CLUSTAL format seed alignment for MF_02081

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D0SAM0_ACIJO          ---------MKQHFPLKNVQQEKRIFRNRTFISMGIVVFFLLILVTRYAYLQLVQFDEFS
Q4FRE7_PSYA2          ----------MNKPLTPDTEQVNSIFTSRILILGLIIFVGLLGLIARYGFLQIFAHDKYT
F8G6R0_PSEP6          ---------MSQPIRLKDHEKDARLVRNRVVVGAVAIMLLICVLIARLYYLQVIQHDYHS
J8V5W5_PSEPU          ---------MSQPIRLKDHEKDARLVRNRVVVGAVAIMLLICVLIARLYYLQVIQHDYHS
A0A0X1SZ91_PSEAA      ---------MTQPIRLKDHEKDARLVRKRVVVGAVVVVLLIGVLIARLYFLQVVQHEYHS
F6AE75_PSEF1          ---------MPQPIRLKDHEKDARLIRKRALVGGSVFLVLTLVLIARMYYLQVIQYDYHS
A4VR03_PSEU5          ---------MPQPIQLKDHEKDAVLVRQRVIVGLVFVLLLIGVLVARMYYLQVVQFEHHS
A0A024HAK7_PSEKB      ---------MPQPIQLKDHEKDARLVRSRVVVGAVAVFILALVLVARMYHLQVTQYEYHS
C1DMQ4_AZOVD          ---------MPEPIRLKDHEKDARLVRARAVVGATAIVLLSLVLVVRLYYLQVVQYQHHS
Q3K9B4_PSEPF          ---------MPEPIPIKDHEKETRLVNKRLIACALFVFAISCALVVRLYILQVVEFDYHS
F8XKR8_PSESJ          ---------MPNPIPLKDHEKETRLVNQRLIACAVLVGVLAACLVARMYFLQVTEFDYHS
Q1IAM3_PSEE4          ---------MPQPIPLKDHEKEKSLVNRRLLACAVLVMSLVAVLVGRLYVLQVLQHDQQS
A1U3B9_MARHV          ----------MVWGELKNTAAERRLFQRRAMVMLVFVLVLMTGLLARMYQLQIVEHEIYT
K4KXF7_SIMAS          ---------MSDHLQIKDHHREARVFARRAGVAGILILGCLSLIFVRYYRLQITEHEDYV
W0E3I9_MARPU          --------MLESGFQ--DRKREQRIIATRSAIAALLVVLALALLVVRLLHLQVERHDHFS
I1XMJ6_METNJ          --------MIDPRHRLKDHFREGRLVSNRLIFAGLFSLILFGIIIFRLVMLQIVEFEHFD
L0DY27_THIND          -------MLIDRNDSYDEGSRDQRRFSIRVLVAIVVLLGLVLTIGVRMFSLQVGAHAHFT
H8GQD8_METAL          ---------MDRVFSIKNDLAENRLFLRRIYVAMLFIGLMSAGLVVRLMYLQIVGHEHYA
D5CU46_SIDLE          ---------MNRYVELKNHQREIYYFRLRLVLSLGFVAVMLLILLLRFFYLQVIRHDYFH
Q7NPY2_CHRVO          ---------MRRPSRFKNPQSEEAQFELRLVIAYALIILMFLILLARFVWLQVLQHDHFS
D8NAB8_RALSL          ---------MTEIR--NVEQ-ELSRFRVRLAAAALFVLVCFGLLLARFVWLQSVKHEQYS
A2S8I4_BURM9          ---------MTEFK--DTQQ-QLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHGKYA
G4QDF4_TAYAM          ---------MFEFA--PKKGVNRKKLLIRVFVAMLLVLSCFGLLIYRLYFLQIVRYQGFS
V8QQ28_9BURK          ---------MFEFR--KRSAIQRKKIRLRVVVAIVFVLGCFGLLIDRLWVLQVERYQGLA
Q2KU77_BORA1          ---------MFEFK--KTSQQQKQRFRLRAWVGGLFALACFGVLIGRFWYLQVDRYEGFS
G0CGF2_XANCA          ---------MHGRRHPKNPHAEAEQFRRRAVLGFVMVVLCLVGLGGWYFKLQVLDHEVYA
G7TCD5_XANOB          ---------MHGHRHPKNPHAEAEQFRRRAVLGFAMVLICLVGLGGWYFKLQVLDHEVYA
B4SJ25_STRM5          ---------MIPRRQVKNPHAEAEQFRRRAALGFLGVLVCLLGLGGWYFKLQVLDHDVYA
B2I959_XYLF2          --------MSVHHPQAKHTYAEVEQFRRRALLSLFVVVVCLFGLVGWYFKLQVLDHEIYA
B7J7N2_ACIF2          -------------MNAVQPAREHRQFTRRLLVAAGLITALTALLAIQIFRLQVWDHDLYA
Q31F48_HYDCU          --MGMKNKH--RYQTESEIFFQKRLFRNRIYFALALALIFFSLLWVRMSYLQWVGYKHYH
A5CW45_VESOH          --MASRSVLIIKMQSINNVQFENKTLFSRLRLALIFIFLLTTLLIIRIYNLQIVNHQYYL
A9KCR1_COXBN          -MIGMNRER----LTIKNIHLETHLFKSRCLTALILLLIFAFILIGRLIYLQIKNHHFYS
Q87RQ5_VIBPA          -------MIRRRRSQIRDYQAEARLFASRAIVAFFGIVVLMGLLVANMYNIQVNQFQDYQ
Q6LLA3_PHOPR          --------MSKEKVKIRDHQSEMALFTGRAIAAFLFMLVGVGVLLTNLYHLQIENHSQYQ
MRDA_ECOLI            --------MKLQ-NSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQ
A7MK35_CROS8          --------MKLK-DSFRDYTAESALFVRRALVAFAGILVLTGILIVNLYHLQILRFNDYQ
D4GM21_PANAM          --------MKLQSNAFRDYSAEQKVFVRRAFIAFVGILLLSSVLVVNLYHLQILRFDDYS
A1JPW7_YERE8          --------MKKEPNPFRDYSAESALFVRRALVAFLGILLLSGILVANMYNLQIVRFEDYR
U2M473_SERFO          --MKKSSGMKIERNPFRDYTAESALFVRRAVVAFFIILVLTGILIANLYNLQIVRFEDYR
E0SEU1_DICD3          --------MNIERKPFRDYTAEAALFVRRALVAFLGILLLSGILVANLYHLQVSRFDDYR
A0A0H3I6R0_PECPM      --------MKVERKPFRDYTAESALFVRRALVAFLGILLLSGVLVANLYHLQILRVDDYR
Q492Z7_BLOPB          -------MKSNGHQIFHNYSAESLLFARRITIASVFVLLIIGILFIHLYQIQIIHFDMYT
Q7VRB0_BLOFL          -------MKSNNLQVFHSCSPESLLFTKRIMISCTVIIFIISILFIQLYRIQIMHFHMYV
I2B442_SHIBC          --------MVLLRDEIRDHLAEKRLFARRAVTSLLLVVVCFGILVANLCRLQIREHDFYQ
A8GEB7_SERP5          --------MALLKDKIRDHSAEEMLFIRRAGVAMVLVVACFGVLVANLYRLQVKQHGFYQ
E6WAB0_PANSA          -------------MNFRNFEAEEKLFVRRAIVAFALVVICFTILGVNLYHLQVDENSYYA
MRDA_SALTY            -------------MTFKDFDAEEKLFLRRVIVAFGVVVVCFGILIFNLYNLQIRQHHYYT
G9Y2R2_HAFAL          --------MSRLPELLRDHSAEATLFVRRSIIAAVVVVLLFGVLVFNLYHLQVEEHEQYQ
Q9CJR8_PASMU          MKKLKKLLAKPQQELIRDKKSERNLFARRALVSFIFVWVLTAILATNLYHLQIVNYDSYQ
MRDA_HAEIN            -MNLKKFFNTPTHEPFRDKKAERNLFARRTLVAFLGILLLTGVLFTNIYQLQIVNFDTYQ
B8F685_HAEPS          --MFGKFAKPQNYDKVRNGQAELNLFVRRALIAFVGVIALTGILLTNLYHLQIVDYASYQ
A3QH53_SHELP          -------MAPRKRMAMHDHAAEASLFKRRAIFTFACVVVLLSILLGNLYHLQVLSYKDYE
A1S8T4_SHEAM          ---------------MHDHAAEAALFKRRAIFTFLCVVALFGVLLTNLYHLQVTSYADYT
Q5QYD8_IDILO          ---------MRHRTHIRDHDSEAAVFGRRVLVAMVIVVAAFIALASNMYHLQVSEHNELQ
                                               .  *              :      :*        

D0SAM0_ACIJO          TASDQNRIRLQPLAPARGYIYDRNGVLLADNYPVFTATMSRADVTD-IDATIERLTPILE
Q4FRE7_PSYA2          TQSDNNRIKLISAPPSRGYIYDRNGIILADNQPVFTAMLSPDEVGD-PERTLQLLAPIFD
F8G6R0_PSEP6          TLSENNRVHVQPIPPTRGLIFDRNGVIVADNRPSFSLSMTRERAGN-WQEVLDTIVEVLE
J8V5W5_PSEPU          TLSENNRVHVQPIPPTRGLIFDRNGVIVADNRPSFSLSMTRERAGN-WQEVLDTIVEVLE
A0A0X1SZ91_PSEAA      TLSENNRVHVQSIPPPRGLIYDRNGVVVADNRPSFSLSMTRERSGD-WQQVLDVIVEVLQ
F6AE75_PSEF1          TLAENNRIHVQPIPPNRGLIFDRNGVIIADNRPSFSLTLTRERAGD-WEKVLDVIVEVLQ
A4VR03_PSEU5          TLSENNRVHVQPIPPNRGLIFDRQGRVIADNRPSFSLTVTRERAGD-WRVVLDAVVEILE
A0A024HAK7_PSEKB      TLSENNRVHVQPIPPTRGLIYDRNGVLIADNRPSFSLTVTRERTEN-LKQELQFLVDILG
C1DMQ4_AZOVD          TLAENNRIHVQPIPPNRGLIFDRNGVILADNRPSFSLTVTRERAGD-WQKVLDTIVEVLE
Q3K9B4_PSEPF          TISENNRVHVLPIPPTRGLIYDRNGVLLADNRPSYNLTITRERATD-VNQELDEVINLLH
F8XKR8_PSESJ          TISENNRVHVLPIPPERGLIFDRNGEVLADNRPSFNLTLTRERAGD-WHKVIDELMTLLE
Q1IAM3_PSEE4          AVSENNRVHVLPIPPERGLIYDRNGVVLATNKPSFDLTMTRERAGD-SARVLDTLTQILG
A1U3B9_MARHV          TLSDKNRVQVQSVPPPRGLVYDRNNILLAENRPVFSLTVVPERVGD-MDATLARLSDILS
K4KXF7_SIMAS          TRSDRNRVQVQPVAPTRGLIYDRSGRLLADNRPSYTLSIVREQTTD-LDTTLETLKQLVA
W0E3I9_MARPU          VLSQDNRVKIQPIPPTRGLIYDANGVLLAENHPSFSLEITVEKVSD-LDATITALSRIIP
I1XMJ6_METNJ          SLSNRNRVDIEPLPPQRGLIYDRNGVLLAENIPTFSLELIPEKVEN-LDETITELSELLS
L0DY27_THIND          TLSENNRLRIEPIPPARGLIYDRNGVLLAENQPAYQLEVTVEQAGD-LDRLLKRLAPLVD
H8GQD8_METAL          TLAKENSIKLTPVPPTRGIIYDRNGRILAENTPSYSLELIPEQIED-MEDTLRRLQALFG
D5CU46_SIDLE          TMADSNRIYVVPIVPNRGLILDRNGVVMAKNYSGYTLEIAPTKVKD-MDGLIAELSRLVE
Q7NPY2_CHRVO          TLAQNNRISLVPILPNRGLILDRNGIVLAQNYSAYTLELTPSKISD-LAATIAKLKTLAD
D8NAB8_RALSL          AKAEDNRISVAPIEPNRGIIMDRNGVVLARNYSAYTLEITPSKLQDTLDNTIDQLAQVID
A2S8I4_BURM9          LQAEENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLADTLDNTINALAEVVQ
G4QDF4_TAYAM          ERAERNRITLLPIPPKRGDVVDRNGEVLARSYRDYTIEIVPHDFKD-LDALINELQEIIA
V8QQ28_9BURK          ERADRNRIALVPISPRRGDIVDRNGTVLARSYRDYTLEIVPAQVKN-LDELINQISTVIT
Q2KU77_BORA1          ERADRNRIAVQPIPPRRGEVLDRNGVVLARNYRTYTLEVVPARAGP-VDELFARLTPVVY
G0CGF2_XANCA          TRSEANRIKPRPVVPGRGMIYDRSGRLLAENVPAFRLDVTPDKVED-METMLAALGKVIP
G7TCD5_XANOB          TRSEANRIKPKPVVPGRGMIYDRTGRLLAENVPAFRLDVTPDKVTD-MSAMLDALGKVIP
B4SJ25_STRM5          TRSEANRIKPRPVVPGRGMIYDRNGRLLAENVPAFRLDVTPDKVKD-MDATLEGLAKIIS
B2I959_XYLF2          TRSDANRIKLHPVVPGRGMIYDRDGRLLADNVPAFRLDVMPDKVAD-MEAMLVELGKVIP
B7J7N2_ACIF2          TQSTHNTLVLLPIAPQRGLILDRHGQVLADDQTGFALTITPNKAMH-PEETIRRLRRILP
Q31F48_HYDCU          SMSEGNRISVEAIPPVRGRIFDRNHVLLADNQPVFVLKFSKDKIEN-IQDSFSILQELLP
A5CW45_VESOH          KKSLDNQIRTMPITPSRGKIFDRNGNVLATNKLAFRLTLTQEKTKN-ITKTLQQLKQS-G
A9KCR1_COXBN          TLSRHNLLNIIPIEPNRGLIFDRNGVLLAKDIPTYILTILPNGTHH-LNETIRELTKIIP
Q87RQ5_VIBPA          TRSNDNRIKVVPIAPNRGLIYDRNGVLLAENRPVFNLELTPEKIKD-IDATIQELQTILE
Q6LLA3_PHOPR          SRSNNNRIKVIPVEPNRGRIYDRNGVLLAQNTPVYSLELVPEKVHD-MDATLASLKSLLG
MRDA_ECOLI            TRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDN-VQQTLDALRSVVD
A7MK35_CROS8          TRSNENRIKLVPIPPSRGIIYDRNGTPLALNRTIYQIEMMPEKVDS-VQDTLEALRSVVD
D4GM21_PANAM          TRSNENRIKLVPVAPSRGIIYDRTGTPLALNRTIYQAELVPEKVDD-LKQTLQNLRPVLE
A1JPW7_YERE8          TRSNENRIKLVPIAPSRGMIFDRNGTPLAMNRTIYQLELMPEKIED-LPATLNALRPIVD
U2M473_SERFO          TRSNENRIKLLPIAPSRGIIYDRNGTPLALNRTIYQLELMPEKVDD-LKATLEALRPVVD
E0SEU1_DICD3          TRSNENRIKLVPIAPSRGIIYDRNGTPLALNRTIYQLELIPEKVNN-LEETLQALKSIID
A0A0H3I6R0_PECPM      TRSNENRIKLVPIAPSRGIIYDRNGTPLALNRTIYQLELVPDKVDN-LKETLDALRPIVN
Q492Z7_BLOPB          TRSNENRIKIIPIPPKRGIIYDRNGIALALNRTIYQLEIVPENTID-LSHTIHELKLLLN
Q7VRB0_BLOFL          TRSNENRIKIIPISPKRGIIYDRNGIALALNRTVYYLEIMPKHILN-LNQTIYKLQSLLH
I2B442_SHIBC          TRSEQNAIKMLPVAPTRGLIFDRNGTALVRNITLFRLQVIPGKTAS-ISQMLQALTPVVH
A8GEB7_SERP5          TRSNQNDIKMVPIAPSRGLIFDRNGTPLVRNITLYQIQIIPSKIEN-MTALLQELTPIVD
E6WAB0_PANSA          TRSNENDIKMIPIAPTRGLIYDRNGIPLVRNVTWYDILLTPYKIDD-MKATIAALTPIVD
MRDA_SALTY            TRSNENDIKMLPVAPTRGIIYDRNGIPLVRNVTWYDIAVTPYKIAD-MDALLKQLTPIVD
G9Y2R2_HAFAL          TRSNANDIKTLPIAPVRGLIYDRNGIPLVQNQTLYQIELIPGKIAD-LDATLKALTPIVD
Q9CJR8_PASMU          TRSNGNRIKLLPLPPTRGLIYDRYGKLLAENLTFFGLYIVPEKVEN-LERTFEELKAIVG
MRDA_HAEIN            TRSNGNRIKLLPLPPTRGLIYDRYGKLLAENLTFFGLYIVPEKTEN-LDRTLDELRYIVG
B8F685_HAEPS          TRSDGNRIKLLPVPPTRGLIYDRNGKVLAENLTYFGLYIVPEKIYN-LDQTLEELKLLVG
A3QH53_SHELP          TRSNDNRIRVVPVAPSRGLIYDRHGQLLAENQPFYSLELIPEKVKD-VPATLDELAKVVE
A1S8T4_SHEAM          TRSNDNRIRVTPVAPSRGLIYDRNGVLLAENQPVYSLELIPEKVKN-IPQTLTQLSTVIP
Q5QYD8_IDILO          TRSNDNRIKLLPLAPNRGLIYDRNGVLLAENTPIYSLDVTPEEIDN-LEQTLSQLQQLLD
                        :  * :   .  * ** : *     :. .   :   .            :  :     

D0SAM0_ACIJO          LTPDDIERFNSRIKASR-KTERVSIKLNLNENDIARFSEVKYQF--PGVNIETQMTRYYP
Q4FRE7_PSYA2          LTDENITDILARLSKN--KNDPVTIKIDLTEAQLAQFSERKPFF--RGVTIQSKLTRSYP
F8G6R0_PSEP6          LTADDRALFEKRMRQGRRPFEPVPILFELNEEQIARVAVNQFRL--PGVEVVAQLVRHYP
J8V5W5_PSEPU          LTPDDRALFEKRMRQGRRPFEPVPILFELNEEQIARVAVNQFRL--PGVEVVAQLVRHYP
A0A0X1SZ91_PSEAA      LTPEDRVLFEKRMRQGRRPFEPVPILFELSEEQIARVAVNQFRL--PGVEVVAQLVRHYP
F6AE75_PSEF1          LPPEDRELFERRVKQGRRPFEPVPVLFELSEEQIARLAVNQFRL--PGVEVVAQLVRHYP
A4VR03_PSEU5          LGEEERGLFEKRVLQGRRPFEPVPIMYELSEEQIARIAVNQFRL--PGIEVAAQLVRHYP
A0A024HAK7_PSEKB      LTEEDRAIFEKRMKQGRRPFEPVPIMFELSEEQIARIAVNQYRL--PGIDVTAQFVRHYP
C1DMQ4_AZOVD          LGPEERALFEKRVRQGRRPFEPVPVLFELSEEQIARVAVNQFLL--PGVEVAAQLVRHYP
Q3K9B4_PSEPF          LPAEDRAVFDKAMKQSRHPFTPVTLFYELTEEQIAVLAVNEFRL--PGLDVEPQFVRNYP
F8XKR8_PSESJ          LPDEDRILFDKELKQVRHPFEPATLLYELTEEHIATLAVNQYLL--PGVDVAAQFVRHYP
Q1IAM3_PSEE4          LGEDDRHQFDKDLRRGRKPFEPVTLMVGLSEEQIALIAVNQFRL--PGLDVAPQFIREYP
A1U3B9_MARHV          IADEDLERFERRLREPRRPFQAIPLSYDLDEAEIARMAVHRHQF--PGVEVEAELVRYYP
K4KXF7_SIMAS          LDEQDLSAFAERQKQRRRPFEAIPLRYRLTEAEIARLAVNEYRL--DGVEVSAELVRFYP
W0E3I9_MARPU          IDDKDRARFARLKRQ-RMRFQGVPIRLNLTPAEVARFSVNGHRF--PGVDVRAELVRAYP
I1XMJ6_METNJ          LTAEDIEAFNERRKR-HRAFEEIVVRNQLTQKEVALFSVNRHRF--PGVDVVGRLIRHYP
L0DY27_THIND          LTPAEIERFRTSVRQ-RRPFQPVLLKAGLDDEAVARIAVARHEL--PGVEIEARPVRHYP
H8GQD8_METAL          LPDEKIEQFHR-QRKREKRFNSVVLLPAMTDEELAKFAVSMPFF--PGVEIKTHQVRHYP
D5CU46_SIDLE          ITPKDIKRFKKLLTE-RQTLETMPLLSQLTDEEVARISAQQYRF--PGVEIKARLFREYP
Q7NPY2_CHRVO          VSPRDEKLFKKLLAE-SKTFEAIPLKVKLTDDEAARVAAHGFEL--PGVEVRARLFRDYP
D8NAB8_RALSL          IQPRDRRRFKRLMED-ARSFESLPIRSQLTDQEVARFSAQRFRF--PGVDVHARLFRQYP
A2S8I4_BURM9          IDARDRRRFKKLQED-SKNFESLPIRTRLTDDEVARFTAQRWRF--PGVDVRARLFRQYP
G4QDF4_TAYAM          ISPLDIKRFKQRVAG-SNRYTSIPLRRNITDKEAALFAANSYKF--PKVSLKARWVREYP
V8QQ28_9BURK          LTPLDVRRFKRRMGQ-NTRYASVMLRGNLTDDEAAVFAAHSFRF--PDVNLRARWVREYP
Q2KU77_BORA1          ISPADQRRFKRRVSE-SGRYANLVLRNNLNETEAAWFSAHAFEF--PGVELRARWVREYP
G0CGF2_XANCA          IAPEDLERFNRERKA-RRSFLPVTLKLRMSDEEMARFAVERWRF--PGVELEPYLTRRYP
G7TCD5_XANOB          ISPEDLERFNRERHA-RRSFLPVTLKLRMSDEEMARFAVERWRF--PGVELEPYLTRRYP
B4SJ25_STRM5          ISPEELEAFDKSRKA-RRKFLPVTLKLRMSDEEMARFAVDRWRF--PGVELEPYLTRRYP
B2I959_XYLF2          LSEDELERFHRERKV-RRRFMPVTLKLRMSEEEMARFAVDRWRF--PGVELEPYFTRRYL
B7J7N2_ACIF2          VSAEDQQRFNRDLSH-ARPYQPILLRRNLSPGELAAFAVQRHQF--PGVAIQTRTKRHYP
Q31F48_HYDCU          NLSEERLTRFFDRLKVTSKYRPLYLPYTLSEAEAARFAGHSYQL--PGITLVAKLKRTYP
A5CW45_VESOH          FINDKDIKSFNQNIKHYQKFHSIPIRYNLNEIQVAKFL-ISNIF--IGVNIEPYFHRIYP
A9KCR1_COXBN          ISSDE-IKQFHHILYQYHRYQPVPLKYKLTNEEVARFYVNQYRF--PDVRIETRMIRYYP
Q87RQ5_VIBPA          ITPEQIERFHRERKR-TRRFKSVPLLTQLNEKQVAVFSVNQYRF--PGVEISATLKRYYP
Q6LLA3_PHOPR          LNESDIAQFKKAMHR-TLRTRPVTLIEQMSEVQVAEFSVNQFHY--DGVDVDAYLERYYP
MRDA_ECOLI            LTDDDIAAFRKERAR-SHRFTSIPVKTNLTEVQVARFAVNQYRF--PGVEVKGYKRRYYP
A7MK35_CROS8          LNDDDIANFKKERAR-SHRFTSIPVKTNLTEVQVARFAVNQYRF--PGVEVKGYKRRYYP
D4GM21_PANAM          LTDDDIEAFEKERKR-SRRFTSIPVKTGLNEVQVARFAVNQYRF--PGVEVKGYQRRYYP
A1JPW7_YERE8          LTDEDIANFEKERKR-SRRFTSIAVKTPLTEVQVARFAVNQFRF--PGIEVKGYQRRFYP
U2M473_SERFO          LTDDDIANFEKERKR-SRRFVSIPVKTPLTEVQVARFAVNQFRF--PGAEVKGYQRRYYP
E0SEU1_DICD3          LTDEDIDNFRKERKR-SRRFTSIPVKTGLNEVQVASFAVNQYRF--PGVEVKGYQRRYYP
A0A0H3I6R0_PECPM      LTDDDLENFEKERKR-SRRFTSIPVKTGLDEIQVARFAVNQYRF--PGVEVKGYQRRYYP
Q492Z7_BLOPB          LSDHDIECFEKNRKR-STQFVSLPIKIDLTEEQQARFAVNRFRF--SGVTIKSYQRRYYP
Q7VRB0_BLOFL          LNNADIQYLKKYHEC-FSRYQLSSIKIKLTEEQHARFAVNQFQFDHNEITIQKYQYRYYP
I2B442_SHIBC          LTPEEVASFRNALHH-NSRYKSITLKDRLSEVEVARFAVNEFRF--PGVTVETYQEREYP
A8GEB7_SERP5          LTPEDITAFRDDMHH-NGRYKPVTLKSGLTETEVARFAVNQYRF--DGVTIDTYQQREYP
E6WAB0_PANSA          LTPEEIDTFWKNLKQ-NSRYKPVVLKEELTDEQVARFAVNQFRF--TGVSIDTYQDRQYP
MRDA_SALTY            LSPDDISDFRRALKS-SSRYRPVVLKNALTDVEIARFAVNQFHF--NGVTINSYQDRQYP
G9Y2R2_HAFAL          LTQDDIDNFHQAMKS-SRRFAEVPLKEALTDVEVARFSVNEFEF--PGVSISSYQQRNYP
Q9CJR8_PASMU          LTEEDIENFKKERRR-ASRYTSILLKPHLTEEQIARFSVNQYRF--TSLEVKPYFKRHYL
MRDA_HAEIN            LTDNDIENFKKERRR-GTRYTPILLKPNLTEEQISRFAVNGYQY--PSLEVRPYFKRHYL
B8F685_HAEPS          LTDQDIENFHKEKKR-TTRYTPILLKPDLTEEQMARFAVNQYRF--PSMDVHPYFKRNYP
A3QH53_SHELP          LSKDDRESLVASLKY-HRRFKPITVKNRLSEEEVAIFSVNQHRF--PGFSIDAGLKRHYP
A1S8T4_SHEAM          LSEEAQAEFLEALKY-HRRFKPLTLRDNLTEEEVAAFSVNQHQF--PGVRVEAGLKRFYP
Q5QYD8_IDILO          FPDSTIERFYRNLKN-QRRFNNVPLLDELNEKQLAVFAAHQHKY--PGISIEARLIRNYP
                                              :   :     : .             :     * * 

D0SAM0_ACIJO          HGELFAHVIGYVGRINDKELKSINKD------------------LYAGTNLIGKIGVENS
Q4FRE7_PSYA2          YDELFAHVIGYVGRINDKESKQINKD------------------RYAGTDLIGKIGIEDF
F8G6R0_PSEP6          QGAHFAHSVGYVGRINEKELKTLDPV------------------NYSGTHHIGKTGIERF
J8V5W5_PSEPU          QGAHFAHSVGYVGRINEKELKTLDPV------------------NYSGTHHIGKTGIERF
A0A0X1SZ91_PSEAA      QGAHFAHSVGYMGRINEKEAKVLDSV------------------NYSGTHHIGKTGIERF
F6AE75_PSEF1          QREHFAHSVGYVGRINEKELKELDPV------------------EYSGTHHIGKTGIERF
A4VR03_PSEU5          QGPHFAHSVGYVGRINEQEVKQLDPV------------------NYAGTHHIGKTGIEKF
A0A024HAK7_PSEKB      LGEHFAHSVGYVGRINEPELKILDPV------------------NYAGTHHIGKTGVEKF
C1DMQ4_AZOVD          QGEHFAHSVGYVGRINERELKKLDPV------------------DYSGTHHIGKTGVELF
Q3K9B4_PSEPF          LGAHFAHSIGYVGRINEKESKTLDSV------------------EYRGTQSIGKTGIERF
F8XKR8_PSESJ          LGAHFAHSIGYVGRINEKEAAHLDN-------------------EYRGTQSIGKTGVERF
Q1IAM3_PSEE4          LAEHFAHSVGYVGRINEKEAKTLDST------------------AYRGTQSIGKTGVERF
A1U3B9_MARHV          HSELTAHALGFVGRINRDELQRIDP------------------VNYAGTNYIGKSGIERF
K4KXF7_SIMAS          YGELFAHSIGYVGRINERELAAFDEDAY---------------ARYSGTHTIGKLGIEKS
W0E3I9_MARPU          LGPYAAHVLGYVGRINEGELKRIDAR------------------NYAGTHFIGKGGIEKA
I1XMJ6_METNJ          QGPLFAHAVGYVGRINQREMQVIDQQ------------------NYKGTLQIGKTGVEKQ
L0DY27_THIND          QGADFAHVVGYVGRINERDVQRLDMR------------------NYAGSSHTGKTGIERY
H8GQD8_METAL          YYELASHVVGYVGRINETELKELPMP------------------EYQGATHMGKLGIEKT
D5CU46_SIDLE          YTDVTSHLIGYVGRINQKDIDQLEEDDA--------------ASNYLGSDYIGKTGIEQS
Q7NPY2_CHRVO          YKEMTSHVLGYIGRINQKDKERLEEEDK--------------TTNYKGTNYIGKTGLEAV
D8NAB8_RALSL          LGEAAAHVIGYIGRISERDLERIDDMSDANSQPNVTYDPRKDANNYSGTEYIGKVGIEQS
A2S8I4_BURM9          LGPTAAHVIGYIGRISKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGVEQS
G4QDF4_TAYAM          QGETAAHLIGYVGRISEKDQEKLEEKGI--------------EGNYRGTDLIGKKGIELS
V8QQ28_9BURK          QGESAAHVVGYVGRISERDQERLEQEGT--------------EGNYRGTDVIGKKGIEAS
Q2KU77_BORA1          QGEAAAHVVGYIGRIAENDLEDLEKSGQ--------------LGNYRGTDVIGKKGIEKT
G0CGF2_XANCA          YGPLFAHIIGYVGRIDEKDL-AVLGEGN------------------AALTHMGKSGLERY
G7TCD5_XANOB          YGPLFAHIIGYVGRIDEKDL-AVLGEGN------------------AALTHMGKSGLERY
B4SJ25_STRM5          YGDLFAHIIGYVGRVDEKDL-EILGEGN------------------AALTHIGKSGLERY
B2I959_XYLF2          YSDLFAHVIGYVGRIDEKDL-ETLNGGD------------------AALTYIGKSGLERY
B7J7N2_ACIF2          YGSLFAHAVGYVGRLTPAEIREEQMADY------------------AGLDSIGKSGLEAQ
Q31F48_HYDCU          FNKSAVHAIGYVGKINQKEFNQLSES------------------EYAGTDVMGKLGVEKY
A5CW45_VESOH          NQNSSVHVIGYVSRMSKKDQLIYDKK------------------NYLGTLFVGKTGIEKQ
A9KCR1_COXBN          LGDVTSDVVGYVGRINARELQKVNTN------------------NYNIDDDIGKMGIEKY
Q87RQ5_VIBPA          YGEVLTHVIGYVSRINDRDMQRLIREEK--------------DANYQATRDIGKLGIEKY
Q6LLA3_PHOPR          YSANLTHVLGYVGKINDRDIRRLKEEEK--------------YTNYKATRTIGKLGIERY
MRDA_ECOLI            YGSALTHVIGYVSKINDKDVERLNNDGK--------------LANYAATHDIGKLGIERY
A7MK35_CROS8          YGAALTHVIGYVSKINDKDVERLDKDGK--------------LANYAATHDIGKLGIERY
D4GM21_PANAM          FGQTLTHVVGYVSKINDRDVARLDKEGK--------------WPNYAATHDIGKLGIEAY
A1JPW7_YERE8          YGSALTHVIGYVSKINDKDVERLDKEGI--------------LANYAATHDIGKLGIERY
U2M473_SERFO          YGSALTHVIGYVSKINDRDLERLDKDGQ--------------LRNYAATHDIGKLGIERY
E0SEU1_DICD3          YGAALTHVIGYVSKINDKDLERLDQEGK--------------LPDYAATHDIGKLGIERY
A0A0H3I6R0_PECPM      YGSALTHVTGYVSKINDKDVERLTKEEK--------------IADYAATRDIGKLGIERH
Q492Z7_BLOPB          YGSDVTHVIGYVAKINGEDIKRLNKQGI--------------LGKYVAAPNIGKLGIERY
Q7VRB0_BLOFL          YGSVLTHVIGYVSKINASDIKQLNKKGI--------------LQQYTATQDIGKLGIERY
I2B442_SHIBC          FGSALAHVVGYVSKINDHDLERLSRDGE--------------AENYAADHNIGKQGIEGY
A8GEB7_SERP5          YGAELAHVVGYVSKINDSDLKRLDKAGL--------------SENYAADHNIGKQGIEAY
E6WAB0_PANSA          YGADLAHVVGYVSKINDNDYKRLNEAGV--------------GENYAADHNIGKQGIEGY
MRDA_SALTY            YGAELAHVLGYVSKINDNDLKALDKKGL--------------AENYAADHNIGKQGIERY
G9Y2R2_HAFAL          YGAELAHVVGYVSKINDRDAKRLDDAGE--------------SENYAADHDIGKQGIERF
Q9CJR8_PASMU          YGEPLTHILGYVAKINDKDVERLKKEGK--------------FANYAGTHDIGKLGIERY
MRDA_HAEIN            YGETMAHILGYVGKMNDKDVERLKREDK--------------FANYAGTNDIGKLGIERY
B8F685_HAEPS          YGDILTHILGYVAKINDRDKKRLQEEGK--------------FGNYAGSHDIGKLGIEKF
A3QH53_SHELP          YDGLLTHVLGYVGRINNRDQAALQRNGQ--------------WQNYAATKDIGKQGIEKF
A1S8T4_SHEAM          HGELLTHVLGFVGKINAKDRTALEKADR--------------WPDYAASKDIGKQGVEKY
Q5QYD8_IDILO          HKELLTHAVGYVAKINPRDVESLRESGE--------------LPNYAASRTIGKLGIEKY
                            .  *::.::   :                                 ** *:*  

D0SAM0_ACIJO          YEDLLHGVPGNESVEADAHGNVLRHLGRKEPVRGNDLYLSLDYGLQTVASEQLA------
Q4FRE7_PSYA2          YENILLGQPGYQSVETDAHGNILRQLDTKAPIAGNDITLSLDYGLQVVAQQQLD------
F8G6R0_PSEP6          YEADLHGQVGYEEVETNARGRVLRVLKRTDPKPGKDIVLSLDIKLQEAAEAALG------
J8V5W5_PSEPU          YEADLHGQVGYEEVETNARGRVLRVLKRTDPKPGKDIVLSLDIKLQEAAEAALG------
A0A0X1SZ91_PSEAA      YEAQLHGQVGYEEVETNARGRILRVLKRTDPVPGKDIVLSLDIKLQEAAEEALG------
F6AE75_PSEF1          YEDELHGKVGYEEVETNARGRVLRVLNRTDPLPGRDVTLTLDVHLQEVAEKALG------
A4VR03_PSEU5          YEDELHGQVGYEEVETNARGRVLRVLKRTDPIPGKDITLSLDLDLQEAAEEALG------
A0A024HAK7_PSEKB      YEAQLHGTVGYEEVETNARGRVLRVLKRTDPVPGKDIVLSIDSKLQAKAEEALG------
C1DMQ4_AZOVD          YEDLLHGQVGYEEVETNARGRVLRVLKHTAPVPGKDLTLTLDLNLQKAAEAALG------
Q3K9B4_PSEPF          YEPQLHGHVGYEEVETNAQGRVLRVLKHTDPIPGKNIVLSLDVKLQEAAEAALG------
F8XKR8_PSESJ          YESELHGHVGYEEVETNAQGRVLRVLKHTDPVPGKNITLTLDAHLQAAAENALG------
Q1IAM3_PSEE4          YESELHGQVGYEEVETNAQGRVMRVLRHHDPVPGKDIVLSLDAHLQQAAEKALG------
A1U3B9_MARHV          YEEALHGQVGYQHVETNARGRILRVLERVNPVPGEDLQLHLDLRLQRRAHELME------
K4KXF7_SIMAS          YEDQLLGQVGSQQVEINARGRVLRTLDTQPPEAGQNLTLTLDAHLQQVAHEALA------
W0E3I9_MARPU          HEDLLHGQVGHQQVEVNARGRVLRTLESQPPVPGRDLSLYLDIKLQRAATDILG------
I1XMJ6_METNJ          YEDLLHGTVGYRQVETNVQGRTVRELFSEPASAGQDLYLHLDINLQQAAAEALG------
L0DY27_THIND          YEDVLHGTTGHKQVEVNAQGRVIRELSVTPPVPGQDLFLSIDVELQRSARAALA------
H8GQD8_METAL          YETQLHGTTGYAEIETNVQGRALNTLNEVKPVPGANLYLTLDIDLQKTAYDALD------
D5CU46_SIDLE          YEKDLHGKTGFEQVEVDASGRAVRVLSRTAPKSGNNLMLTLDAKLQEVAEKAFG------
Q7NPY2_CHRVO          YEDDLHGQVGFEEMETDSGGRAVRSLRRTPPVNGNTLKLALDIRLQEMADKLFG------
D8NAB8_RALSL          YETELHGLTGYEEVEVSAGGRPIRTLSTSQATPGNNLILSLDINLQRLAEQLFG------
A2S8I4_BURM9          YETELHGITGFEEVEVTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFA------
G4QDF4_TAYAM          YETQLHGKTGWQEVEISASGKPVRILRSTDPEPGLNLRLSVDLGLQKLAESL--------
V8QQ28_9BURK          YETVLHGKTGWEEVEVAASGKPVQVLKRIDPVPGDTLHLSIDMGLQKMVEDLYSKG----
Q2KU77_BORA1          WEQALHGRTGLEEVEVTAGGRPVRTLRRIDPVPGSDIMLSIDLGLQRVAEKAF-------
G0CGF2_XANCA          YEQDLRGQVGYEQVETNVQGRAIRTVGRVAPQSGADLRLSVDADLQRAMVAAFG------
G7TCD5_XANOB          YEQDLRGQVGYEQVETNVQGRAIRTVGRVAPRSGADLRLSVDADLQRAMVAAFG------
B4SJ25_STRM5          YEQQLRGKVGYEQVETNVQGRAIRTIGRVAAQSGADLRLSIDADLQRAMVAAFG------
B2I959_XYLF2          YEQVLRGKIGYQQIETNVQGRAIRSLGRVTAQAGADLRLSIDADLQRAMVAAFG------
B7J7N2_ACIF2          YETLLKGQPGDQEVEVDARGHTLHTRLRNPPREGVTIRTTLDLAVQQAAAKAMI------
Q31F48_HYDCU          YESVLHGSPGLQQIETNARGRVIQKLESVPAKPGKDIQLTIDIRLQQYIENYLD------
A5CW45_VESOH          YEILLHGTNGLQQIERNVNGRVIHTKIIKPAITGKNLYLSIDLDMQKKAETLLK------
A9KCR1_COXBN          YENELHGTMGAEEAEINASGRIVRILKRVPPTPGTNIYLTIDSNLQAEARKVLG------
Q87RQ5_VIBPA          YEDLLHGTAGYQEVEVNSRGRVIRTLKYVPPVPGKDIVLNLDINLQLYVHQLLDG-----
Q6LLA3_PHOPR          YEDTLHGQSGYEKVEIDSRGRVVRTLDYVAPISGQDIKLNIDVGLQLYANKQLTIKKENP
MRDA_ECOLI            YEDVLHGQTGYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAG-----
A7MK35_CROS8          YEDVLHGQTGYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQTYIETLLQG-----
D4GM21_PANAM          YEDLLHGKTGYEEVEVNNRGRVIRQLHEQSPQAGRDIYLTIDLKLQQYIETLLAG-----
A1JPW7_YERE8          YESVLHGKTGYEEVEVNNRGRVIRQLHEQPPQAGKDIYLTLDLHLQTYIEQLLSG-----
U2M473_SERFO          YEDVLHGKTGYEEVEVNNRGRVIRQLHEQPPSAGKDVYLTLDLNLQRYIEQLLVG-----
E0SEU1_DICD3          YEDVLHGKPGYEEVEVNNRGRVIRQLHEQPPQAGKDIYLTLDLNLQLYIEKLLAG-----
A0A0H3I6R0_PECPM      YEDLLHGKPGYEEVEVNNRGRVIRQLHEQPPQAGRDIYLTLDLSLQIYIEKLLEG-----
Q492Z7_BLOPB          YENILHGTPGYGAVEINNRGKVIRELYKKSPIPGKNIVLTLDLNLQQYIIKLLVG-----
Q7VRB0_BLOFL          YENILHGTPGYGAVEVNNRGKIIRKLYEKQSIPGNSIILTLDLHLQKYITKLLIG-----
I2B442_SHIBC          YEKALHGTTGYQEVEVDNHGRIVRTLKVVPPQAGEDLYLTLDVRLQQYIETVLKG-----
A8GEB7_SERP5          YESELHGTTGYQEVEVDNHGRVIRLLKEQPPQAGKNIYLTLDLPLQQYIESVLKG-----
E6WAB0_PANSA          YESILHGKTGYQEVEVDNHGRIVRVLKEVPPVAGKNIYLTLDLHLQQYVESQLVG-----
MRDA_SALTY            YENDLHGKTGYQEVEVDNHGRIVRLLKDVPPIAGKNIHLTLDLHLQEYIESLLAG-----
G9Y2R2_HAFAL          YESELHGKTGSQEVEVDSHGRIVRELTEIPPQAGKNIYLTIDLHLQQYIEKLLKG-----
Q9CJR8_PASMU          YETQLHGSTGFEEVEVNNRGKVIRKLREQPAIAGKSIHLTIDLELQRYITDLLSG-----
MRDA_HAEIN            YEDILQGTTGFEEVEINNRGKVIRTLRSRPAVAGKSIHLTIDLALQRYITELLSG-----
B8F685_HAEPS          YEEQLHGVTGFEEVEINNRGKVIRKLRDQPAVAGSSIRLSLDIDLQRYVANLLDN-----
A3QH53_SHELP          YESLLHGMPGHLEEEVNNRGRTIRTLKSVAPEPGQDIYLTLDLQLQKKAMELLAG-----
A1S8T4_SHEAM          YENLLHGKPGHLEEEVNNRGRTIRTLKTVPPEPGQDLYLTLDINLQKKAMELLSG-----
Q5QYD8_IDILO          YEKDLHGEVGYQSVEVNNRGRAVRTLSIEAPKPGQDIVLELDLELQRKAAELLGE-----
                       *  * *  *    *    *. :.      .  *  :   :*  :*              

D0SAM0_ACIJO          --------GRRGAIVAMDPRTGEILALVSSPSFNPNLFVTGISHTDYSGLRDNLDQPLYN
Q4FRE7_PSYA2          --------GRRGAIVAIDPKNGDVLAFVSNPSYDPNPFISGISFKDYDDLREDLDQPLYN
F8G6R0_PSEP6          --------GRRGAVVALDPRTGEVLAMVSQPSFDPNLFVTGIGFKAYAELRDSIDRPLFN
J8V5W5_PSEPU          --------GRRGAVVALDPRTGEVLAMVSQPSFDPNLFVTGIGFKAYAELRDSIDRPLFN
A0A0X1SZ91_PSEAA      --------GRRGAVVALNPNTGEVLAMVSQPSFDPNLFVTGISFKAYAELRDSIDRPLFN
F6AE75_PSEF1          --------GRRGAVVAIQPQTGEVLAMVSQPSFDPNPFVTGISFKAYAELRDSIDRPLYN
A4VR03_PSEU5          --------GRRGAIVALLPDTGEVVAMVSQPSFNPNLFVTGISFKDYGELRDSIDRPLYN
A0A024HAK7_PSEKB      --------GRRGAIVAIQPSTGEVLAMVSQPSYDPNLFVTGISFKDYSALRDSIDRPLYN
C1DMQ4_AZOVD          --------DRRGAVIAIDPATGGVLAMVSQPSFNPNLFVTGISVKDYAALRDSIDRPLYN
Q3K9B4_PSEPF          --------DRRGSVVALDPSTGEVLAMVSNPSFDPNLFVTGISSKEYSALRDSIDRPLFN
F8XKR8_PSESJ          --------DRRGSVVALDPETGDVLAMVSKPSFDPNLFVTGISFKQYAALRDSIDRPLFN
Q1IAM3_PSEE4          --------DRRGAVVVLDPANGDVLAMVSNPSFDPNLFVKGISYKQYSALRDSIDRPLFN
A1U3B9_MARHV          --------GRRGAIIAIEPKTGGILALASVPGFDANKFVTGISVDDYRELSQSIDKPLFN
K4KXF7_SIMAS          --------GRRGAVVAIDVNSGGILTLVSTPSFDPNLFVTGISYADYDALSQSRDLPLFN
W0E3I9_MARPU          --------ERRGSIVAIDPRNGGVLALVSQPSFDPNLFVEGISQKDYHALLYSPDKPLFN
I1XMJ6_METNJ          --------EYNGSVVVLDTKTGGVLALISKPDYDPNSFVTGISIKEYAELRDSIDQPLFD
L0DY27_THIND          --------PHDGAVVAIDTATGEVLALVSKPGFDPDPFVNGISHRDFAALQSDPHKPLFN
H8GQD8_METAL          --------FYNGAVVAIDIKTGGVLVFVSRPGFDPNPFVVGIPSEDYKALNESENQPLYN
D5CU46_SIDLE          --------DYRGALVALDPTNGEVLAFVSKPGYDPSLFIDGIDTDTWDELNNSPDTPLNN
Q7NPY2_CHRVO          --------DRRGALVAIDPNTGGVLAFLSKPGFDPSLFIDGIDTQTWTALNTDWQKPLIN
D8NAB8_RALSL          --------NRRGALVAIEPETGDILAFVSKPTFDPNLFIEGIDSATWSELNGSPDKPLLN
A2S8I4_BURM9          --------GKRGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLN
G4QDF4_TAYAM          --FVKNGVVERGALVAIDPRSGQVLAYVSSPSYDPNLFVDGIDVADWRRLADDENSPLLN
V8QQ28_9BURK          --FVKEGVPEKGALVAIDPRNGQVLAYVSAPSYDPNLFIDGIDVENWRRLADSPEHPLID
Q2KU77_BORA1          -------EGHRGALVALDPDTGEVLAFVSQPSFDPNLFVDGIDVENWRRLNESPDHPLIN
G0CGF2_XANCA          --------EHEGAAIAMDPRTGEILGMVSLPSYDPNLFVNGISHTDFKALNDNPSRPQFN
G7TCD5_XANOB          --------EHEGAAIAMDPRTGDILGMVSLPSYDPNLFVNGISHTDFKMLNDNPSRPQFN
B4SJ25_STRM5          --------EQEGSAVAMDPRTGEVLAMVSLPSYDPNLFVNGISHADFKALNDNPSRPQFN
B2I959_XYLF2          --------QYEGAAVAMDPRSGEILGMVSLPSYDPNLFVNGISHAQFNALNANPSRPQFN
B7J7N2_ACIF2          --------GQQGAVVALDPRNGDVLAAYSAPAFDPNAFVDGLSTAVWSSLRDDPGTPMAN
Q31F48_HYDCU          --------GKKAAVVVTDPKTGEILAYVSTPGYDPNLFVDGISQVKYQELLKDHNRPLIN
A5CW45_VESOH          --------GKRGSIVVIDVKNGEILTLVSTPIYNPNWFVNGISHTNYNQLQTSKNIPQLN
A9KCR1_COXBN          --------EESGAIVAIQPSTGQVLALVTKPSFDPNPFVSGLSQQDYQKLVNSPQHPLYN
Q87RQ5_VIBPA          ---------RRGSAIVLDPRDNGVLAMVSSPSYDPNAFVHGISGKAYRDLLNDKNRPLVN
Q6LLA3_PHOPR          ITHKMEDYHRRGSIVVLDPRDNSVLAMVSSPSYDPNLFVHGISSKRYNALLNDPDHPLLN
MRDA_ECOLI            ---------SRAAVVVTDPRTGGVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVN
A7MK35_CROS8          ---------SRAAVVVTDPRTGGILAMVSMPSYNPNLFVDGISSKDYSGLLNDPNTPLIN
D4GM21_PANAM          ---------SRAAVVVSDPRTGEILAMVSTPSYDPNLFVDGISSKDYRGLLSDENRPLYN
A1JPW7_YERE8          ---------SRAAVVVTDPRTGGILALVSNPSYDPNLFVDGISNKDYQGLLNDPNRPLIN
U2M473_SERFO          ---------SRAAVVVSDPRTGGILAMVSNPSYDPNLFVDGISNKDYQGLLNDPNRPLIN
E0SEU1_DICD3          ---------SRAAVVVTDPKDASILAMVSTPSYDPNLFVDGISSKTYHALLNDPNRPLIN
A0A0H3I6R0_PECPM      ---------SRAAVIVTDPRDGGILAMVSTPSYDPNLFVDGISTKNYAKLQNDPNRPLIN
Q492Z7_BLOPB          ---------NRSSVIVVDPRNGGIQALISHPSYNPNLFVDGISNTEYSILLKDNNCPLLN
Q7VRB0_BLOFL          ---------SRSSVIVIDPRNGGIRALVSHPSYDPNLFVNGISRTEYHLLLTDDNCPLLN
I2B442_SHIBC          ---------QRGAVAVVDPRDGGVLAMVSSPSYDPSPFVKGISAPAYRALLSDPDRPLIN
A8GEB7_SERP5          ---------QRAAVVVEDPRDGGILAMVSSPSYDPNPFVKGISYSAYKSLLANPDLPLIN
E6WAB0_PANSA          ---------QRAAVLIEDPHDGSVLAMVSSPSYDPNPFVKGISYQAYKTLLQDKNLPLIN
MRDA_SALTY            ---------QRAAVLVEDPHDGSVLAMVSMPSYDPNPFVKGISYQDYGKLLHDKNLPLIN
G9Y2R2_HAFAL          ---------QRAAVVVMDPRDGGILAMVSSPSYDPNPFVNGISYKSYQALLDNPDLPLIN
Q9CJR8_PASMU          ---------QKGAVVVLDPKDNSILAMVSTPSYDNNLFVDGISSADYKRLLNDPNRPLYS
MRDA_HAEIN            ---------LKGAVVVLDPKDSSVLAMVSTPSYDNNLFVDGISSEDYKRLLNDLARPLYS
B8F685_HAEPS          ---------QKGAVVVLDPTDSSILAMVTNPSYDNNLFVDGVSGKDYKQLLEDPDRPLYS
A3QH53_SHELP          ---------RRGSIVAIDPRDGGILAMVSSPSYDPNQFVHGISSKAYSDLLNARSRPLIN
A1S8T4_SHEAM          ---------RRGTIVAIDPRDGGIMAMVSSPSYDPNLFVQGISSKDYSALLNDKARPLIN
Q5QYD8_IDILO          ---------QRGSIILMDATTGGILAMVSTPSYDPNWFVNGISVKQYQSLLNSTQSPLLN
                                 .:          :    : * :: . *: *:    :  *      *  .

D0SAM0_ACIJO          RAVQGAYPPGSTIKPMFGLGGIHYGLIDWGTAISDHGYFTLPGDSHK-FRDWKKSGHG-V
Q4FRE7_PSYA2          RALQGTYPPGSTIKPFEGLGGIHYGLRNWDTTIYDPGYFSLPGDSHR-FRDWKKGGHG-T
F8G6R0_PSEP6          RVLRGLYPPGSTIKPAVAIAGLDSGVVNAGSRVFDPGYYQLPNYDHK-YRNWNRSGDG-W
J8V5W5_PSEPU          RVLRGLYPPGSTIKPAVAIAGLDSGVVNAGSRVFDPGYYQLPNYDHK-YRNWNRSGDG-W
A0A0X1SZ91_PSEAA      RVLRGLYPPGSTIKPAVAIAGLDSGVVNASTRVFDPGYYELPNYDHK-YRNWNRTGDG-W
F6AE75_PSEF1          RVLRGLYPPGSTIKPMVAVSGLDAGVVTPSSRVFDPGFYQLPNNSHK-YRNWNRTGDG-W
A4VR03_PSEU5          RVLRGLYPPGSTIKPMMAVAGLDAGVITPTSRVFDPGFFQLPNVQHK-YRNWNRSGDG-W
A0A024HAK7_PSEKB      RVLRGLYPPGSTVKPAVAIAGLDAGVVTPSSRIFDPGYYQLPNYDHK-YRNWNHSGEG-W
C1DMQ4_AZOVD          RVLRGIYPPGSTIKPMVALAGLDSGVVERGTRVFDPGFFQLPNVSHK-YRNWNRGGDG-W
Q3K9B4_PSEPF          RVLRGLYAPGSTIKPEVAIAGLDAGVVTPQTRVFDPGYYQLPDFDHK-YRNWNHSGDG-W
F8XKR8_PSESJ          RVLRGLYAPGSTVKPEVAIAGLDSGVMTASTKVFDPGYFQLPDFDHK-YRNWNHSGDG-W
Q1IAM3_PSEE4          RVLRGLYAPGSTVKPEVAIAGLDSGVITPGNRVFDPGYYELPNYDHK-YRNWNRTGDG-W
A1U3B9_MARHV          RALRGQYPPASTIKPMMAVAALDSGATDKDRRIWDPGYFQLREGGRR-FRNWNRSGDG-W
K4KXF7_SIMAS          RSLQGQYPPGSTLKPMLGLAGLHYRIVDANSRVRDPGWYQLENDERF-YRDWKKGGHGAW
W0E3I9_MARPU          RAIRGQYPPGSTVKPFVGLAGLIEGTVTAQSKTYCPGYFTLPGHSHR-FRCWRRGGHG-H
I1XMJ6_METNJ          RALRGHYPPGSTFKPFVALAGLELNVVTQQSRTYCPGFYSLPGNTHR-YRCWKRVGHG-H
L0DY27_THIND          RALSGQYPPGSTLKPVVALAGLEEQVTTAERRMFATGYYQLPGHERR-YRDWRRSGHG-W
H8GQD8_METAL          RALRGLYPPGSTIKPFIALAGLEYDKVRAPQGLYCPGYYTLPGVDHR-YRDWRRGGHG-T
D5CU46_SIDLE          RALRGQYPPGSTIKPFMALAGLYYGTRSPTHGISDPGYYMLPGSRHQ-YRDWKVGGHG-S
Q7NPY2_CHRVO          RALRGTYPPGSTFKPFMAMAALNTHSIGMHDIRPAPGYFTLPGSSHQ-FRDSKKSGNG-M
D8NAB8_RALSL          RPLRGTYPPGSTYKPFMALAALELGKRTPQWGMADPGSFTLGN--HT-FRDDVPGGHG-W
A2S8I4_BURM9          RPLHGTYPPGSTYKPFMALAGLALGKRTPGWGFQDPGYFTFGG--HT-FRNDVRSGQG-W
G4QDF4_TAYAM          RPISGTFPVGSTYKPFVGLAAMQLGVRAPEKRVYDPGYFEYGK--QR-FRNAGGAVYG-N
V8QQ28_9BURK          RPVSGTFPIGSTYKPFVALAALKTGVRDPNARIPDPGYFEYGN--QR-FRNAGGAAYG-P
Q2KU77_BORA1          RPLSGTYPIGSTYKPFVGLAALELGKRRATDRLPDPGYYEFGG--QK-FRNAGGAVFG-M
G0CGF2_XANCA          RLVLGGVAPGSTLKPLIALAGLDSGLRRPEDRVLSTGMFYLPGVSRG-WGDSHRGGHG-W
G7TCD5_XANOB          RLVLGGVAPGSTLKPLIALAGLDSGVRRPEDRVLSTGMFYLPGVSRG-WGDSHRGGHG-W
B4SJ25_STRM5          RLVLGGVAPGSTLKPLIGLAGLDSGVRRPEDKVLSTGMFYLPGTSRG-WGDSHRGGHG-W
B2I959_XYLF2          RLVSGGVAPGSTLKPLIALAGLDAGVRRPEDRILSTGMFYLPGVNRG-WGDSHRGGHG-W
B7J7N2_ACIF2          RFLRGSYPPGSTIKPFVALSALRDKAIAADQRLAGGAYYQIPGTKHK-YYDWKPGGHG-A
Q31F48_HYDCU          RVINGQYPPGSTIKPFVALAAIENNIISPYKKIFDPGFLEFKD--HR-YRDWKRQGHG-L
A5CW45_VESOH          RAIQGLYPPGSTIKPMVALAGLEEGVITNISSTFCPGYYKLPNVKRK-FNDWKKTGHG-H
A9KCR1_COXBN          RAIRGQFASGSTVKPFLALFGLDMGIITPQYRIYDPGWFQLPNTQHI-YHDWRERGHG-W
Q87RQ5_VIBPA          RTTLGIYPPASTIKPFMAVAALQEGVITPNTTRNDPGYWRIPNSDTRPFRDWLRWGHG-R
Q6LLA3_PHOPR          RTTLGVYPPGSTVKPQIAVAALSEGVISPNTMRNFPGWWRIPHSKSRKFRDDVRWGHG-E
MRDA_ECOLI            RATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQLPGSEKR-YRDWKKWGHG-R
A7MK35_CROS8          RATQGVYPPASTVKPYVAVSALSAGVINRNTSLFDPGWWQLPGSEKR-YRDWKKWGHG-R
D4GM21_PANAM          RAIQAAYPPASTVKPYVAVSALSAGVINRNTSLFDPGWWQLPGSEKR-YRDWKKWGHG-R
A1JPW7_YERE8          RATQGVYPPASTVKPYIAVSALSAGVITKNTSLFDPGWWQLPGSEKR-FRDWKKWGHG-R
U2M473_SERFO          RATQGVYPPASTVKPYIAVSALSAGVITKNTVVFDPGWWQLPGSEKR-FRDWKKWGHG-R
E0SEU1_DICD3          RATQGVYPPASTVKPYIAVSALSANVITPYTSLFDPGWWQLPGSEKR-FRDWKKWGHG-R
A0A0H3I6R0_PECPM      RATQGIYPPASTVKPYIAVSALTAGVITTNTSLFDPGWWQLPGSEKR-FRDWKKWGHG-R
Q492Z7_BLOPB          RATQGVYPPASTVKPYISVSALTLGVINQNFLFSDPGWWQLPGSEKR-FRDWKRWGHG-E
Q7VRB0_BLOFL          RATQGVYPPASTVKPYISVSALTLGIINKNFSFFDPGWWQLPGSEKR-FRDWKRWGHG-E
I2B442_SHIBC          RVTQGLYPPASTVKPYMAVSALSAGVITPGTRFFGAPTWTLPGTQRR-YRDWLKTGHG-M
A8GEB7_SERP5          RVTQGLYPPASTVKPYMATSALFAGVITPNTTFFGAPTWTLPGTQRR-YRDWLKTGHG-M
E6WAB0_PANSA          RVTQGLYPPASTVKPYMAMSALLTGVITPQTTFFGAPTWTLPGTDRK-YRDWKKSGHG-M
MRDA_SALTY            RVTQGLYPPASTVKPYMAMSALLCGIITPQTTFFGAPTWTLPGTQRH-YRDWKKTGHG-M
G9Y2R2_HAFAL          RVTQGIYPPASTVKPFMATSALLAGVITPQTTFFGQPTWVLPGTNRH-YRDWLKTGHG-M
Q9CJR8_PASMU          RVTQGAYPPASTVKPFIGVAALHENVITQNMTIFDPGYWVLPNTTKR-FRDWKKTGHG-H
MRDA_HAEIN            RATQGAYPPASTVKPFIAVAAQTENVITPNTTIFDPGYWVLPNSTKR-FRDWKKTGHG-D
B8F685_HAEPS          RATQGTYPPASTIKPFMAVAGLTEGKITPNTTIYDPGFWILPGSTQR-FRDWKKGGHG-R
A3QH53_SHELP          RATQGQYAPASTVKPHMALLGLEEKVVTPKTRVWDPGFWQIPGVERK-YRDWKRWGHG-W
A1S8T4_SHEAM          RATQGLYAPASTIKPHMALMGLEEQVVTERTRIWDPGYWQMPGVERK-WRDWKKWGHG-Y
Q5QYD8_IDILO          RVTQGAYPPASTIKPQIGLLGLEEGTIDEDTRIWDPGWFEIKGVDRR-YRDWLAWGHG-W
                      *   .  . .** **  .  .                           :        *  

D0SAM0_ACIJO          VNLHKSQVVSCDTFFYILSFRMGIEKMNTWMRQFGFGEKTGVDLP--SESTGLYPNPEWK
Q4FRE7_PSYA2          VDLKQSIVMSVDTYYYKLAYEMGIQRLHDWMVRFGFGEETGIDLP--NEKSGVMPSPKWK
F8G6R0_PSEP6          VDLDTAIMRSNDTYFYDLAHKMGIDRLSSYMNKFGIGQRVSLDMF--EESAGLMPSREWK
J8V5W5_PSEPU          VDLDTAIMRSNDTYFYDLAHKMGIDRLSSYMNKFGIGQRVSLDMF--EESAGLMPSREWK
A0A0X1SZ91_PSEAA      VDLDMAIMRSNDTYFYDLAHKLGIDRLALYMNKFGLGQKVSLDMF--EESPGLMPSREWK
F6AE75_PSEF1          VDMNTAIMRSNDTYFYDLAHKMGIDRLHDYLSRFGIGQRVSLDMF--EETAGLMPSRDWK
A4VR03_PSEU5          VDLDLAIARSNDTYFYDMAHKLGVDRMYDYMTRFGLGQRVSLDMY--EETAGLMPSRDWK
A0A024HAK7_PSEKB      VNLETAIMRSNDTYFYDLAHKLGIDRLHDYMSRFGFGQRVALDMY--GESPGLMPSRDWK
C1DMQ4_AZOVD          VNMEAAITRSNDTYFYSLAHRMGIDRLHRYLSQFGIGQRVSLDMF--EEASGLMPSREWK
Q3K9B4_PSEPF          VDMDAAIMRSNDTYFYDLAHKLGIDRLHDYMAMFGLGEKVSLDMF--EESPGLMPSQAWK
F8XKR8_PSESJ          VDMDTAIMRSNDTYFYTVAHKLGIDRLHDYMTMFGIGQKVSLDMF--EESAGLMPSREWK
Q1IAM3_PSEE4          VDMYTAIMRSNDTYFYDLAHKLGIDRLHDYMAEFGLGQKVSLDMF--EEAPGLMPSQAWK
A1U3B9_MARHV          VDLKYSMARSNDVYFYEVGVDMGVDVMSSYLARFGFGEDATLDVS--GALTGLLPTADWK
K4KXF7_SIMAS          VNLHTAIEQSCDVYFYDLSFRMGIDRMHEFGSHFGLGNKTGIDVP--NERSGIWPSRAWK
W0E3I9_MARPU          VDLRAAMAESCDVYFYDLAYKLGIDRLHTRLAEFGFGAVTGIDLA--GELGGLLPSREWK
I1XMJ6_METNJ          VDLKSAMAESCDVYFYDLAHAIGIDRLHGFLDLFGFGHQTGVDIP--GESKGLSPSREWK
L0DY27_THIND          VDMSRAVAVSSDVYFYDLGYKLGIDRMAPMFKAFGIGDRVGIDAT--GERPGIRPSREWK
H8GQD8_METAL          VDMIRAITESCDVYFYRLAQMLGIQKMHDFLQQFGFGEKTGIDLY--GEVAGLLPSPAWK
D5CU46_SIDLE          VDMFKSIVVSCDTYYYGLANELGIDNMHSYLSRFGFGQKTGLDME--GEVSGLLPSPEWK
Q7NPY2_CHRVO          VNLQRAITVSSDTFFYKLAWDMGIDKIHPVVGSFGLGSKTGIDLD--GEATGVLPSKEWK
D8NAB8_RALSL          VDMYRSIVVSCDTYYYKLANDMGVNAIHDFMKPLGFGQVTGIDIE--GERTGILPSTDWK
A2S8I4_BURM9          VDMNKAIMVSNDTYFYMLARDLGVTAIANFMKPFGFGQLTGIDIQ--GEARGILPSPEWK
G4QDF4_TAYAM          IDMHRAIVVSSDTFFFSLGPEIGVDRLHDFTIQFGFGKQTGIDLV--GEKRGILPSKEWK
V8QQ28_9BURK          TNMHRALVVSSDTYFFSLGPLIGVDALHDFSKMFGFGRKTGIDLE--YEKIGILPSREWK
Q2KU77_BORA1          TDMHRAIVVSSDTYFYSLGPEIGVNALHDFSKQFGFGQITGIDLE--GERAGVLPSTDWK
G0CGF2_XANCA          TDLRKSIAQSVNTYYYRLAVDMGIDRFDHYMGEYGFGQPTGVDLL--GEIGGILPSPAYK
G7TCD5_XANOB          TDLRKSIAQSVNTYYYRLAVDMGIERFDHYLGEYGFGQPTGVDLL--GEIGGILPSPAYK
B4SJ25_STRM5          TDLRKSIAQSVNTYYYKLALDLGIERFDHYMEYYGFGQPTGIDLT--GEIGGILPSPAYK
B2I959_XYLF2          TDLRKSIAQSVNTYYYKLALDLGIERFTDYMRRYGLGQLTGVDLT--GEISGILPSLEYK
B7J7N2_ACIF2          QNLREAIRDSNDVYFYQIAMRLGVIQLGNGLAHFGFGQRSGVDLP--GEAAGVIPSPVWL
Q31F48_HYDCU          VDMNDAVAQSCDTYFYELSLNMGIDLIHDALYPFGFGHHTKIDLY--NESVGILPSKAWK
A5CW45_VESOH          VNVKDSITQSCDVFFYDLANKLGIDKLHNNLDLFNFGRKTNIDIP--GENPGILPSKVWK
A9KCR1_COXBN          VNVVKAIAVSCDVYFYNLAVALGIKRMDDILQRFGFGQLTGIDLP--EEVPGLVPSPRWK
Q87RQ5_VIBPA          VDVIKSIEESVDTFYYQIAYDLGIDRISNWMMMFGFGDYTGIDIY--EESKANMPTRDWK
Q6LLA3_PHOPR          VNVVKAIEQSVDTFFYQVAYDMGIDRLSVWMNKFGYGKPSGIDIN--EESTANMPTREWK
MRDA_ECOLI            LNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGIDLA--EERSGNMPTREWK
A7MK35_CROS8          LNVTKSLEESADTFFYQVAYDMGIDRLSEWMRKFGYGSLTGIDLS--EERSGNMPTREWK
D4GM21_PANAM          LNVTRSLEESADTFFYQVAYDMGIDRLSEWMTKFGYGERTGIDLP--QESAGNMPTRDWK
A1JPW7_YERE8          LNVTKALEESADTFFYQVAYDMGIDRLSSWMSKFGYGEYTGIDLS--EERAGLMPTREWK
U2M473_SERFO          LNVTKALEESADTYFYQVAYDMGIDRLSTWLTKFGYGEYTGIDLS--EERSGLMPTRDWK
E0SEU1_DICD3          LNLTKSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHRTGIDLSDKEESPGIMPTREWK
A0A0H3I6R0_PECPM      LNLTKSLEESADTFFYQVAYDMGIDRLSEWMNKFGYGEKTGIDIS--EESAGNMPTREWK
Q492Z7_BLOPB          LNITKALEESSDTFFYQIAYKMGIDNLSEWMNKFGYGRYTGIDLF--EELTGVMPTKAWK
Q7VRB0_BLOFL          LNITKALEESSDTFFYQIAYKMGIDNLSEWMTKFGYGKYTGIDLL--EELTGIMPNREWK
I2B442_SHIBC          LNVTKAIEESADTFFYQVAYQMGIDRIHTWMSKFGYGQRTGIDLN--EEYAGVLPSREWK
A8GEB7_SERP5          LNVTKAIEESADTFFYQVAYEMGIDRIHSWLSKFGYGQATGIDLN--EEYRGVLPSREWK
E6WAB0_PANSA          LDVTRAIEESADTFFYQVAFMMGIDRIHHMLSQFGYGKPTGIDLN--EEYAGLLPSREWK
MRDA_SALTY            LDVTKAIEESADTFFYQVAYMMGIDRIDTMLSQFGYGKPTGIDLN--EEYDGLLPSRAWK
G9Y2R2_HAFAL          LNVTKAIEESADTFFYQVAYEMGIDRIHFWLSKFGYGQYSGIDLM--EQAKGVLPDREWK
Q9CJR8_PASMU          TDLNKAIVESSDTYFYQTAYNMGIDRLSDWMKRFGFGVPTGIDIQ--EETAGIMPSREWK
MRDA_HAEIN            TDLNKAITESSDTYFYQVAYNMGIDRLSNWMKDFGFGMPTGIEIQ--EETAANIPTREWK
B8F685_HAEPS          TDVNRAIVESSDTFFYQLAYDMGIDKMSDWMKKFGFGVKTGIDLA--EESVGIMPSREWK
A3QH53_SHELP          VDVNGALVHSCDTYFYDMAYKTGIDKISNFMQQFGFGERTGVDIF--EESAGNMPSKDWK
A1S8T4_SHEAM          VDVYHAIVESCDIFFYDMVHKMGIDKIAAFMHQFGFGESTGVDIF--EESAGIMPSSDWK
Q5QYD8_IDILO          VDVERAITESCDTFYYDLALKLGVDKISSFMAEFGFGERTGIDIH--EEVSALMPSRGWK
                       ::  :   * : :::      *:  :       . *    ::        .  *   : 

D0SAM0_ACIJO          MRTRDAK------WLKGETISVSIGQGAFTATPLQLAMATAITANHGSHVIPHVLQTSKG
Q4FRE7_PSYA2          KDTYDKG------WLPGETISVSIGQGYFLATPLQIANATAMTASKGFHITPHLLKSSDG
F8G6R0_PSEP6          RATRRQA------WFPGETLILGIGQGYMQATPLQLAQATALIANKGVWNRPHLAKTIEG
J8V5W5_PSEPU          RATRRQA------WFPGETLILGIGQGYMQATPLQLAQATALIANKGVWNRPHLAKTIEG
A0A0X1SZ91_PSEAA      RTTRRQA------WFPGETLILGIGQGYMQATPLQLAQATALVANKGVWNRPHLAKTIEG
F6AE75_PSEF1          RARYRQG------WYPGETLILGIGQGYMQATPLQLAQATALIATKGKWIRPHLARTIDG
A4VR03_PSEU5          RARYRQP------WYPGETVILGIGQGYMQATPLQLAQATALMATRGKWIRPHLARSIGG
A0A024HAK7_PSEKB      RITRRQV------WFPGETLILGIGQGYMQATPLQLAQMTALIANHGKWIRPHLAKTIEG
C1DMQ4_AZOVD          RVSRRQA------WYPGETLITGIGQGYMLATPLQLAQATALLANKGKWHRPRLLMQADG
Q3K9B4_PSEPF          RATRRQA------WFPGETVILGIGQGYMQVTPLQLAQATALIANKGVWNRPHLAKTVDG
F8XKR8_PSESJ          RATRRQA------WFPGETVILGIGQGYMQVTPLQLAQATSLIASKGVWHRPHLAMEVGD
Q1IAM3_PSEE4          RATRRQA------WFPGETLILGIGQGYMQVTPLQLAQATSLLASKGAWHRPHLAMSVGG
A1U3B9_MARHV          RAVRNEP------WYPGDSVNMSIGQGFLLATPMQLATATALIANRGAWVEPRLLKDVHG
K4KXF7_SIMAS          RAMRGLP------WFPGDSLNMGIGQGAVLTTPLQLAVMTATMANKGIRYRPHLVQAAN-
W0E3I9_MARPU          QRVRNQP------WFPGETVIMGIGQGAYLATPLQLAAATASLANHGHFITPRVVRASRA
I1XMJ6_METNJ          RNQRNQA------WYPGETLISGIGQGFNQMTPIQLAHATATLGMMGTVYTPQLVRATKA
L0DY27_THIND          RSVQNLP------WFPGETLITAIGQGYMLTTPLQLADIASTLANRGQRLQPRLLRAVRD
H8GQD8_METAL          QAKRKQR------WYEGETLITGIGQGYHQVTPVQLARATATLANHGQVVTPFLVDKIVT
D5CU46_SIDLE          AKRYNQI------WYPGDTVSAGIGQGYNLVTPVQLAFATAILANDGVAFQPHLVKEVQP
Q7NPY2_CHRVO          AKRFARYKPEVRRWYPADVVSIGIGQGFNAYTPLQMANATAIMANGGQVFKPHLVQQVVD
D8NAB8_RALSL          RKAYKRPEQQ--KWYDGETISLGIGQGYNNFTILQLAHAVATLANNGGVMKPHLVKAVED
A2S8I4_BURM9          -KTFKKAAQQ--KWFDGETISLGIGQGYNSFTILQLAHATATLANDGVIMKPHLVKEVEN
G4QDF4_TAYAM          SKAFKDPKKK--SWLVGETISVAVGQGYNSFTIMQLAQATSVLAANGVYMRPHLVNLLEN
V8QQ28_9BURK          KKAFKDPRQQ--RWIPGETISVAVGQGYNSFTIMQLAQATSTLAADGKYIRPHLVSEMES
Q2KU77_BORA1          RRAYKDRERQ--RWYAGETISVAVGQGYNAFTLLQLAQGTSTLANNGLYRRPHLVHAVRD
G0CGF2_XANCA          YKTRKER------WYPGDTVNIAIGQGDWKVTPLQLVRGVSAIA-GGLLLRPHLVLEERT
G7TCD5_XANOB          YKTRKER------WYPGDTVNIAIGQGDWKVTPLQLVRGVSAIA-GGLLLRPHLVLEERT
B4SJ25_STRM5          RKSRKEA------WYPGDTVNISIGQGDWKVTPLQLARGVSGLA-NGQLRTPHLVIQQRA
B2I959_XYLF2          RKVRKQA------WYQGDTVNVSIGQGDWKVTLLQLVRSVAGLA-SGHMNRPHLVVAERA
B7J7N2_ACIF2          RRRYGQT------WYQGQTVMMGIGQGYLLSTPLQLARATASIANGGKLVIPHMKQS---
Q31F48_HYDCU          RRVKGQT------WYKGETIIAAIGQGYFLSTPLQLAKAISIMANRGEIVEPHLLKDNE-
A5CW45_VESOH          KINKHKP------WYRGETLITGIGQGFIAVTPLQLAVATTAIANKGILFQPTLLKNTQA
A9KCR1_COXBN          MGTQGKP------WYTGDTIEAGIGQGFFLVTPLQLAQATATLAEHGKRYRPTLLFKSVE
Q87RQ5_VIBPA          MSRHKTP------WYKGDTIPVGIGQGYWTATPMQIAKATSVLVNNGAVSAPHLLKSTID
Q6LLA3_PHOPR          HAHYHQA------WYQGDTIPVGIGQGYWTASPMQIAKATAVVADEGVVHRPHLLKAVME
MRDA_ECOLI            QKRFKKP------WYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKVPHLLMSTAE
A7MK35_CROS8          MKRFKKP------WYQGDTIPVGIGQGYWTATPVQMNKAMMILINDGVVKVPHLLMTTVV
D4GM21_PANAM          MRRFKKP------WYQGDTIPVGIGQGYWTATPLQMNKAMMILINDGVIKVPHMLRATRE
A1JPW7_YERE8          QKRHKKP------WYQGDTIPVGIGQGYWTATPIQMAKALMTLINDGAVKTPHLLQSTRI
U2M473_SERFO          FKRYKKP------WYQGDTIPVGIGQGYWTATPIQMSKALNTLINDGNVKDPHLLQSTKI
E0SEU1_DICD3          MKRYKKP------WYQGDTIPVGIGQGYWTATPIQMLKALTTLINDGQVKAPHLLSSTQE
A0A0H3I6R0_PECPM      LRRFKKP------WYQGDTIPVGIGQGYWTATPIQMNKALVTLINDGQVKTPHLLYSSRE
Q492Z7_BLOPB          IQRFNQP------WYQGDTIPVGIGQGYWTATPIQMSKALITLINDGNVRIPHLLDSVLL
Q7VRB0_BLOFL          IKKYKTP------WYQGDTISVGIGQGYWSATPVQMSKALITLINDGNVLVPHLLNSILL
I2B442_SHIBC          KRVHKSM------WYQGDTVSVGIGQGYWIATPVQMVKALTTLLNNGKVKDPHLLYSMAS
A8GEB7_SERP5          QRVHKKT------WYQGDTISVGIGQGYWVATPIQMVKALTTLINNGKVKTPHLLYSMRQ
E6WAB0_PANSA          QKVHKKG------WYQGDTVSVGIGQGYWIATPIQMVKALVALLNNGRVINPHLLGKVQL
MRDA_SALTY            QRVHKKA------WYQGDTISVGIGQGYWIATPIQMVKAMVALINNGKVIAPHLLLNEES
G9Y2R2_HAFAL          LKVHKKA------WYQGDTISVGIGQGYWTATPIQMVKALSTLINNGNTKTPHLMYSMKQ
Q9CJR8_PASMU          QKRHKRP------WVQGDTISVGIGQGYWIATPLQVAKATSILINEGKVHTPHLMKSVEG
MRDA_HAEIN            QKRYKRP------WVQGDTISVGIGQGYWTATPLQVAKATTILVNNGKVNTPHLMKAIEG
B8F685_HAEPS          QKRYRKS------WLQGDTISVGIGQGYWISTPLQLAKATAVLINNGRVNTPHLMKEIMS
A3QH53_SHELP          RLKYNQP------WYIGDTISVGIGQGYWTTTPLQLANATAIMANKGERFVPHLLKSIKN
A1S8T4_SHEAM          RIRHNQP------WYPGDTISVGIGQGYWTATPIQLANATAILANRGKRFVPHLLKAMKD
Q5QYD8_IDILO          RARFGQP------WYAGETLSVGIGQSYWTATPMQLAVATAMVANKGEHLIPRLLRGKIQ
                                   *  .: :  .:**.    : :*:          *    * :      

D0SAM0_ACIJO          AKPHK------DLNAPDGRIQFNGTDQDWIQMRDAMVDVIETGTGRGIRT-----PMYKI
Q4FRE7_PSYA2          AAAVD------VITKPDGKIDYNGKPSDWLRMHDAMEETIKAGTGRGIYT-----PRYRI
F8G6R0_PSEP6          QPPVD---------DNPMENIVLRDKSDWAKVTHGMEQVMHNARGTARKA--AIGSQYRI
J8V5W5_PSEPU          QPPVD---------DNPMENIVLRDKSDWAKVTHGMEQVMHNARGTARKA--AIGSQYRI
A0A0X1SZ91_PSEAA      QKPLD---------ENPMADIVLRNPSDWDKVNHGMQQVMHGARGTARKA--AIGAQYLI
F6AE75_PSEF1          SPPHD---------PNPMPDIVLRDPKYWDYARQGMESVMHGARGTARKV--GDTAAYRI
A4VR03_PSEU5          EPPVD---------PEPLPDIQLRDPRFWDYATHGMEQVLHGARGTARKV--GESSVYRI
A0A024HAK7_PSEKB      QPPAD---------PEPMPDIDLREPGNWEMIDSDMQQVVHNARGTAHKV--GATSVYRI
C1DMQ4_AZOVD          LTPEQLVANGLLETRPTPPDIQLREPHNWDLISSDMQQVVHGARGTAHKV--GATARYRI
Q3K9B4_PSEPF          VAPVD---------EHPMPNILLKDPRDWEQVNHGMQMVMHDARGIARAA--AAGAQYRI
F8XKR8_PSESJ          KAPVD---------EHPMPNIVLHDPNEWNQVNTGMQMVMHDPRGIARDA--AKGAQYRI
Q1IAM3_PSEE4          QAPID---------PNPMPDIVLHDRRAWDQVSQGMQMVMHDPRGIARAA--AAGAQYRI
A1U3B9_MARHV          DSPVE-----EFLPEQTHEQLELKDPDDWEYVVDTMEEVMHGARGTGRSA--GRGASYRM
K4KXF7_SIMAS          ----------QVVIEPEVVDTQKISAGDWQLVEQAMEAVVHNPRGTAQSI--NRKLNYKI
W0E3I9_MARPU          SEPAP--LTPEEALPIVDHQIRVEDPAHWDTVIDAMVAVIEDRQGTARKI--RSP-DYRI
I1XMJ6_METNJ          DNDEG--MQLLGVQQ--ADSLPIQKSSHWQSVIESMVEVVHGKRGTARHI--GTNLPFQI
L0DY27_THIND          HSDAE--PIVQPVRR---LAPVSASDDHWAVIHEALIDAVHARHGTAWGSIGSTAPSYRI
H8GQD8_METAL          AQGVQ-------KSPEQPARIIPLKAQNLDPIVAGMINVVHSASGTAKRI--GYGIPYQI
D5CU46_SIDLE          PSGG------GVPTVIKRLFDLKIDPANLKLVKSAMEAVTKP-GGTASVAS--YGAPYRI
Q7NPY2_CHRVO          SKTGK-----SRQIEPQPIRQLPYPKEYFDYIKEGMRNVMIS-G-TGARVG--AGLQYTM
D8NAB8_RALSL          SINKA-----RTLTVPTESYRIPLKQANIDVIKRAMAGVVQA--GTAAKAF--AGAQYAA
A2S8I4_BURM9          PISRA-----RHLTVPKESGVIPLKQNDLDVVKRGMENVVESPSGTAFKVF--RGAPYLA
G4QDF4_TAYAM          PLDGS-----VTPIVKEPEYIIPLNQKYIDVVKNAMVQVTRS--GTARRVF--AGADYLS
V8QQ28_9BURK          PISKA-----VTPTVKQPDYQIPVSETSIRLVKDALVDVTKR--GTARRSF--VGAAYDS
Q2KU77_BORA1          SRTGE-----LTATPSTPDYRIPLKQANIDVIKSAMADVVRS--GTARRAF--ANTAYQA
G0CGF2_XANCA          GFDHP-----WQPMIQPPGKPISANAAHLQVVREGMMDTMRP-GGTGYAIT--PGAPYQM
G7TCD5_XANOB          GFDHP-----WEPMIQPPGKPISPNPAHLQVVREGMMDTMRP-GGTGYAIT--PGAPYQM
B4SJ25_STRM5          GFDHD-----WMATDPGESKPVSPNPNNLQAVREGMMATMLP-GGSAARMA--AGAPYTM
B2I959_XYLF2          AFSQP-----WQVLPQPPSQPISSNPGHVQVVREGMIDTMRP-GGTGYQAA--IGAPYSI
B7J7N2_ACIF2          --------------PDGATQPLDFSPEDIAVIQGAMRDAVTS-G--TGKSL--ANDLHAI
Q31F48_HYDCU          -----------QTKKE---QIPIQNIENWEKVIKAMMDVLHSSRGTARKYG--RDLPFKM
A5CW45_VESOH          SDDII-----IESKKDSHIQIPIKNIQNWEDVIDGMKQAIYAPKGTARKLN--KGLTYTL
A9KCR1_COXBN          PTGKV-----NVQQPIPKPPIFLKNPDNWDIVIHAMQEVVDKPWGTADFFG--RHPGFTV
Q87RQ5_VIBPA          NGDNF--EEQETSEYVTYPPIQNVPEKYWDIAKEGMRRVNHGTRGTARRS--FYNMSYQT
Q6LLA3_PHOPR          GG------QFEPVLFKDYPRISEAKKQNWDLAKEGMHRVI--VSGTARKL--FKTLAYEA
MRDA_ECOLI            -DG-----KQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKY--FASAPYKI
A7MK35_CROS8          -NG-----QKVPWKQPEQPPVGDIHSGYWEIAKDGMYGVANRANGTGHKY--FAGAPYKI
D4GM21_PANAM          -GR-----TLVPYRQPPSQPIGDIHSGYWEIAKDGMYGVANRPNGTAHKS--FADAPYKI
A1JPW7_YERE8          -DG-----VLVPYKQEDSTQIGDIHSGYWEIAKDGMYGVANRPNGTGRKF--FEGTPYKA
U2M473_SERFO          -NG-----VLVPFKQKESKQIGDIHSGFWEIAKDGMYGVANRPNGTARKF--FEKTPYKA
E0SEU1_DICD3          -NN-----TQVPYRQQEHQQIGDIRSGYWEIVKDGMYGVANRQNGTAHKF--FADAPYKI
A0A0H3I6R0_PECPM      -NG-----AIVPFRQTENQQIGNIHSGYWEVAKDGMYGVANRANGTAHKS--FDDAPYKI
Q492Z7_BLOPB          -EK-----NCVPYHQTECDQVGDPKSNVWKIAKDGMFGAANRPNGTVSGS--FSGTSYKA
Q7VRB0_BLOFL          NEQ-----YYIPYTQIERNQIGDPKSNVWEIAKDGMFGAANRPNGTVKNS--FSNTEYKA
I2B442_SHIBC          GTR-----VMRYQPPAQTPQVGDPNSPYWNIVRNGMYGMANLPNGTGYKM--FHSAPYGI
A8GEB7_SERP5          GRQ-----VNLYQPPKQAAQIGDAKSPYWGIVRNGMYGMANLPNGTGYKL--FHTAPYQI
E6WAB0_PANSA          GTT-----QQPYEAKDPQPQIGDPKSPYWSLVRHAMFGMANAPNGTGYKY--FHTAPYGI
MRDA_SALTY            GKT-----VVPYRPSGTPAQIADPASPYWGLVRQAMYGMANAPNGTGYKF--FHTAPYGI
G9Y2R2_HAFAL          GNH-----VERYQ-QQEHVQVADPKSPVWDIVKKGMFGMANYPNGTGYKY--FHTAPYEI
Q9CJR8_PASMU          -ST-----VEPYQDPLLYEDITEPKAAYWDAAKRGMYNVVNAANGTGRKA--FIGTSYRV
MRDA_HAEIN            -AV-----LEPYEDPLLYPDINTPKVAAWEAAKRGMYNVVNAANGTGRKA--FADANYRV
B8F685_HAEPS          -SE-----LIPYKDPLLYEDISDVPSLYWQISKLGMYNVINASNGTGRKA--FAGTAYRA
A3QH53_SHELP          DT------VKVDTPVDKMAPVVLKSPHNWQIINEAMRDTAHKSR--------FVDAGYTA
A1S8T4_SHEAM          NS------AKIERPPEEMPPVALKNPRNWEIINEAMRQTAHKSR--------FTDATYTA
Q5QYD8_IDILO          DG------VFEEALIAHREKLTLSDSSNWEVITKGMRNVNMSPKGTAHRA--FKDAPYSS
                                                         :                     .  

D0SAM0_ACIJO          AGKTGTAQVKSIAQGKRYN-EALLTERQLDHGLFVGFAPAENPEIAIAVVWENG-RHG-G
Q4FRE7_PSYA2          AGKTGTAQVKSIAQGKSYN-KSALDKRQWDHAWFNGFAPVEDPQIALAVLVENG-GGGSV
F8G6R0_PSEP6          AGKSGTAQVVAIKQGEKYD-RNKLQERHRDHALFVAFAPAEDPKIVVSVMVENG-ESGSG
J8V5W5_PSEPU          AGKSGTAQVVAIKQGEKYD-RNKLQERHRDHALFVAFAPAEDP--------EDR-GFGDG
A0A0X1SZ91_PSEAA      AGKSGTAQVVAIKQGEKYD-RSKVQERHRDHALFVGFAPANNPKIAVAVMVENG-ESGSG
F6AE75_PSEF1          AGKSGTAQVVAIKQGEKYD-RSKVQERHRDHALFVGFAPADNPQIVVSVMVENG-ESGSG
A4VR03_PSEU5          AGKSGTAQVVAIRQGEKYD-SAKLAERHRDHALFVAFAPVHDPKIAVAVMVENG-ESGSG
A0A024HAK7_PSEKB      AGKSGTAQVVAIKQNEKYD-RSKLSERTRDHALFVGFAPADNPQIAVSVMVENG-ESGSG
C1DMQ4_AZOVD          AGKSGTAQVVAIRQGERYN-RNKLQERHRDHALFIAFAPAENPRIAVAVMVENG-ESGSG
Q3K9B4_PSEPF          AGKSGTAQVVAIKQGERYN-REKTLERHRDNALFVGFAPAEHPKIAISVMIENG-EAGGR
F8XKR8_PSESJ          AGKSGTAQVVAIKQGGRYN-RLKTLERNRDNALFVGFAPADHPKIVVSVTIENG-EAGGR
Q1IAM3_PSEE4          AGKSGTAQVVAIKQGERYN-RDKTLERHRDNALFVGFAPAEHPAMVVAVMIENG-EAGGR
A1U3B9_MARHV          AGKTGTAQVFSLGQDEEYD-EEQIKERLRDHALFVGFAPADDPKIAVAVIVENG-GSGSG
K4KXF7_SIMAS          AGKTGTAQVVGIAQGEEYD-SEALEERLRDHALFVAFAPADNPRTAVAVIVENG-EK-SS
W0E3I9_MARPU          AGKTGTAQVFTIGQNERYD-AETVPERLKDHALFVAFAPIEDPRIAVAVVVENG-GSGSA
I1XMJ6_METNJ          AGKTGTAQVFGIAQDAKYD-AELLAKKLHDHALFVAFAPATDPEIAIAVVVENG-GSGSA
L0DY27_THIND          AGKTGTAQVFSLAPDQEYD-ESELDRRLWDHALFLAYAPADDPQIAVGVLVEHG-GSGGR
H8GQD8_METAL          AGKTGTAQVFGIKQGAKYN-ESQIDFKLRDNALFVAFAPADDPKIAVAVVIEHG-GHGGS
D5CU46_SIDLE          AGKTGTAQVIAIKQGEKYD-AKKISEYNRDHAWFIAFAPADKPRIAMAVLVENG-GHGGT
Q7NPY2_CHRVO          AGKTGTAQVVAIKQGAKYN-AAALAEQYRDHSWFIAFAPVEQPKIAVAIIVENA-GFGAA
D8NAB8_RALSL          AGKTGTAQVFSLGKGEKYN-HHAIPENKRDHALFEAFAPTDHPKIAVALIVENA-GFGAT
A2S8I4_BURM9          AGKTGTAQVFSLQ-GGNYR-GHLLAEHLRDHALFIAYAPVDHPQIALALIVENG-GWGAQ
G4QDF4_TAYAM          AGKTGTAQVFNLR-GSRYN-ARNLKKRLHDHALYIGYAPADNPKIALALIVENG-GWGST
V8QQ28_9BURK          AGKTGTAQVFSLK-GSKYN-SRTLKRSLWDHALYMGFAPAEEPKIAVALIVENG-GWGAS
Q2KU77_BORA1          AGKTGTAQVFSLR-GGQYR-AAALDERLRDHALFMGFAPVEHPRIAVALIVENA-GWGAS
G0CGF2_XANCA          AGKTGTAQVVSR-RGVAAVDPRSLPLHLRHRGLFVGFAPADNPVIAVAVAVEGG-GFGTS
G7TCD5_XANOB          AGKTGTAQVVSR-KGVAAVDPRSLPLHLRHRGLFVGFAPADHPVIAVAVAVEGG-GFGTS
B4SJ25_STRM5          AGKTGTAQVVSR-KGTAAVNPKSLPMHLRHRALFVGFAPVDQPVIALAIAVEGG-GYGGA
B2I959_XYLF2          AGKTGTAQVASR-KGEAAVDPRNLPMHLRHRALFVGFAPADNPTIAVAVAVEGG-GYGAS
B7J7N2_ACIF2          AGKTGTAQVHHAQRNDSGRVLRDTVQLWQDHALFIAYAPADHPRIAVAVVVEHG-GHGGS
Q31F48_HYDCU          AGKTGTAQVFSLNE--GEYDEENIRKSLRDHSLFIGFAPVKKPKIAISVIIENS----TL
A5CW45_VESOH          AGKTGTAQVFSLDNTIKQYIEAKLDERLRDHALFTGFAPTENPEIAIAIIVENA-GNGSS
A9KCR1_COXBN          AAKTGTAQVYGHQRD-EDKSRTNIPKRLRNNHLFIAFAPVENPQIAVAVVVEHS-----A
Q87RQ5_VIBPA          AGKSGTAQVFGLGENEEYN-ADEIAEHLRDHALFTGFAPFDDPKVIVTLVLENA-GGGSS
Q6LLA3_PHOPR          GGKTGTSQVFGLARGQKYN-SKEVAEHLRDHALFTGFAPLNHPKVLVAIVLENA-GWGK-
MRDA_ECOLI            AAKSGTAQVFGLKANETYN-AHKIAERLRDHKLMTAFAPYNNPQVAVAMILENG-GA-GP
A7MK35_CROS8          AAKSGTAQVFGLKANETYN-AHRIAERLRDHKLMTAFAPYDNPQVAVAMILENG-GA-GP
D4GM21_PANAM          AAKSGTAQVFGLKENETYN-AHKIAERLRDHKLMTAFAPYDKPRVAVTMILENG-GA-GP
A1JPW7_YERE8          AAKSGTAQVYSY---ETYN-AHKVAEHLRDHKLMVAFAPYENPTVSVAMILENG-GA-GP
U2M473_SERFO          AAKSGTAQVFGY---ETYN-AHKLAEHLRDHKLMTAFAPYDNPTVSVAIILENG-GS-GP
E0SEU1_DICD3          AAKSGTAQVFGLKENETYN-ANRIAERLRDHKLMTAFAPYNNPKVAMSIILENG-GA-GP
A0A0H3I6R0_PECPM      AAKSGTAQVFGLKENETYN-AHKIAEHLRDHKLMVSFAPYKNPKVALSIILENG-GA-GP
Q492Z7_BLOPB          AAKSGTAQLFNLKSNQNYD-PSKISESLRDHKLMTAFAPYENPTVAVVVILENA-RI-GV
Q7VRB0_BLOFL          AVKSGTAQLFSLRNNQTYN-PNKISKYLKDHKLMTAFAPYDKPTIAVVIILENG-EG-NI
I2B442_SHIBC          AAKSGTSQVFSLRQNQVYN-ARMIPVRLRDHIFYTLFAPYQHPKVAMALILENG-GGDGV
A8GEB7_SERP5          AAKSGTSQVFGLKENQTYN-AKMIPVRLRDHIFYTLFAPYKNPRVAMALILENG-GGDGV
E6WAB0_PANSA          AAKSGTSQVFSLRQNQVYN-AKMIPTRLRDHIFYTAFAPFNDPKVAVALILENG-GNEGI
MRDA_SALTY            AAKSGTSQVFSLKENQTYN-AKMIPIRLRDHVFYTAFAPYKNPKVAIALILENG-GSDGV
G9Y2R2_HAFAL          AAKSGTSQVFGLKQDQVYN-AKMIPVKLRDHIFYTAFAPYSNPKVAIAVILENG-GGDGV
Q9CJR8_PASMU          AGKSGTAQVFSLKENQTYD-ASGLKKELHDHAWFTAYAPYDDPKMVVAIILENA-GGGSS
MRDA_HAEIN            AGKSGTAQVFSLKENEKYN-TAGLKKELHDHAWFTAYAPYDNPKLVVTVILENA-GGGSS
B8F685_HAEPS          AGKTGTAQVFSLN-GQSYD-AKGLKKNLHDHGWFIGYAPYDNPKIVVSIILENA-GGGGS
A3QH53_SHELP          AMKTGTAQVFSVAEDEKYD-AENIDEHLRDNALIVAYAPYEAPRIVLAVVLENA-GWGGA
A1S8T4_SHEAM          AMKTGTAQVFSVAQDAKYD-HDKVAEHLRDNALIVAYAPFESPKIVLAVVLENA-GWGGA
Q5QYD8_IDILO          AGKTGTAQVRSLGQEEEYN-AEDIAERYRDNAMYVGYAPAEDPEVVVVVAIENSLGGGGS
                      . *:**:*:                    ..     :**   *        *        

D0SAM0_ACIJO          SAAQLARPILDYWLLTRHKNPIRPQNHQISGGLMTAGIKPGELPSGSTPPATTTGTSAAT
Q4FRE7_PSYA2          VAAPIGRALFDYWVLQRDTNPILPPTTD-----QLKVIKRQKAFEKATLDAIRDKEDKAL
F8G6R0_PSEP6          VAAPVVRQVMDAWLLDENGRLKP--EFA------------------------PATVTQES
J8V5W5_PSEPU          RER---------------------------------------------------------
A0A0X1SZ91_PSEAA      VAAPVVRQVMDAWLLGPDGRIKP--EYA------------------------GTTTAEAT
F6AE75_PSEF1          VGAPVVKQVMDAWLLDENGQLKA--EYAKPGAA-------------------APLNAEVK
A4VR03_PSEU5          VAAPVAKQVMDAWLLDEEGKLKA--EFA------------------------PPLTAEGK
A0A024HAK7_PSEKB      VAAPVLKQVMDAWLLDENGKLKP--EYA-------------------------PQVAQVQ
C1DMQ4_AZOVD          VAAPVAKQVMDAWLLDEKGQLKA--TAQF--AA-------------------APQEGIRE
Q3K9B4_PSEPF          VAGPVVRQIMDAWLLDQDGHLKP--QYA------------------------APTKAPGD
F8XKR8_PSESJ          VAGPVVREILDAWLLDSEGKLKP--EYA------------------------TPAKAPGN
Q1IAM3_PSEE4          VAGPVVREVMDAYLLDEQGHLKA--QFA------------------------GTAGKEAA
A1U3B9_MARHV          AAAPVARALFDAWLEEFPAEQAE--PVIS-----------------------DSSAAGGD
K4KXF7_SIMAS          EAAKIARTLFDAQFTQEGQTSSS--QVTP-----------------------AWLGSGGQ
W0E3I9_MARPU          TAAPIARRVIDAYLGGEPLPPEQDEE-----------------------------RADGD
I1XMJ6_METNJ          TAAPIARKLIDVYFGIETDEPATE------------------------------------
L0DY27_THIND          VAAPIARKVIDFHLASRGLLADAVEA-----------------------------GGVR-
H8GQD8_METAL          VAAPIAGKVIKQYLQNLHEN----------------------------------------
D5CU46_SIDLE          TAAPIARKVMDYYLLGKIP---------------------------------QPL----Q
Q7NPY2_CHRVO          AAAPVARGLFDFYLTGKVR---------------------------------NDLAGMLK
D8NAB8_RALSL          SAAPIARAVFDYYLEGKW--PAELAAIAPKVQPQPPVDTPSVFSTGKTATIASA-TATPQ
A2S8I4_BURM9          SAGPIARRVLDFYLLERKNPSTEAAAVAAAASATEPVNAPVIGDATKPVGIAAGFKALPQ
G4QDF4_TAYAM          VAAPIARKVFDYWLSPQRQ-KVYEESLINDGYDT--TISPAIEDNIDAESESSPDTEVPE
V8QQ28_9BURK          IAAPIARKVFDYWLSPTRSAQVNSAPVLEIGND-------------EPAEDTSPDVMVPQ
Q2KU77_BORA1          VAAPIAREVFDYWLTPKRE----------------------------------DKIVRPQ
G0CGF2_XANCA          SAAPIARKVFDAWLLGKLPEGLEPLDSELGMTAVGVNQFEAGATDARQQGDAAAAALDEL
G7TCD5_XANOB          SAAPIARKIFDAWLLGKMPAGLEPLDSELGMTAVGVNRFEAGVTDARAAGDAAAATLDEL
B4SJ25_STRM5          AAAPIARKVFDAYLLGKMPEGMQPLDSERGTTAIGATAFDNEDVGARQAGDLAAAQVGEH
B2I959_XYLF2          TAAPIARKIFDAWLLGKLPEGLEPLDSARGRTAIGLTQFDMTVAGVCEAGNRAALQLGEI
B7J7N2_ACIF2          TAGPVARAVIDAYLNTLTTAEVNS------------------------------------
Q31F48_HYDCU          KAAPVAVDITKYYLSELQDEN---------------------------------------
A5CW45_VESOH          KAAPIARQVLDVYFNKQLNNTLP-------------------------------------
A9KCR1_COXBN          MADKMAGEIINYYFKHQQK-----------------------------------------
Q87RQ5_VIBPA          NGGPMARKIFDRVVLGP-------------------------------------EEIKPE
Q6LLA3_PHOPR          YAAPIARNIMDYVLVKPTINLDA-----------------------------DPSNLPPD
MRDA_ECOLI            AVGTLMRQILDHIMLGDNNTD----------------------------------LPAEN
A7MK35_CROS8          AVGTIMRQILDHIMLGDNNTE----------------------------------LPTEN
D4GM21_PANAM          AVGTVMRQILDHIMLGDNNTV----------------------------------LPDAA
A1JPW7_YERE8          AVGTITRQILDHILLGDNNTE----------------------------------LPDAA
U2M473_SERFO          AVGTITRQILDHILLGDNNTQ----------------------------------LPDAV
E0SEU1_DICD3          AVGSIVRQILDHIILGDNNTN----------------------------------LPDAP
A0A0H3I6R0_PECPM      TVGTITRQILDHILLGDNNTD----------------------------------LPSAP
Q492Z7_BLOPB          SIGSITRKIFDYVLLQ--------------------------------------------
Q7VRB0_BLOFL          PIGTITRKILDFVLLQ--------------------------------------------
I2B442_SHIBC          VAGPVARKILDHIFLPGHGMAET-----------------------------PPGLPGDA
A8GEB7_SERP5          VAGPTARAILDHIFDPANAPQ--------------------------------PEQGQEV
E6WAB0_PANSA          TAAPVMRNILDHIFLPPPAVP--------------------------------------V
MRDA_SALTY            TAAPIMRKILDHLFDPQ------------------------------------------A
G9Y2R2_HAFAL          SAAPTTRAILDYIFAQTKPEE-----------------------------------PPAL
Q9CJR8_PASMU          VAAPVVRQIMDYYLTQRLPQISR-----------------------------LSPADSLA
MRDA_HAEIN            NAAPLARKVMDYYLNQRLPQVEK-----------------------------YNVPIQQK
B8F685_HAEPS          TAAPIARQIMDYALLHQTEATAP-----------------------------LPVEEREP
A3QH53_SHELP          NAGPVARALLDEYMLRDNLPL-------------------------------------ET
A1S8T4_SHEAM          NAGPVARAMLDEFMLHEQWKV-------------------------------------QP
Q5QYD8_IDILO          VAAPVARKILDVWHTRFNNGK-------------------------------------KQ
                                                                                  

D0SAM0_ACIJO          PTSTSNTAPASTTANTSRSATPPSAPVESD------------------------------
Q4FRE7_PSYA2          KAAKEKTKAQAQTATATTE-----------------------------------------
F8G6R0_PSEP6          AL----------------------------------------------------------
J8V5W5_PSEPU          ------------------------------------------------------------
A0A0X1SZ91_PSEAA      P-----------------------------------------------------------
F6AE75_PSEF1          QP----------------------------------------------------------
A4VR03_PSEU5          KP----------------------------------------------------------
A0A024HAK7_PSEKB      KP----------------------------------------------------------
C1DMQ4_AZOVD          Q-----------------------------------------------------------
Q3K9B4_PSEPF          PHV---------------------------------------------------------
F8XKR8_PSESJ          PHA---------------------------------------------------------
Q1IAM3_PSEE4          PHG---------------------------------------------------------
A1U3B9_MARHV          N-----------------------------------------------------------
K4KXF7_SIMAS          P-----------------------------------------------------------
W0E3I9_MARPU          ------------------------------------------------------------
I1XMJ6_METNJ          ------------------------------------------------------------
L0DY27_THIND          ------------------------------------------------------------
H8GQD8_METAL          ------------------------------------------------------------
D5CU46_SIDLE          KVTDKTGDASD-------------------------------------------------
Q7NPY2_CHRVO          TVPMENGDVREDAAD---------------------------------------------
D8NAB8_RALSL          AAAEAVAQSAALAAAASGV--QAADAATAGGASAPGASAVAAGALAMSPDLVAPALREAG
A2S8I4_BURM9          PVPPASASGADGASGASGAGGEPTEHANAGGNPAGGGIAGGAAGTANNGSGAAAPGGMPG
G4QDF4_TAYAM          KPLSNPEDKPLDTRPEIFR--GPNSSQYPDE-----------------------------
V8QQ28_9BURK          NVPDNPEDRAPEHLPDILAPVGNGNGRNGDERRQDNE-----------------------
Q2KU77_BORA1          QVAAGEKAQ---------------------------------------------------
G0CGF2_XANCA          PVVIGQVAV----ALDPNRPAQPVIPDVPDTVSETDR-----------------------
G7TCD5_XANOB          PVVIGQTAV----ALDPNTPAQPVVPDVPDAVQETDH-----------------------
B4SJ25_STRM5          QVLVGVPAPEPVPAPQPGTPAAAALPVTPRPTAAEPAR----------------------
B2I959_XYLF2          QVSVAGGML----NSTAMMPVAPRAPVTLDSLPEEDP-----------------------
B7J7N2_ACIF2          ------------------------------------------------------------
Q31F48_HYDCU          ------------------------------------------------------------
A5CW45_VESOH          ------------------------------------------------------------
A9KCR1_COXBN          ------------------------------------------------------------
Q87RQ5_VIBPA          DDKTNAQKEVTR------------------------------------------------
Q6LLA3_PHOPR          QLMTHDGRHVNVHKNTQTALPKKELAHHKVKVLDSEQVKHS-------------------
MRDA_ECOLI            PAVAAAEDH---------------------------------------------------
A7MK35_CROS8          PATAAAEDR---------------------------------------------------
D4GM21_PANAM          PTPPGYEGE---------------------------------------------------
A1JPW7_YERE8          PLPPGVEAD---------------------------------------------------
U2M473_SERFO          PLPPGIEGD---------------------------------------------------
E0SEU1_DICD3          PSPPGSETE---------------------------------------------------
A0A0H3I6R0_PECPM      PAPPGSESE---------------------------------------------------
Q492Z7_BLOPB          ------------------------------------------------------------
Q7VRB0_BLOFL          ------------------------------------------------------------
I2B442_SHIBC          PPAERDALPPGDSDGAR-------------------------------------------
A8GEB7_SERP5          KPELNDSADVQQ------------------------------------------------
E6WAB0_PANSA          ETANIANAPAAR------------------------------------------------
MRDA_SALTY            DTTQPDQAP---------------------------------------------------
G9Y2R2_HAFAL          PSPDAEQVQDAH------------------------------------------------
Q9CJR8_PASMU          TEDSE-------------------------------------------------------
MRDA_HAEIN            KDLSQESEQINGR-----------------------------------------------
B8F685_HAEPS          PEAEELSE----------------------------------------------------
A3QH53_SHELP          AGSPHNERP---------------------------------------------------
A1S8T4_SHEAM          ------------------------------------------------------------
Q5QYD8_IDILO          QEETNADN----------------------------------------------------
                                                                                  

D0SAM0_ACIJO          ------------------------------------------------------------
Q4FRE7_PSYA2          ------------------------------------------------------------
F8G6R0_PSEP6          ------------------------------------------------------------
J8V5W5_PSEPU          ------------------------------------------------------------
A0A0X1SZ91_PSEAA      ------------------------------------------------------------
F6AE75_PSEF1          ------------------------------------------------------------
A4VR03_PSEU5          ------------------------------------------------------------
A0A024HAK7_PSEKB      ------------------------------------------------------------
C1DMQ4_AZOVD          ------------------------------------------------------------
Q3K9B4_PSEPF          ------------------------------------------------------------
F8XKR8_PSESJ          ------------------------------------------------------------
Q1IAM3_PSEE4          ------------------------------------------------------------
A1U3B9_MARHV          ------------------------------------------------------------
K4KXF7_SIMAS          ------------------------------------------------------------
W0E3I9_MARPU          ------------------------------------------------------------
I1XMJ6_METNJ          ------------------------------------------------------------
L0DY27_THIND          ------------------------------------------------------------
H8GQD8_METAL          ------------------------------------------------------------
D5CU46_SIDLE          ------------------------------------------------------------
Q7NPY2_CHRVO          ------------------------------------------------------------
D8NAB8_RALSL          TSAQAVAPATLDAQVLQALSHVQPAPDLP--SPRGHNLPAAPASAPAASPKDRKPAVKPN
A2S8I4_BURM9          ANGAAMGAPPASRRLPPRKPRRTPASDAAISAAASRDDPRKPSSGAPKTPAQDDNHAVSA
G4QDF4_TAYAM          ------------------------------------------------------------
V8QQ28_9BURK          ------------------------------------------------------------
Q2KU77_BORA1          ------------------------------------------------------------
G0CGF2_XANCA          ------------------------------------------------------------
G7TCD5_XANOB          ------------------------------------------------------------
B4SJ25_STRM5          ------------------------------------------------------------
B2I959_XYLF2          ------------------------------------------------------------
B7J7N2_ACIF2          ------------------------------------------------------------
Q31F48_HYDCU          ------------------------------------------------------------
A5CW45_VESOH          ------------------------------------------------------------
A9KCR1_COXBN          ------------------------------------------------------------
Q87RQ5_VIBPA          ------------------------------------------------------------
Q6LLA3_PHOPR          ------------------------------------------------------------
MRDA_ECOLI            ------------------------------------------------------------
A7MK35_CROS8          ------------------------------------------------------------
D4GM21_PANAM          ------------------------------------------------------------
A1JPW7_YERE8          ------------------------------------------------------------
U2M473_SERFO          ------------------------------------------------------------
E0SEU1_DICD3          ------------------------------------------------------------
A0A0H3I6R0_PECPM      ------------------------------------------------------------
Q492Z7_BLOPB          ------------------------------------------------------------
Q7VRB0_BLOFL          ------------------------------------------------------------
I2B442_SHIBC          ------------------------------------------------------------
A8GEB7_SERP5          ------------------------------------------------------------
E6WAB0_PANSA          ------------------------------------------------------------
MRDA_SALTY            ------------------------------------------------------------
G9Y2R2_HAFAL          ------------------------------------------------------------
Q9CJR8_PASMU          ------------------------------------------------------------
MRDA_HAEIN            ------------------------------------------------------------
B8F685_HAEPS          ------------------------------------------------------------
A3QH53_SHELP          ------------------------------------------------------------
A1S8T4_SHEAM          ------------------------------------------------------------
Q5QYD8_IDILO          ------------------------------------------------------------
                                                                                  

D0SAM0_ACIJO          ------------
Q4FRE7_PSYA2          ------------
F8G6R0_PSEP6          ------------
J8V5W5_PSEPU          ------------
A0A0X1SZ91_PSEAA      ------------
F6AE75_PSEF1          ------------
A4VR03_PSEU5          ------------
A0A024HAK7_PSEKB      ------------
C1DMQ4_AZOVD          ------------
Q3K9B4_PSEPF          ------------
F8XKR8_PSESJ          ------------
Q1IAM3_PSEE4          ------------
A1U3B9_MARHV          ------------
K4KXF7_SIMAS          ------------
W0E3I9_MARPU          ------------
I1XMJ6_METNJ          ------------
L0DY27_THIND          ------------
H8GQD8_METAL          ------------
D5CU46_SIDLE          ------------
Q7NPY2_CHRVO          ------------
D8NAB8_RALSL          PKPAPKPARAAP
A2S8I4_BURM9          ARPAAGGIDE--
G4QDF4_TAYAM          ------------
V8QQ28_9BURK          ------------
Q2KU77_BORA1          ------------
G0CGF2_XANCA          ------------
G7TCD5_XANOB          ------------
B4SJ25_STRM5          ------------
B2I959_XYLF2          ------------
B7J7N2_ACIF2          ------------
Q31F48_HYDCU          ------------
A5CW45_VESOH          ------------
A9KCR1_COXBN          ------------
Q87RQ5_VIBPA          ------------
Q6LLA3_PHOPR          ------------
MRDA_ECOLI            ------------
A7MK35_CROS8          ------------
D4GM21_PANAM          ------------
A1JPW7_YERE8          ------------
U2M473_SERFO          ------------
E0SEU1_DICD3          ------------
A0A0H3I6R0_PECPM      ------------
Q492Z7_BLOPB          ------------
Q7VRB0_BLOFL          ------------
I2B442_SHIBC          ------------
A8GEB7_SERP5          ------------
E6WAB0_PANSA          ------------
MRDA_SALTY            ------------
G9Y2R2_HAFAL          ------------
Q9CJR8_PASMU          ------------
MRDA_HAEIN            ------------
B8F685_HAEPS          ------------
A3QH53_SHELP          ------------
A1S8T4_SHEAM          ------------
Q5QYD8_IDILO          ------------