPASDPRL
B7J3V8_ACIF2          LTGVTGR--GGTGFLAAIPGYSVAGKTGTSI-MANGKGGFHKHQVNTTFVGFAPARNPQF
Q83F33_COXBU          LETVVQK--GGTGTRAQVYGYSVAGKTGTAY-IAGPNG-YFKHRYVASFVGIAPANNPRL
A0A0P9SFL7_9PSED      LQQVIED--PRGVYRARVPSYHVAGKSGTARKTSIGTKGYAENSYRSLFAGFGPMSNPRY
Q87WX9_PSESM          LQQVIED--PRGVYRARVPSYHVGGKSGTARKTSIGTKGYAENSYRSLFAGFGPMSNPRY
I4K1J3_PSEFL          LQQVIEA--PRGVYRAQVPAYHVAGKSGTARKTSVGTKGYAENSYRSLFAGFGPMSDPRY
B1J1Y4_PSEPW          LQQVIEA--PRGVFRAQVPFYHVAGKSGTARKATVGSKGYTENAYRSLFAGFGPMSDPRY
FTSI_PSEAE            LQQVVEA--QGGVFRAQVPGYHAAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRI
Q8PCK5_XANCP          METVVTQ--GG-AKGAAILGYHVAGKTGTARKNGAG--GYERGHYNALFAGLVPATRPRF
Q5GW36_XANOR          METVVTQ--GG-AKGAAILGYHVAGKTGTARKNGAS--GYERGHYNALFAGLVPATRPRF
H8L356_FRAAD          LETTTQP--GGTATKARIANYTVAAKTGTAHKAQAG--GYAKNSYEAVFAGIVPADHPRL
C5BP40_TERTT          MKTVPQP--GGTATRAQIDAYPVAGKTGTAHKVSSD--GYADDRHTALFAGVAPADNPRL
K0BZN7_CYCSP          MRGVVTK--AGTAPRAKVYGYSVAGKTGTVKKAIA--GGYAEDKYLGVFAGMAPASDPKL
Q604V2_METCA          LEGVVSA--DGTAIKASIPGFRVAGKTGTVKKNAGR-GGYQSSRYISVFAGMAPASDPRL
PBP2_NEIMB            MVSVTEP--GGTGTAGAVDGFDVGAKTGTARKFVNG--RYADNKHIATFIGFAPAKNPRV
Q5F6K9_NEIG1          MVSVTEP--GGTGTAGAVDGFDVGAKTGTARKFVNG--RYADNKHVATFIGFAPAKNPRV
A0A1E9M4S0_9NEIS      MVSVTEA--GGTGTAGAVDGFDVGAKTGTARKLVNG--RYVDNKHVGTFIGFAPAKNPRV
B1YSR8_BURA4          LETVVAP--GGTSPDAAVPGYRVGGKSGTAYKHEGH--GYT-RKYRASFVGMAPMPNPRI
Q63QJ1_BURPS          LESVVSP--QGTSPNAAVPGYRVGGKSGTAYKQVGR--GYDHKKYRASFVGMAPMPNPRI
Q0K6L8_CUPNH          METVTAP--GGTAPEAQVMGYRVGGKTGTAYKHEGR--GYNRSKYRASFIGLAPMSNPRI
U3QLX4_RALPI          METVTAP--GGTAPEAQVMGYRVGGKTGTAYKHEGR--GYNRSKYRASFIGLAPMSNPRI
A4SV68_POLAQ          MEAVTEP--GGTAVKAQAEGYRVGGKTGTAHKLVGK--GYG-NSYRAYFAGLAPISSPRI
B1XT03_POLNS          MEAVTEP--GGTAIKAQAEGFRVGGKTGTAHKLVGK--GYS-NKYRAYFAGLAPISAPRI
I0HMQ2_RUBGI          LSLVTQP--GGTAPKAAAIGYSTGGKSGTARKQEGK--GYS-NKYRAWFVGIAPISAPRI
Q63KZ4_BURPS          LEMAVGQ--GGTGRAARVDGYRVGGKTGTARKQVGA--SYVKGKYRALFAGMAPMSNPRL
Q7VUP8_BORPE          LEAAAGP--DG-TKRAQVQGYRVAGKSGTARKIVDG--KYSAQRHRSSFVGFAPVSNPKI
N8X3T7_ACIGI          LEQVTMP--GGTAKQANIPGYRVGGKTGTAHKLRPDHRGYSNTEYRALFAGVAPISDPRL
N9HFX1_ACILW          METATLP--GGTATRATIPGYRVAGKTGTAHKLRADRKGYSTSEYRALFAGVAPVSDPRI
FTSI_ECOLI            MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GRYINKYIAYTAGVAPASQPRF
Q32K08_SHIDS          MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GRYINKYIAYTAGVAPASQPRF
Q7CR83_SALTY          MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GRYINKYIAYTAGVAPASQPRF
A9MQC8_SALAR          MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GRYINKYIAYTAGVAPASQPRF
A8ALL2_CITK8          MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GRYINKYIAYTAGVAPASQPRF
A0A3N4B5A3_YERPE      MESVALP--GGGGTKAAIKGYRIAIKTGTAKKVGPD--GKYMDRYLAYTAGVAPASNPRF
B2VD88_ERWT9          MESVALP--GGGGVKAAIKGYRIAIKTGTAKKVGPD--GKFVNRYIAYTAGVAPASKPRF
Q7CQD7_SALTY          MESVALP--GGGGTKAAVRDYRIAVKTGTAKKIGDD--GKYVDKYVAYTAGVAPASNPRF
A9MNI7_SALAR          MESVALP--GGGGTKAAVRDYRIAVKTGTAKKIGDD--GKYVDKYVAYTAGVAPASNPRF
A8AFN2_CITK8          MESVALP--GGGGTKAAVRDYRVAVKTGTAKKIGDD--GKYVDKYVAYTAGVAPASDPQF
A6TAZ4_KLEP7          MESVALP--GGGGTKAAVRDYRVAVKTGTAKKIGPD--GKYIDKYVAYTAGVAPASRPQF
E3DGY1_ERWSE          MESDALP--GGSGVRAAVPGYRLAIKTGTAEKMGDS--GKYDGGYINYTAGVAPASHPQV
B2VFT4_ERWT9          MESDALP--GGSGVRAAVPGYRLAIKTGTAEKMGDS--GKYDGGYINYTAGVAPASHPQV
H2IPU0_RAHAC          MESDALP--GGSGLSAAVPGYRLAIKTGTAEKMGAS--GKYDGGYINYTAGVAPASNPRV
D4E674_SEROD          MESDALP--GGSGVSAAVPGYRLAIKTGTAEKMGDN--GKYDGGYINYTAGVAPASDPQV
FTSI_BUCAI            MESVSQP--GGGGLQAAVRGYRVAVKTGTAKKVGIH--GRYIKKYTAYTAGIAPASDPRF
FTSI_BUCAP            METVAHP--GEGGSQAAIKGYRVAIKTGTAKKVGIH--GYYIKKYIAYTAGIAPASNPKF
FTSI_BUCBP            LEEVAKP--GGAGFKAAIKGYRIAVKTGTAKKINSK--GKYDNKYVSYIVGFAPVSNPTF
FTSI_HAEIN            LEKVAIK--NK---RAMVEGYRVGVKTGTARKI-EN--GHYVNKYVAFTAGIAPISDPRY
Q9KPG1_VIBCH          LETVTQP--GGTATRAAVPGYRIAAKSGTSRKA-IA--GGYSDEYFAYTAGVAPVSDPRI
Q5E2P4_ALIF1          METVTQP--GGTATRAAVPGYRVAAKTGTSRKA-VR--GGYSDEYMTVTAGVAPVSNPRI
Q6LMF0_PHOPR          IESVTDKAGGGGGWRAGVPGYRVGVKTGTAKKA-IA--GGYGDDYIAYTAGIAPVSKPRL
W0A3X2_AERHY          LEYVVSN----AIPKAQIPGYRVGGKSGTAKVA-VA--GGYGKDYMAWFAGFAPASNPRF
B1KKY3_SHEWM          LVGVTEK--GGTATKAHIEGYPVAGKTGTARKA-VA--GGYGEDYVAVFAGVAPVHNPRL
Q8E9P2_SHEON          MVSVTEK--GGTGTLAHIDGYPVAGKSGTSRKA-VA--GGYGDDYVALFAGVAPVNNPKL
E1SMJ9_FERBD          LTQVTEP--GGTATRAAIDGYKVAGKTGTSRKA-VA--GGYGEDYVSLFAGLAPSDNPRL
K0D3G6_ALTMS          MESVTQRG--GTAIKASVPGYRVAGKTGTSRKA-VA--GGYGEEYVNIFAGIAPVSDPRL
F5ZBR0_ALTNA          MESVTQRG--GTAKKAAVPGYRVAGKTGTSRKA-VA--GGYGEEYVNIFAGIAPVSDPRL
Q47VQ3_COLP3          LEAVVDE----HVPKAKIDGYRVGGKTGTSIKA-VA--GGYGNDYVALFAGIAPISNPEI
A1SU13_PSYIN          MEGVTEK--GGTAPKAKVEGYRIAGKTGTSRKA-VA--GGYGDDYVAVFAGLAPASNPRF
Q5NGX9_FRATT          MQSVVEDL-GGTGSKAQIPLYHVAGKTGTARML-SG--GNYGAKYLASFVGIVPATDPKL
                      :              .    :  . *:**                     *. *   *  

D0KXX8_HALNC          VLVVVVTDPQQGSYYAGDVAAPIFHGIMSGALRMLNIRPDNLPN----------------
B7J3V8_ACIF2          VMAVVVRGPTRGWRYGGVVAAPVFRVTMGTALHQMGVQPD--------------------
Q83F33_COXBU          VVAVVIRDP-QGQHFGGIVAAPLFSKIMSGALRILDVPPD--------------------
A0A0P9SFL7_9PSED      AIVVVIDEPSKGGYYGGLVSAPVFSKVMSGTLRLMNVTPD----NLA-------------
Q87WX9_PSESM          AIVVVIDEPSKGGYYGGLVSAPVFSKVMSGTLRLMNVTPD----NLA-------------
I4K1J3_PSEFL          AIVVVIDEPSKAGYFGGLVSAPVFSKVMSGTLRLMNITPD----NLP-------------
B1J1Y4_PSEPW          AIVVVIDEPRKGGYFGGLVSAPVFSNVMSGTLRLMNVPPD----NLP-------------
FTSI_PSEAE            AMVVVIDEPSKAGYFGGLVSAPVFSKVMAGALRLMNVPPD----NLP-------------
Q8PCK5_XANCP          ATVIVINDPQGKVYYGGLVSAPVFHRVMEGALRLMDVPPD----DIQSWLAAQAAGKTGQ
Q5GW36_XANOR          ATVIVINDPQGKVYYGGLVSAPVFHKVMEGALRLMDVPPD----DIQSWLAAQAAGKTGQ
H8L356_FRAAD          VGVVIVDNPVKGGYYGGQVSAPVFANVMTGALRLLDVPPD----NIGRWYA-------GG
C5BP40_TERTT          VAIVVINEPSDGHYFGGEAAAPVFAKIVEESLKVLRVTPE----LPA-------------
K0BZN7_CYCSP          VMVVVIDEPKAGDYYGGLVAAPVFSRVMSGALRLMNIAPD--------------------
Q604V2_METCA          VTVVMIDEPSAGEYYGGAVAAPAFAAVMEPALRLLNVLPD--------------------
PBP2_NEIMB            IVAVTIDEPTAHGYYGGVVAGPPFKKIMGGSLNILGISPT--------------------
Q5F6K9_NEIG1          IVAVTIDEPTAHGYYGGVVAGPPFKKIMGGSLNILGISPT--------------------
A0A1E9M4S0_9NEIS      IVAVTIDEPTANGYYGGVVAGPVFKEVMSGSLNILGVSPT--------------------
B1YSR8_BURA4          VVAVSVDEPTAGSHFGGQVSGPVFSAIAGDTMRALNVPPN--------------------
Q63QJ1_BURPS          VVAVSVDEPTTGGHFGGQVSGPVFSAIVGDTLRALNVPPN--------------------
Q0K6L8_CUPNH          IVAVSVDEPTAGSHYGGLVAGPAFAAITGGTLRALNVQPD--------------------
U3QLX4_RALPI          IVAVSVDEPTAGSHYGGLVAGPAFAAITGGTLRALNVQPD--------------------
A4SV68_POLAQ          VVAVMIDEPTGGSHYGGDVAAPVFSTIVGETLRTLNVLPD--------------------
B1XT03_POLNS          VVAVMIDEPTGGSHYGGDVAAPVFSTIVSETLHTLNVLPD--------------------
I0HMQ2_RUBGI          VVAVMVDEPGKGVFYGGDIAGPVFSQVVQNTLRMMGVPPD--------------------
Q63KZ4_BURPS          IIAVMIDEPAARSYYGGTVAGPVFSSVMSGSLQLLGVPPD--------------------
Q7VUP8_BORPE          VVAVSIDEPQVGGYYGGAIAAPVFSRIVGGSLRLMGVQPD--------------------
N8X3T7_ACIGI          AVIVVVENP-RGQYYGGLVAAPVFARIMQESLRLMNVPLD--------------------
N9HFX1_ACILW          AMVVVVENP-QGTYYGGTVSAPVFARVMQESLRLLNVPLD--------------------
FTSI_ECOLI            ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
Q32K08_SHIDS          ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
Q7CR83_SALTY          ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
A9MQC8_SALAR          ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
A8ALL2_CITK8          ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
A0A3N4B5A3_YERPE      ALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDAL------------------
B2VD88_ERWT9          ALVVVINDPQSGKYYGGAVSAPVFGAIMGGVLRTMNVEPDAL------------------
Q7CQD7_SALTY          ALVVVINNPQNGAYYGGAVSAPVFSQIMGDVLRLENVEPDGM------------------
A9MNI7_SALAR          ALVVVINNPQNGAYYGGAVSAPVFSQIMGDVLRLENVEPDGM------------------
A8AFN2_CITK8          ALVVVINNPQNGSYYGGAVSAPVFSQIMGDVLRLENVKPDGM------------------
A6TAZ4_KLEP7          ALVVVMNDPSNGSYYGGAVSAPVFSQIMGDVLRLENVMPDGM------------------
E3DGY1_ERWSE          ALVIMINHPTAGDHFGGSVAAPVFGNIIGPVLKHMNIPPDAL------------------
B2VFT4_ERWT9          ALVIMINHPTAGDHFGGSVAAPVFGNIIGPVLKHMNIPPDAL------------------
H2IPU0_RAHAC          ALVVMVNNPQAGKHFGGSVAGPIFGQIMGEILNHMNIAPDAL------------------
D4E674_SEROD          ALVVMVNNPKAGKHFGGSVAGPVFGKIMAQVLEHMNILPDAQ------------------
FTSI_BUCAI            SLIIILDNPQGKKYYGGAVSAPVFSNIMKLILKKMNIKPDNL------------------
FTSI_BUCAP            SLTIIIDNPKGEKYYGGAVSAPVFSKIMKLVLKEMKIKPDNL------------------
FTSI_BUCBP            CLMIMINEPKSNKYYGGEIAAPIFKTIMQKILKIKNIKPDAY------------------
FTSI_HAEIN            ALVVLINDPKAGEYYGGAVSAPVFSNIMGYALRANAIPQDAE------------------
Q9KPG1_VIBCH          SLVVMVNEPQGDSYYGGAVAGPVFSEIMKGALQILNIAPDEN------------------
Q5E2P4_ALIF1          ALVTIVNQPQGDEYYAGQVAAPIFGQVMKDALQILNVAPDES------------------
Q6LMF0_PHOPR          AMVVMVNEPKGEQYYGGAIAAPIFAEVMQNALQILNVPPDAD------------------
W0A3X2_AERHY          VMVVVINEPKGDAYYGGAVATPPFAEAMGGVLQLFNIRPDAI------------------
B1KKY3_SHEWM          AIAVVVNEPKGDKYYGGDLAAPAFAKVMSGALQMLNVEPISS------------------
Q8E9P2_SHEON          AIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEPISD------------------
E1SMJ9_FERBD          AMAVVINEPQGDAYYGGVVAAPVFSEVMAGALQLLNVEPSQR------------------
K0D3G6_ALTMS          VTIVLINEPGGDLYHAGDTAAPVFSSIMGGALHMLNVTPDD-------------------
F5ZBR0_ALTNA          VTIVLINEPGGDLYHAGDTAAPVFSSIMGGALHMLNVTPDD-------------------
Q47VQ3_COLP3          VVVVVINEPSGDLYHGGEVAAPVFSRVMKGALRVLNVAPDAQ------------------
A1SU13_PSYIN          AIVVMINEPQGDRYYAGDVAAPVFSAVMKSALLLSHVRPDDE------------------
Q5NGX9_FRATT          AIVVTIKDPKGDQYGGGSVAAPVFADVALNSLQILGVKLDKI------------------
                           :  *      .*  : * *       :    :                       

D0KXX8_HALNC          ---------------------EPAEVTAASVPPPSTAVAGKKQAGGA-------------
B7J3V8_ACIF2          ---------------------IGAEGWNAAAGKPMTAEQERRWAEGAGDAAH--------
Q83F33_COXBU          ---------------------------NS-------------------------------
A0A0P9SFL7_9PSED      --------------------------PPE---QVNAAPA----AKGGRG-----------
Q87WX9_PSESM          --------------------------PPE---QVNVAPA----AKGGRG-----------
I4K1J3_PSEFL          --------------------------PTQ---QANTAPVVPLKAEGGRG-----------
B1J1Y4_PSEPW          --------------------------PPADPQQVNAVPA-----KGGRG-----------
FTSI_PSEAE            --------------------------TATEQQQVNAAPA-----KGGRG-----------
Q8PCK5_XANCP          PVVKPQPADLDPALVPDPVDEVSAGIPTALASG--ATPAQPAPLQESRQ-----------
Q5GW36_XANOR          PMVKPQSADLDPALVPDPVDEVSAGIPTALAPAPAAAPAQPAPLQESRQ-----------
H8L356_FRAAD          PVQSP------------------SGLVGSKPPE--DAPAEEAPADEVP------------
C5BP40_TERTT          -------------------------------LQTAQVVGF--------------------
K0BZN7_CYCSP          --------------------------------NLDKATVFASLERGIQ------------
Q604V2_METCA          --------------------------------QDMGPSILSAQKEEVF------------
PBP2_NEIMB            --------------------------------KPLT-AAAVKTPS---------------
Q5F6K9_NEIG1          --------------------------------KPLT-AAAVKTPS---------------
A0A1E9M4S0_9NEIS      --------------------------------KPLSNTATVKVPS---------------
B1YSR8_BURA4          --------------------------------MPIKQLVVSDDAPGAPAKPGPQKLAAGS
Q63QJ1_BURPS          --------------------------------MPVKQLVVSDDATNAAA---AQKLAANA
Q0K6L8_CUPNH          --------------------------------SPIRQLVVSDKVQESEP-----------
U3QLX4_RALPI          --------------------------------SPIRQLVVSDKVQESEP-----------
A4SV68_POLAQ          --------------------------------SKVKQMVLDDKPAESAH-----------
B1XT03_POLNS          --------------------------------SKVKQMVLQDKSSQEIQ-----------
I0HMQ2_RUBGI          --------------------------------IPVQAQIVAPVAAEPESF----------
Q63KZ4_BURPS          --------------------------------APIAADKPAGAGAKPQA-----------
Q7VUP8_BORPE          --------------------------------APFESTIVAGNPEGAR------------
N8X3T7_ACIGI          --------------------------------KPLETAKAKP------------------
N9HFX1_ACILW          --------------------------------KPLEPPKVQ-------------------
FTSI_ECOLI            --------------------------------TTGDKNEFVINQGEGTGGRS--------
Q32K08_SHIDS          --------------------------------TTGDKNEFVINQGEGTGGRS--------
Q7CR83_SALTY          --------------------------------ATGEKNEFVINQGEGTGGRS--------
A9MQC8_SALAR          --------------------------------ATGEKNEFVINQGEGTGGRS--------
A8ALL2_CITK8          --------------------------------ATGEKSEFVINQGEGTGGRS--------
A0A3N4B5A3_YERPE      --------------------------------PTGDKSELVINTKEGSGGRS--------
B2VD88_ERWT9          --------------------------------PTIDKNEMVTNKNEALSGRS--------
Q7CQD7_SALTY          --------------------------------PADSDHLLVMHGSHVAVPGS--------
A9MNI7_SALAR          --------------------------------PADSDHLLVMHGNHVSVPGL--------
A8AFN2_CITK8          --------------------------------PADSDHLLVMHGNRLSSPSL--------
A6TAZ4_KLEP7          --------------------------------PQGAENLIVMHDSHPQGPAL--------
E3DGY1_ERWSE          --------------------------------YNHS------------------------
B2VFT4_ERWT9          --------------------------------YGHG------------------------
H2IPU0_RAHAC          --------------------------------VPETPPTTVINGGQKTDLVRRPATDG--
D4E674_SEROD          --------------------------------PLNVVSHIKG------------------
FTSI_BUCAI            --------------------------------SNQKMILKSNKRN---------------
FTSI_BUCAP            --------------------------------KNKLS-----------------------
FTSI_BUCBP            --------------------------------L---------------------------
FTSI_HAEIN            --------------------------------AAENTTTKSAKRIVYIGEHKNQKVN---
Q9KPG1_VIBCH          --------------------------------RFQNK-----------------------
Q5E2P4_ALIF1          --------------------------------TVKHIDVLN-------------------
Q6LMF0_PHOPR          --------------------------------TIDKMNIVNK------------------
W0A3X2_AERHY          --------------------------------PPEVPAKLARTEAAHGAPRT--------
B1KKY3_SHEWM          --------------------------------TEKVRLAGSTRRAE--------------
Q8E9P2_SHEON          --------------------------------KEQVQLAGLAGRAE--------------
E1SMJ9_FERBD          --------------------------------SPELGTLASVWGSDNVVTR---------
K0D3G6_ALTMS          --------------------------------KQVTSSRLLKGGQSGS------------
F5ZBR0_ALTNA          --------------------------------KHVTSGAWLKGGNSGS------------
Q47VQ3_COLP3          --------------------------------KSRTASKHIKLTHPAQKPVAGEHHA---
A1SU13_PSYIN          --------------------------------NDSYTYLESN------------------
Q5NGX9_FRATT          --------------------------------EN--------------------------
                                                                                  

D0KXX8_HALNC          --------------------
B7J3V8_ACIF2          --------------------
Q83F33_COXBU          --------------------
A0A0P9SFL7_9PSED      --------------------
Q87WX9_PSESM          --------------------
I4K1J3_PSEFL          --------------------
B1J1Y4_PSEPW          --------------------
FTSI_PSEAE            --------------------
Q8PCK5_XANCP          --------------------
Q5GW36_XANOR          --------------------
H8L356_FRAAD          --------------------
C5BP40_TERTT          --------------------
K0BZN7_CYCSP          --------------------
Q604V2_METCA          --------------------
PBP2_NEIMB            --------------------
Q5F6K9_NEIG1          --------------------
A0A1E9M4S0_9NEIS      --------------------
B1YSR8_BURA4          GAKHMIVSSTTRNSPGVVR-
Q63QJ1_BURPS          PAKRLIVSSTTHNRPGVVR-
Q0K6L8_CUPNH          -------WSSTQ--------
U3QLX4_RALPI          -------WSATQ--------
A4SV68_POLAQ          -------TANVQAQHVVLKR
B1XT03_POLNS          -------TANAQAQHVVLKR
I0HMQ2_RUBGI          --------------------
Q63KZ4_BURPS          -------KAKT---------
Q7VUP8_BORPE          --------------------
N8X3T7_ACIGI          --------------------
N9HFX1_ACILW          --------------------
FTSI_ECOLI            --------------------
Q32K08_SHIDS          --------------------
Q7CR83_SALTY          --------------------
A9MQC8_SALAR          --------------------
A8ALL2_CITK8          --------------------
A0A3N4B5A3_YERPE      --------------------
B2VD88_ERWT9          --------------------
Q7CQD7_SALTY          --------------------
A9MNI7_SALAR          --------------------
A8AFN2_CITK8          --------------------
A6TAZ4_KLEP7          --------------------
E3DGY1_ERWSE          --------------------
B2VFT4_ERWT9          --------------------
H2IPU0_RAHAC          --------------------
D4E674_SEROD          --------------------
FTSI_BUCAI            --------------------
FTSI_BUCAP            --------------------
FTSI_BUCBP            --------------------
FTSI_HAEIN            --------------------
Q9KPG1_VIBCH          --------------------
Q5E2P4_ALIF1          --------------------
Q6LMF0_PHOPR          --------------------
W0A3X2_AERHY          --------------------
B1KKY3_SHEWM          --------------------
Q8E9P2_SHEON          --------------------
E1SMJ9_FERBD          --------------------
K0D3G6_ALTMS          --------------------
F5ZBR0_ALTNA          --------------------
Q47VQ3_COLP3          --------------------
A1SU13_PSYIN          --------------------
Q5NGX9_FRATT          --------------------