CLUSTAL format seed alignment for MF_02085

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q7V4E2_PROMM          -----MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHGFKEVMVNVSH
Q0I6W7_SYNS3          -----MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHGFTEVMVNVSH
Q3AGZ6_SYNSC          -----MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHGFTEVMVNVSH
Q7U410_PARMW          MSETPMKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHGFNEVMVNVSH
A8G2F7_PROM2          -----MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLREHNFKEIMVNVSH
A5GQH2_SYNR3          -----MKAMILAAGKGTRVQPITHTIPKPMIPILQKPVMEFLLELLRQHGFTEVMVNVSH
A0A0G8AU36_9SYNE      -----MKAMILAAGKGTRVQPITHTIPKPMIPILQKPVMEFLVELLKEHGFTEIMVNVSH
CUGP_SYNY3            -----MKAMILAAGKGTRVRPITHTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSH
K9YNP6_CYASC          --------MILAAGKGTRIRPITHTIPKPLIPILQKPVMEFLLELLRQHGFDQVMVNVSH
B7K9I4_GLOC7          -----MKAMILAAGKGTRVRPITYTIPKPLIPILQKPVMEFLLELLRQHGFDQIMVNVSH
B7JZQ9_RIPO1          -----MKAMILAAGKGTRVRPITHTIPKPLIPILQKPVMEFLLELLRQHGFDQIMVNVSH
Q8YRP4_NOSS1          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSH
Q3M7K7_TRIV2          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSH
B2IX24_NOSP7          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSH
K9ZJ56_ANACC          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDEIMVNVSH
A0ZD25_NODSP          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFNQIMVNVSH
A0A1B7X7I1_APHFL      -----MKAMILAAGKGTRIRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDEIMVNVSH
K9YUN6_DACSA          -----MKAMILAAGKGTRVRPITYTIPKPLIPILQKPVMEFLLELLRKHGFDEVMVNVSH
B1XM99_SYNP2          -----MKAMILAAGKGTRVRPITYTIPKPLIPILQKPVMEFLLDLLAQHGFDQIMVNVSH
Q8DL85_THEVB          -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLVELLRQHGFNQIMVNVSH
K9SQY6_9SYNE          -----MKAMILAAGKGTRVRPITYIMPKPMIPIMQKPVMEFLVELLRQHGFDQIMVNVSH
B4WFX1_SYNS7          --------MILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLKNHGFDQIVANVSH
A0A0H3K555_SYNP6      -----MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLKEHGFKEVMVNVSH
Q2JQM7_SYNJA          -----MKAMILAAGKGTRVRPITYMMPKPMIPILHKPVMEFLVELLREHGFDQIMINTSH
                              **********::***: :***:***::*******::** :*.* ::: *.**

Q7V4E2_PROMM          LAEEIENYFRDGQRFGVEIAYSFEGRIEE-GELIGDALGSAGGLKKIQDFQQFFDDTFVV
Q0I6W7_SYNS3          LAEEIENYFRDGQRFGVEIAYSFEGSIQD-GELIGDALGSAGGLKKIQDFQTFFDDTFVV
Q3AGZ6_SYNSC          LAEEIENYFRDGQRFGVEIAYSFEGRIED-GELIGSALGSAGGLKKIQDFQHFFDDTFVV
Q7U410_PARMW          LAEEIENYFRDGQRFGVEIAYSFEGRIED-GELIGSALGSAGGLKKIQDFQNFFDDTFVV
A8G2F7_PROM2          LAEEIENYFRDGQRFGVEIAYSFEGRIED-GELIGDALGSAGGLKKIQDFQKFFDETFVV
A5GQH2_SYNR3          LAEEIENYFRDGQRFGVEIAYSFEGRIED-GELIGDALGSAGGLKKIQNFQKFFDDTFVV
A0A0G8AU36_9SYNE      LAEQIEGYFRDGQRFGVQIAYSFEGYIED-GQLIGAALGSAGGMKKVQNFQPFFDDTFVV
CUGP_SYNY3            LAEEIESYFRDGQRFGVQIAYSFEGNIVD-GDLVGKALGSAGGLKKIQEFNPFFDDTFVV
K9YNP6_CYASC          LAEQIESYFRDGQRFGVQIGYSFEGSIVD-GELRGDALGSAGGIKRIQEFNPFFDETFVV
B7K9I4_GLOC7          LAEEIESYFRDGQRFGVQIAYSCEGYIGEDGKLVGEALGSAGGIKRIQDFHPFFDDTFVV
B7JZQ9_RIPO1          LAEEIESYFRDGQRFGVQIGYSFEGYIADNGDLVGEAMGSAGGLRRIQDFHPFFDDTFVV
Q8YRP4_NOSS1          LAEEIENYFRDGQRFGVQIAYSFEGKIDDEGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
Q3M7K7_TRIV2          LAEEIENYFRDGQRFGVQIAYSFEGKIDDEGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
B2IX24_NOSP7          LAEEIENYFRDGQRFGVQIAYSFEGKIDDDGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
K9ZJ56_ANACC          LAEEIENYFRDGQRFGVQIAYSFEGKIDDDGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
A0ZD25_NODSP          LAEEIENYFRDGQRFGVEIAYSFEGKIDDDGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
A0A1B7X7I1_APHFL      LAEEIESYFRDGQRFGVQIAYSFEGKIDDDGKLVGEAIGSAGGMRRIQDFSPFFDDTFVV
K9YUN6_DACSA          LAHEIESYFRDGQRFGVDIAYSFEGRIVD-GQLVGEALGSAGGIRRIQDFNKFFDDTFVV
B1XM99_SYNP2          LAHEIEGYFKDGQRYGVHLAYSFEGSIQD-GELQGAALGSAGGLRKIQDFHPFFDDTFVV
Q8DL85_THEVB          LAHEIESYFQDGQRFGVEIAYSFEGYIKD-GELVGKALGSAGGIKRIQDFNPFFDDTFVV
K9SQY6_9SYNE          LSEEIENYFRDGQKFDVQMGYSFEGKIVN-GELVGDALGSAGGLKKIQDFSPFFDDTFVV
B4WFX1_SYNS7          LANEIEGYFRDGQRFGVELAYSFEGRITD-GELVGEAIGSAGGMRKIQDFSPFFDDTFIV
A0A0H3K555_SYNP6      LAQEIESYFRDGQRFGVEVAYSFEGRIED-GQLIGEALGSAGGMKRIQDFSPFFDDTFVV
Q2JQM7_SYNJA          LAHQIEDYFRDGQQWGVHIGFSFEGHFEN-GQPVAEPLGSAGGMRKIQDFSGFFDSTFVV
                      *:.:**.**:***::.*.:.:* ** : : *.  . .:*****::::*:*  ***.**:*

Q7V4E2_PROMM          LCGDALIDLDLSEAVKRHRAKGALASLVTKRVPKDQVSSYGVVVTDENDCVQAFQEKPST
Q0I6W7_SYNS3          LCGDALIDLDLTEAVRRHRAKGALASLVTKTVPKDQVSSYGVVVSDDDGKIQAFQEKPSV
Q3AGZ6_SYNSC          LCGDALIDLDLSEAVRLHKDKGAIASLVTKRVPKDQVSSYGVVVTDDQNRISSFQEKPSV
Q7U410_PARMW          LCGDALIDLDLTEAVRRHREKGALASLVTKRVPKEQVSSYGVVVTDAEDRISHFQEKPKV
A8G2F7_PROM2          LCGDALVDLDLTQAVKKHKQKGAIASLITKRVIKDQVSSYGVVVSDENGRIKAFQEKPSV
A5GQH2_SYNR3          LCGDALIDLNLSEAVRKHRQSGALATIITKRVPKEKVSSYGVVVTDDDGRVKAFQEKPGV
A0A0G8AU36_9SYNE      LCGDALIDLDLSQAVRRHRACGALASVVTKSVPRDRVEGYGVVMSDEDGRVQVFQEKPPQ
CUGP_SYNY3            LCGDALIDLDLTTAVKLHREKGAIATIITKTVPQELVSSYGVVVTDDNGKILTFQEKPAV
K9YNP6_CYASC          LCGDALIDLDLTEVVRRHKEKGAIATVITKSVPREAVSSYGVVVTDEDGKILTFQEKPSV
B7K9I4_GLOC7          LCGDALIDLDLTAAVKWHKEKGSIATIITKSVSKEEVSSYGVVVTDDDDRIKSFQEKPSV
B7JZQ9_RIPO1          LCGDALIDLDLTAAVQWHKEKGSIATVITKSVDREVVSSYGVVVTDEEGRIQTFQEKPSV
Q8YRP4_NOSS1          LCGDALIDLDLTAAVKWHKSKGSIATIITKTVPEEEVSSYGVVVTDENSRVKAFQEKPSI
Q3M7K7_TRIV2          LCGDALIDLDLTAAVKWHKSKGSIATIITKTVPEEEVSSYGVVVTDENSRVKAFQEKPSI
B2IX24_NOSP7          LCGDALIDLDLTAAVKWHRAKGSIATIITKSVPQEEVSSYGVVVTDEEGRVKAFQEKPST
K9ZJ56_ANACC          LCGDALIDLDLTAAVKWHKSKGAIATIITKSVPQEEVSSYGVVVTDEDNRVKAFQEKPST
A0ZD25_NODSP          LCGDALIDLDLSAAVKWHKSKGSIATIITKSVPLEEVSSYGVVVTDEDCRVIDFQEKPSQ
A0A1B7X7I1_APHFL      LCGDALIDLDLTAAVKWHKSKGAIATIITKSVPKEEVSSYGVVVTDEDNRIQAFQEKPTV
K9YUN6_DACSA          LCGDALIDLDLTEALKQHKEKGAIATVITKEVPKEKVSSYGVVVTDENNRITAFQEKPSV
B1XM99_SYNP2          LCGDALIDLDLTAAVRWHREKGAIATVITKSVPKEAVSSYGVVVTDDEDRILSFQEKPSV
Q8DL85_THEVB          LCGDALIDLDLTAAVAWHRQKGAIATVVMKTVPREDVSSYGVVVTDKSDRIVAFQEKPSV
K9SQY6_9SYNE          LCGDALIDLDLKAVVEWHKAKKSLATVVMKTVPKEEVSSYGVVVTDDDGRILDFQEKPSV
B4WFX1_SYNS7          LCGDALIDLDLTEAVRQHKEKNSIATIVMKQVPLKQVPSYGVVVTDESGKIKSFQEKPTV
A0A0H3K555_SYNP6      LCGDALIDLDLTEAVRWHKEKGALATIVMKTVPREEVSSYGVVVTDSDGRIQAFQEKPSV
Q2JQM7_SYNJA          LCGDALIDLNLTQVVNFHKSKGALATVVLREVDPSQVSSYGVVVTDATGRVTAFQEKPRQ
                      ******:**:*. .:  *:   ::*::: : *  . * .****::*    :  *****  

Q7V4E2_PROMM          DAALSDTINTGIYLFEPEIFEHIPSDQPFDIGSDLFPKLVEMGLPFFALPMDFEWVDIGK
Q0I6W7_SYNS3          EEALSDTINTGIYLFEPEIFEHIPSGTSFDIGADLFPTLVKQGAPFYALPMDFEWVDIGK
Q3AGZ6_SYNSC          NEALSDTINTGIYIFEPEVFEHIPSGQSFDIGSDLFPKLAELGAPFYAIPMDFEWVDIGK
Q7U410_PARMW          EEALSDTINTGIYIFEPGIFDHIPSGVSFDIGSDLFPKLAELGAPFYAIPMDFEWVDIGK
A8G2F7_PROM2          DQALSDSINTGIYLFEPEIFNYIPSAEKFDIGADLFPKLVEMDLPFFALPMDFEWVDIGK
A5GQH2_SYNR3          EEALSDEINTGIYLFEPEIFEHIPDGVSYDIGSQLFPKLVEKGLPFYALPMDFEWVDIGK
A0A0G8AU36_9SYNE      DEALSNAINTGIYIFDPEIFNHIPSGVHYDIGSDLFPKLVADGAPFYALPMDFEWVDIGK
CUGP_SYNY3            EEALSTEINTGIYIFEPEVIDYIPSGQEYDLGGDLFPKLVDSGLPFYAVNMDFEWVDIGK
K9YNP6_CYASC          EEALSTEINTGIYIFEPEVIDYIPPNQEYDIGGDLFPHLVELNLPFYAINMDFEWVDIGK
B7K9I4_GLOC7          EEALSTKINTGIYIFEPEVIDYIPSNQKYDIGGDLFPKLVEKNAPFYALNMDFEWVDIGK
B7JZQ9_RIPO1          EEALSTNINTGIYIFEPEIINYIPPNQKYDIGGELFPELVAKAAPFYAVNMDFEWVDIGK
Q8YRP4_NOSS1          EEALSTNINTGIYIFEPEVFNYIPSGVEYDIGGQLFPKLVEIGAPFYAIAMDFEWVDIGK
Q3M7K7_TRIV2          EEALSTNINTGIYIFEPEVFNYIPSGVEYDIGGQLFPKLVEIGAPFYAIAMDFEWVDIGK
B2IX24_NOSP7          EEALSTNINTGIYIFEPEVFNYIPSDVEYDIGSQLFPKLVEIKAPFYAIPMDFEWVDIGK
K9ZJ56_ANACC          EEALSTNINTGIYIFEPEVFNYIPSGVEYDIGGELFPKLVEINAPFYAIPMDFEWVDIGK
A0ZD25_NODSP          EEAISTNINTGIYIFEPEVFEYIPSGVEFDIGGQLFPKLVEVGAPFYAIAMDFEWVDIGK
A0A1B7X7I1_APHFL      EEALSTNINTGIYIFEPEVFKYIPSGVEYDIGSQLFPQLVADNASFYAIPMDFEWVDIGK
K9YUN6_DACSA          EEALSTQINTGIYILEPEAIAYIPSGQVYDLGSDLFPKLVERGAPFYSVPMNFQWVDIGK
B1XM99_SYNP2          TEALSTKINTGIYIFEPEVIDFIPPNCEFDIGGQLFPKLVAANAPFYALDMDFEWVDIGK
Q8DL85_THEVB          EEALSNHINTGIYIFEPEVIDYIPSNQEYDIGSQLFPKLVEMGAPFYGLAMDFEWIDIGK
K9SQY6_9SYNE          EEARSNNINTGIYIFEPEIFNYIPSGEQFDIGGDLFPKLVEANAPFYAIAMDFQWVDIGK
B4WFX1_SYNS7          EEALSTDINTGIYIFEPEVFNYIPSGQEFDIGGDLFPKLVDAGAAFYGIRMDFEWVDIGK
A0A0H3K555_SYNP6      EEALSTTINTGIYIFEPEILNYIPSGQEYDIGGDLFPKLVETGAPFYGISMDFQWIDIGK
Q2JQM7_SYNJA          EEALSNTINTGIYVFEPEVLDYIPPGCPYDIGSDLFPALVKAGAPFYGLKADFQWVDIGR
                        * *  ******:::*  : .**    :*:*.:*** *.    .*:.:  :*:*:***:

Q7V4E2_PROMM          VPDYWRAIRSVLQGEVRQVGIPGKEVRPGIYTGLNVAANWDKINVQGPIYVGGMTRIEDG
Q0I6W7_SYNS3          VPDYWQAIRSVLQGEVRQVGVPGKEVKPGVFTGLNVAANWDKINVEGPVYVGGMTKIEDG
Q3AGZ6_SYNSC          VPDYWQAIRSVLMGDVRQVGIPGKEVRPGVYTGLNVAANWDKINVSGPVYVGGMTKIEDG
Q7U410_PARMW          VPDYWQAIRSVLLGDVRQVGIPGKEIQPGVYTGLNVAANWDKINVSGPVYVGGMTKIEDG
A8G2F7_PROM2          VPDYWSAIRNVLLGKVRQVQIPGKEIKPGVFTGLNVAANWEKVNITGPVYIGGMTRIEDG
A5GQH2_SYNR3          VPDYWHAIRSVLQGDIRQVSIPGKQVRPGIYTGLNVAANWDKIEVEGPVYVGGMTKIEDG
A0A0G8AU36_9SYNE      VPDYWQAVRGVLQGKVRQVPIPGRQVRPGLYAGLNVAADWDSIMMEGPVFVGGMSHIEPG
CUGP_SYNY3            VPDYWQAIRGVLSREIKNVQIPGIEVRPGVYTGINVAANWDNIEIEGPVYIGGMTRIEDG
K9YNP6_CYASC          VPDYWEAIRSVLLGKIKNVQIPGKEVKPGIYTGVNVSINWDKVDITGPVYIGGMTHVEDG
B7K9I4_GLOC7          VPDYWHAIRGVLKREIKNVAIPGIEVKPGIFTGINVAVNWDKVEVSGPIYIGGMTKIEDG
B7JZQ9_RIPO1          VPDYWHAIRGVLQREIKNVEIPGVEVKPGIYTGLNVSVNWDKVNITGPVYIGAMTHIEDG
Q8YRP4_NOSS1          VPDYWRAIRGVLQGDIKNVQIPGHEVAPGIYTGLNVAVNWDKVDITGPVYIGGMTRIEDG
Q3M7K7_TRIV2          VPDYWRAIRGVLQGEIKNVQIPGHEVAPGIYTGLNVAVNWDKVDITGPVYIGGMTRIEDG
B2IX24_NOSP7          VPDYWRAIRGVLLGEIKNVQIPGHEVAPGIYTGLNVAVNWDKVDITGPVYIGGMTRIEDG
K9ZJ56_ANACC          VPDYWRAIRGVLLGEIKNVQIPGHEVAPGIYTGLNVAVNWDKVDITGPVYIGGMTRIEDG
A0ZD25_NODSP          VPDYWRAINGVLLGEIKNVQIPGNEVAPGIYTGLNVAVNWDKVDITGPVYIGGMTRIEDG
A0A1B7X7I1_APHFL      VPDYWRAIRGVLSGEIKNVQIPGHEVAPGIFTGLNVSVNWDKVDISGPVYIGGMTKIEDG
K9YUN6_DACSA          VPDYWHAVRGVLLGEIKNVEIPGKEVAPGVYTGLNVAVNWDKVNITGPVYIGGMTRIEDG
B1XM99_SYNP2          VPDYWQAIQSVLQGKIKNVPIPGIEVKPGVYTGLNVAVNWDKVEIQGPVYIGGMTRIEDG
Q8DL85_THEVB          VPDYWQAVRGVLNGTIKNVSIPGHEQFPGIYTGLNVAVNWDKVTIQGPVYIGGMTKIEDG
K9SQY6_9SYNE          VPDYWQAIQDVLMGKINNVKVPGYEVKPGIFTGLNVCVNWDKVDITGPVYIGAMTQIEDG
B4WFX1_SYNS7          VPDYWQAIQDVLTGQVRGVGIPGNEIRPGVFAGLNVKANWEAIEIEGPVYIGGMTQIEDG
A0A0H3K555_SYNP6      VPDYWQAIRSVLNGEVRNVAIPGKQVRPGVYTGLNVAIDWDSVAIEGPVYIGGMTRIDEG
Q2JQM7_SYNJA          TPDYWLAVQKVLRGEIKGVKVPGIQIRPGVWTGINIRANWDRIHIEPPVYIGASTYLADG
                      .**** *:. **   :. * :** :  **:::*:*:  :*: : :  *:::*. : :  *

Q7V4E2_PROMM          ATIIGPSMIGPSCCICEGATVDNSIIFDYSRIGAGVQLVEKLVFGRYCVGKNGDHFDLQE
Q0I6W7_SYNS3          ATLIGPTMIGPSCYICEGATIDNSIIFDYSRIGAGVQLVEKLVFGRYCVDKEGDHIDLQE
Q3AGZ6_SYNSC          ATIVGPTMIGPSCHICEGATVDNSIIFDYSRIGPGVQLLEKLVFGRYCVGKDGDHFDLQE
Q7U410_PARMW          ATIVGPAMIGPSCHICEGAVIDNSIIFDYSRIGAGVQLVEKLVFGRYCVGKDGDHFDLQE
A8G2F7_PROM2          ATIIGPTMIGPSCCICEGAIIDNSIIFDYSKIGKGVRLVDKLVFGKYCVGKNGDHFDLQD
A5GQH2_SYNR3          ARIIGPAMIGPSCHICAGATIDNSIIFDYSRIGAGVTLAEKLVFGRYCVDKTGDHLDVQE
A0A0G8AU36_9SYNE      ARLVGPAMIGPNCHICSGATVNNSIIFHHSRIGPNVTLVDKLVFGRYCVEKK--------
CUGP_SYNY3            VKIIGPSMIGPSCLICQGAVVDNSVIFEYSRLGPGARLVDKLVFGRYCVDKTGAAIDVQA
K9YNP6_CYASC          AKIVGPAMIGPNCWICEGATVDNSVIFEYSRLGTGVRLVDKLVFGRYCVDKKGTAIDVKE
B7K9I4_GLOC7          AKIIGPSMIGPNCWICSGATVENSVIFEYSRLGPGVRLVDKLVFGRYCVDKTGAAIDVQA
B7JZQ9_RIPO1          ATIIGPSMIGPNCWVCSGATVDNSVIFEYSRLGPGVRLVDKLVFGRYCVDKTGATIDVQA
Q8YRP4_NOSS1          AKIVGPAMIGPNCWICGEATVDNSVIFEWSRLGHGARLVDKLVFGRYCVDKTGAAIDVQA
Q3M7K7_TRIV2          AKIVGPAMIGPNCWICGEATVDNSVIFEWSRLGHGARLVDKLVFGRYCVDKTGAAIDVQA
B2IX24_NOSP7          AKIVGPAMIGPNCWICSGATVENSVIFEWSRLGPGVRLVDKLVFGRYCVDKTGAAIDVQA
K9ZJ56_ANACC          AKIVGPAMIGPNCWICSGATVDNSVIFEWSRLAPGVRLVDKLVFGRYCVDKTGAAIDVQA
A0ZD25_NODSP          AKIVGPAMIGPNCWICSGATVENSVIFEWSRLGPGVRLVDKLVFGRYCVDKTGDAIDVQA
A0A1B7X7I1_APHFL      AKIIGPSMIGPNCWICSGATVDNSVIFEWSRLAPGVRLVDKLVFGRYCVDKTGASIDVQA
K9YUN6_DACSA          ANIIGPAMIGPNCWICSGATVKNSVIFEYSRLGPKVRLVDKLVFGRYCVDKTGTTIDVQA
B1XM99_SYNP2          AKIIGPTMIGPSCWICAGATVESSVIFEYSRLGSGVRLKDKLVFGRYCVDKTGATIDLQK
Q8DL85_THEVB          ATIIGPTMIGPNCHICSGAVVDNCVIFEYSRLGSDVRLVDKLVFGRYCVDKTGTTIDLKA
K9SQY6_9SYNE          VKIVGPTMIGPNCHISTGADVERSVIFEYSRL-SDVHLVDKLVFGRYCVDKTGATIDLQA
B4WFX1_SYNS7          AKIVGPSMIGPNCMISSGTIIDKSVVFEYSRIGPDVRLVDKLVFGRYCVDKTGASIDVKA
A0A0H3K555_SYNP6      VRIVGPAMIGPNCHICKGATIENSVIFEYSRLGSGVRLVDKLVFGRYCVDRNGNAIDVQA
Q2JQM7_SYNJA          VKLIGPTAIGYGCVLNEGCTLDGSLIFNYTQIAAGVTLRHQMVMGRYCISSDGNAIDTEE
                      . ::**: ** .* :     :. .::*. :::   . * .::*:*:**:           

Q7V4E2_PROMM          AALDWLITDARRQDLVEPSPQQK------AMAELLGTDLTPAPS-----------
Q0I6W7_SYNS3          ASLDWLITDARRQDLVEPSPQQK------AMAELLGTDLTQAS------------
Q3AGZ6_SYNSC          ASLDWLITDARRQDLVEPSPQQK------AMAELLGTDLTQAAS-----------
Q7U410_PARMW          AALDWLITDARRQDLVEPSPQQK------AMAELLGTELTQAAS-----------
A8G2F7_PROM2          ASLDWLIADSRRSDLTEPSPQQK------AMAELLGTDLINIPD-----------
A5GQH2_SYNR3          ASLDWLITDARRLDLVEPSPEQK------ALAELLGSDLGNNLGEAS--------
A0A0G8AU36_9SYNE      -SLDWLITDARRKDLVEPSPEQK------AMADLLGAELNMVLPPTI--------
CUGP_SYNY3            AALDWLITDARHAAVQY-RQEYP------SQREISKLLQPE--------------
K9YNP6_CYASC          AALDWLITDSRQTSPSH-LERVK------AISELINFRY----------------
B7K9I4_GLOC7          AALDWLITDARQILPQENSQSLK------AIADLLNQGS----------------
B7JZQ9_RIPO1          AALDWLITDSRQKLPHEQHNQQQ------AIADLLNKAI----------------
Q8YRP4_NOSS1          AALDWLITDARQTPPEHTPVERQ------AIAELLGTNAT---------------
Q3M7K7_TRIV2          AALDWLITDARQTPPEHTPVERQ------AIAELLGTNAI---------------
B2IX24_NOSP7          AALDWLITDARQIPPSHTPVERQ------AIEELLGTNAS---------------
K9ZJ56_ANACC          AALDWLITDARQTPPAETPLEHQ------AIAELLGTNIN---------------
A0ZD25_NODSP          AALDWLITDARQTPPSETPFERQ------AIEDLLGTNVI---------------
A0A1B7X7I1_APHFL      AALDWLITDARQTRPSEIPLEHQ------AIAELLGANSI---------------
K9YUN6_DACSA          AALDWLITDSRQTPPKFELEEQE------AIAQLLMGE-----------------
B1XM99_SYNP2          AALDWWITDVRHAHPPTAPVKNPHVVESLEIEEFLNSSGLAEDCPQSPSSRPSSL
Q8DL85_THEVB          AALDWLITDSRQTDIQLSP---------LELKEMMS-------------------
K9SQY6_9SYNE          AALDWLITDARHPNNAVPPL-----------------------------------
B4WFX1_SYNS7          AALDWLITDTRQDIVAEPPIEHR------AIAELLNKTIAK--------------
A0A0H3K555_SYNP6      AALDWLITDARRAEPVQPSAEHQ------AIADLLGSNVLP--------------
Q2JQM7_SYNJA          SNLTWLIGDARSHANGKSQ------------------------------------
                        * * * * *