CLUSTAL format seed alignment for MF_02086

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

V8CKL4_9HELI          ---------------MSGEKKLAISIGDSNGVGCEIILRELEWVLYQCGQLPKQPSSTLD
T1CSF4_9HELI          MMKKSNLRGMHSRKKPHTKPHVAISIGDINGVGAEIALREHSFI----------------
Q7MAP7_WOLSU          -------------------MKIFVSIGDPNGIGLEIALRSHSGV----------------
A0A4U8S934_9HELI      -------------------MKIAISVGDPNGVGLEILLKNHKKV----------------
D1B2K3_SULD5          ------------------MKKIAISIGDLNGIGLEIALRAHDEV----------------
A0A5B9TRU8_SULMU      ------------------MKKIAISIGDLNGIGLEIALRSHNEV----------------
PDXA_CAMJE            ------------------MKKLAISIGDINSIGLEILVRSHEEL----------------
A5KG59_CAMJU          ------------------MKKLAISIGDINGIGLEILVRSHEEL----------------
B9KCG5_CAMLR          ------------------MKKIAISIGDLNGIGVQILLASHDEL----------------
PDXA_CAMFF            ----------------MSLPKIAISVGDINGVGIEIALKSHDEI----------------
A6Q3Y7_NITSB          -----------------MKPVIAISLGDFNGIGPEIALRCHDQI----------------
PDXA_SULDN            ----------------MSKVRIAISVGDLNGVGIEIAIKAHEEV----------------
B9L5H9_NAUPA          ------------------MQKVAVSIGDLNGVGIEIALKAHNII----------------
A8ESJ0_ARCB4          --------------MIKELPKIAISIGDLNGIGIEIALKCHNQI----------------
PDXA_HELAH            ----------------MVKKKIAISCGDIQGIGLELILKSHKEV----------------
PDXA_HELPS            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
PDXA_HELPJ            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
PDXA_HELPY            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
PDXA_HELP2            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
PDXA_HELPH            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
PDXA_HELPG            ----------------MAKKKIAISCGDIQGVGLELILKSHKEV----------------
Q7VHV2_HELHP          ------------------MPKVAISVGDVNGIGLEIALKAHHHI----------------
D3UFK7_HELM1          ---------------MRKKPKVAISIGDSNGIGGEILLSAHQKI----------------
E7ABT4_HELFC          -----------------MRAKIAISIGDANGIGLEIALKAHQHI----------------
F8KS88_HELBC          -----------------MKPKIAISIGDIQGIGLEIALKAHTHI----------------
                                           : :* ** :.:. :: :     :                

V8CKL4_9HELI          SSPSALCTPIICAHKSLLESALQTLLARGGV------------------ESKRASYIHCL
T1CSF4_9HELI          ---KTLCEPLYCVHKELMQNAAQ-LL-GVAF----------------------PNDMVFA
Q7MAP7_WOLSU          ---KDWGEIIYGVDERVLFEASQ-RL-GIEV----------------------PQDMECD
A0A4U8S934_9HELI      ---CKLCNPVYCVDKDLLKSAAK-KL-SLKI----------------------PKSLVCK
D1B2K3_SULD5          ---KKLCQPIYCINENMLGWGAA-LL-GLDV----------------------PLDFEIR
A0A5B9TRU8_SULMU      ---KKHCYPLYCINENMLGWGAA-LL-GLDV----------------------PSDFEIR
PDXA_CAMJE            ---SKICTPFYFIHESLLNKALK-LL-NLKL-FNAKIVAFKDDKDYEFNFIKKENSLEIY
A5KG59_CAMJU          ---SKICTPFYFIHESLLDKASK-LL-NLKL-FNAKIVAFKDGKDYEFNFVKKENSLEIY
B9KCG5_CAMLR          ---VKICEPYYFVHYKLFQKASK-LL-KLNTKSKINLVEISYANEPKFIFKEEKDNFLIY
PDXA_CAMFF            ---KNICSPIYFINNELLNSAAN-IL-KFTV----------------------PNDFEIF
A6Q3Y7_NITSB          ---KQSCTPLYFTNYKIIQQAAN-IL-KVQV----------------------PEDLEVE
PDXA_SULDN            ---SKLCAPLYCINSYMLNQAST-LL-NYKI----------------------PSNFEIS
B9L5H9_NAUPA          ---KQWVNPVYCINEKILKQAAK-LL-NIPI----------------------PDDFVTF
A8ESJ0_ARCB4          ---SKICQPIYCINNKMLTQASS-LL-KIRI----------------------PENFELF
PDXA_HELAH            ---SVLCEPLYLIHSELLGRANQ-LL-TNAY------------------EVKPLNAIAIN
PDXA_HELPS            ---SALCEPLYLIDSELLERANQ-LL-NNAY------------------ETKTLNTLAIN
PDXA_HELPJ            ---SALCEPLYLVHSELLERANQ-LL-DNAY------------------ETKTLNAIAID
PDXA_HELPY            ---SALCEPLYLTDGELLERANQ-LL-HNAY------------------ETKVLNALAID
PDXA_HELP2            ---NAFCEPLYLIDGELLERANQ-LL-HNAY------------------ETKTLNALAIH
PDXA_HELPH            ---SAFCEPLYLIDGELLERANQ-LL-HNAY------------------ETKTLNTLAIH
PDXA_HELPG            ---NAFCEPLYLIDGELLERANQ-LL-HNAY------------------ETKTLNTLAIH
Q7VHV2_HELHP          ---AQWCEPLYCVHREVLESAST-LL-DYPT----------------------PQDMQCV
D3UFK7_HELM1          ---SQYCMPIYCAKRELLDSMAE-ILHALPL----------------------PKNTSFS
E7ABT4_HELFC          ---NQTCQPIYCVHRELLEQANT-LL-DHAY-------------------THALETMQCA
F8KS88_HELBC          ---SQICTPLYCVHSQLLEQANA-LL-NNGY-------------------TQALENMACS
                                      ::       *                                  

V8CKL4_9HELI          LDIVRFEPPSLKPPPIHIAQITAQSGAYSFASFVRAVELASQDPHTAVLTLPIHKAAWKQ
T1CSF4_9HELI          P-------PKAKIPTIHIAKISKKSGAYSFESFITGLDLLDSAQAQAIITLPIHKAAWKK
Q7MAP7_WOLSU          --------PLGLESPIAPGVISKEAGRYSFESFKKGVERAKKGEVQAIVTLPVHKKAWSL
A0A4U8S934_9HELI      S-------PLIKLPKIIPGEINKDSGAYAYASFLQGLNLTLKRKTKALVTLPIHKKAWQL
D1B2K3_SULD5          --------DCGKVFEIEAGVCSAEAGESSYDSFITAVALAKSNEVSGIVTLPINKESWAM
A0A5B9TRU8_SULMU      --------DCGKVFEIEPGVCSAEAGESSYDSFITAVALAKSNEVSGIVTLPINKESWAM
PDXA_CAMJE            SFCLPLGFKVDENFEIQAGEIDAKSGLYGFLSFKAASYFVYEKHAHALLTLPIHKKAWED
A5KG59_CAMJU          SFYLPLGFKVDENFEIKAGEIDTKSGLYGFLSFKAASYFVYEKHAHALLTLPIHKKAWED
B9KCG5_CAMLR          DFSYQTSKEIDYDFELNPANLDAKSGAYSFLSFEGA-SYCTHLFLDALVTLPINKKTWQM
PDXA_CAMFF            --------ECGSSFNIKPGRVSKKSGKFSFVSFENAILYTQNKRAQALVTMPINKESWKK
A6Q3Y7_NITSB          --------YVKGDFIIKPGKVSKKSGAFSFRSFQKAVEFTASGICDALVTLPVHKEAWMK
PDXA_SULDN            --------EVGGEFAVKKGCVDKDSGRYSYDSFIHAISLCEQKKADAVVTMPIHKEAWML
B9L5H9_NAUPA          --------DVEGDFKIKPGIVDADAGKYSFESFMTAINLAKDKKVDAITTLPINKESWMR
A8ESJ0_ARCB4          --------KTKGDFEIKPGTVSKKSGKYSFNSFMDAINLANKKEVDAICTLPINKESWNK
PDXA_HELAH            S-------PLPSFNSSTIGKVSAQSGAYSFESFRKACELADDKEVDSICTMPINKLAWQQ
PDXA_HELPS            A-------PLPLLNSGTIGKVSAQSGAYSFESFKKACELADDKEVDGICTLPINKLAWQQ
PDXA_HELPJ            A-------PLPLLNSSTIGKVSTQSGAYSFESFKKACELADSKEVDGICTLPINKLAWQQ
PDXA_HELPY            A-------PLPLLNSSTIGKVSAQSGAYSFESFKKACELADSKEVDGICTLPINKLAWQQ
PDXA_HELP2            S-------PLPLLNSSTIGKISAQSGAYSFESFKKACELADSEEVDGICTLPINKLAWQQ
PDXA_HELPH            S-------PLPLLNSSTIGKVSAQSGAYSFESFKKACELADDKEVDGVCTLPINKLAWQQ
PDXA_HELPG            S-------PLPLLNSSTIGKVSAQSGAYSFESFKKACELADSKEVDGICTLPINKLAWQQ
Q7VHV2_HELHP          ADF-----ECLVDNLIKPSCISASSGKYSYESFLQGVSLVQSKQCVALVTLPIHKKAWQE
D3UFK7_HELM1          A-------PTAPLPEINPGSIASDSGLYSFESFGLACSLADHKEVDFLTTLPIHKYAWKK
E7ABT4_HELFC          E-------PTAPMPLIKPAQVDKSSGFYSYASFLHALDLADTKQISGVCTLPIHKKAWQL
F8KS88_HELBC          A-------PNAPKPTIKPAQVCQESGFYSFQSFLHALDLVDRQEAMGVCTLPIHKQAWQL
                                        .    .:*  .: **  .           : *:*::* :*  

V8CKL4_9HELI          AGVQYAGHTEYLRAHFK--------------QEVIMVLGCKQMLVALFCDHIPLARVSER
T1CSF4_9HELI          AGIDFVGHTEVLSARYD--------------KKAIMALGNQKMLVGLFSDHIPLKKVSQK
Q7MAP7_WOLSU          AGIPYAGHTEALREMMG--------------EEAIMMMGKEGFFIALYTDHLPLSEVPQR
A0A4U8S934_9HELI      AGIPYAGHTEALRDILKESLKKNGQLKKQEESQAIMMLGSPKLYVALFSDHIALKEISAR
D1B2K3_SULD5          AGLEYKGHTDALSDLLG--------------CEAIMMLGCEEMFTILYTHHIPLCDVPHE
A0A5B9TRU8_SULMU      AGLEYKGHTDALSDLLG--------------CEAIMMLGCEEMFTILYTHHIPLRDVPHE
PDXA_CAMJE            AGLKYKGHTDALRDFFK--------------KNAIMMLGCKELFVGLFSEHIPLAKVSKK
A5KG59_CAMJU          AGLKYKGHTDALRDFFK--------------KNAIMMLGCKELFVGLFSEHIPLAKVSKK
B9KCG5_CAMLR          AGVSYKGHTEALREFFK--------------QDAIMMLGCDELFVALYTEHIPLKDVYKQ
PDXA_CAMFF            AGVPYVGHTDALGKYFG--------------KNAIMMLGCEELFVALYTDHLALKDVSAK
A6Q3Y7_NITSB          ANIPYKGHTDYLRKRFK--------------KEAIMMLGCDKLFVALFTEHVPLKKVPGL
PDXA_SULDN            AGLKYKGHTDLLREHFK--------------RDAIMMLGCQKMFVALFSEHIPLKDVASS
B9L5H9_NAUPA          AGIKYKGHTEVLRDVFK--------------KDAIMMLGCEEMYVALFTEHIPLKNVADR
A8ESJ0_ARCB4          ADIKYKGHTEVLRDYFG--------------KHAIMMLGCEKMFVALFTEHIALKKVPKK
PDXA_HELAH            AQIPFVGHTDFLKQRYK-------------EHQIIMMLGCPKLFVGLFSDHVPLRAVSQL
PDXA_HELPS            AQIPFVGHTDFLKQRYK-------------DHQIIMMLGCFRLFVGLFSDHVPLGAVSQL
PDXA_HELPJ            AQIPFVGHTDFLKQRYK-------------DHQIIMMLGCSKLFVGLFSDHVPLSAVSQL
PDXA_HELPY            AQIPFVGHTDFLKQRYK-------------DHQIIMMLGCSKLFVGLFSDHVPLGAVSQL
PDXA_HELP2            AQIPFVGHTDFLKQRYK-------------EHQIIMMLGCSKLFVGLFSDHVPLSAVSQL
PDXA_HELPH            AQIPFVGHTDFLKQRYK-------------DHQIIMMLGCSKLFVGLFSDHVPLGAVSQL
PDXA_HELPG            AQIPFVGHTDFLKQRYK-------------DHQIIMMLGCSKLFVGLFSDHVPLGAVSQL
Q7VHV2_HELHP          ADISFVGHTHALSSIFN--------------MDSIMMLGCPSLFVALFTDHIALSQVSAC
D3UFK7_HELM1          AGIPFIGHTEYLRERYK--------------SEGIMMLGCEKMFVALFSDHIPLRDVSNH
E7ABT4_HELFC          AGVSAPGHTALLRDRYK--------------QEAIMMLGCPSLWVALFSDHIPLSAVSDR
F8KS88_HELBC          GGINTPGHTALLKERYQ--------------AEAIMMLGCPKLWVALFSDHIPLSAVSGC
                      . :   ***  *                      ** :*   :   *:  *:.*  :   

V8CKL4_9HELI          ISVESYKEFLCTLE-SS-------------------------------------------
T1CSF4_9HELI          ITASAYEKFLLLLF-QS-------------------------------------------
Q7MAP7_WOLSU          VHERGVEGFLRRLSHAL-------------------------------------------
A0A4U8S934_9HELI      IKVESLKNFLFAFA-PH-------------------------------------------
D1B2K3_SULD5          IKAKKLKPFLLKVY-EE-------------------------------------------
A0A5B9TRU8_SULMU      IKAKKLKPFLLKVY-EE-------------------------------------------
PDXA_CAMJE            ITFKNLSIFLKDFY-KE-------------------------------------------
A5KG59_CAMJU          ITFKNLSIFLKDFY-KE-------------------------------------------
B9KCG5_CAMLR          IKALRLAKFLIDFY-QC-------------------------------------------
PDXA_CAMFF            IKAKNLALFLVDFY-NS-------------------------------------------
A6Q3Y7_NITSB          IEKKRLTQFLIDFYHET-------------------------------------------
PDXA_SULDN            IKYKKLKQFFLDFN-NS-------------------------------------------
B9L5H9_NAUPA          VKKDNLIKFFIDFH-KS-------------------------------------------
A8ESJ0_ARCB4          INEEDLTKFLIDFY-KN-------------------------------------------
PDXA_HELAH            IQVKALVQFLLAFQ-KS-------------------------------------------
PDXA_HELPS            IQVKALVRFLLAFQ-KS-------------------------------------------
PDXA_HELPJ            IQVKALVKFLLAFQ-KS-------------------------------------------
PDXA_HELPY            IQVGALVKFLLAFQ-KS-------------------------------------------
PDXA_HELP2            IQVEALVKFLLAFQ-KS-------------------------------------------
PDXA_HELPH            IQVKELVKFLLAFQ-KS-------------------------------------------
PDXA_HELPG            IQVKALVKFLLAFQ-KS-------------------------------------------
Q7VHV2_HELHP          VTQERVRDFLLRFAQGV-------------------------------------------
D3UFK7_HELM1          LTTQKLSTFLLDFF-AC-------------------------------------------
E7ABT4_HELFC          VRLKPLAEFLYTLGGAL-------------------------------------------
F8KS88_HELBC          VQLEPLKKFLGTLGRVL-------------------------------------------
                      :       *:  .                                               

V8CKL4_9HELI          ------------------------------LDFTQALVLGFNPHCGDYGAIGGEEDALIQ
T1CSF4_9HELI          ------------------------------LQCEKALVLGFNPHCGDNGAIGGKEDSVIK
Q7MAP7_WOLSU          ------------------------------PAMKACGVLGLNPHAGDQGVLGKEEE-GIK
A0A4U8S934_9HELI      ------------------------------ILKTPCGVLGLNPHAGDFGVLGDEEN-AIR
D1B2K3_SULD5          ------------------------------LGEDKIAVLGLNPHAGDNGVIGGEEE-EIK
A0A5B9TRU8_SULMU      ------------------------------LGAERIAVLGLNPHAGDHGVIGDEDA-EIE
PDXA_CAMJE            ------------------------------THFKKMGLLGFNPHAGDYGVIGGEEEKIME
A5KG59_CAMJU          ------------------------------THFKKMGLLGFNPHAGDYGVIGGEEEKIME
B9KCG5_CAMLR          ------------------------------TLFEKIGVLAFNPHASDNGVIGGEEENEIK
PDXA_CAMFF            ------------------------------SKFENIGVLGFNPHASDNETIGGKEEKEII
A6Q3Y7_NITSB          ------------------------------TPAKPVAVLGLNPHAGDGGVLGDEER-IIK
PDXA_SULDN            ------------------------------VPNERVAVLGLNPHAGDNGVLGNEEL-IIT
B9L5H9_NAUPA          ------------------------------TNFHKVGVLGLNPHAGDGGVLGDEEINEII
A8ESJ0_ARCB4          ------------------------------VKSENIAVLGLNPHASDNGVLGDEEV-EIF
PDXA_HELAH            ------------------------------TQAQIIQVCGFNPHAGEEGLFGEEDE-KIL
PDXA_HELPS            ------------------------------TQAKIIQVCGFNPHAGEEGLFGKEDA-KIL
PDXA_HELPJ            ------------------------------TQAKIVQVCGFNPHAGEEGLFGEEDE-KIL
PDXA_HELPY            ------------------------------TQAKIVQVCGFNPHAGEEGLFGEEDE-RIL
PDXA_HELP2            ------------------------------TQAKIVQVCGFNPHAGEEGLFGKEDE-KIL
PDXA_HELPH            ------------------------------TQAKIVQVCGFNPHAGEEGLFGEEDE-KIL
PDXA_HELPG            ------------------------------TQAKIVQVCGFNPHAGEEGLFGKEDE-KIL
Q7VHV2_HELHP          ------------------------------NLNEPCCVLGLNPHCGDEGIMGVEDM-QIN
D3UFK7_HELM1          ------------------------------THFSPIAVLGLNPHCGDNGLIGKEDS-MIA
E7ABT4_HELFC          ------------------------------PQAREIVVLGIDPHCGDGGAIGVQDS-IVQ
F8KS88_HELBC          ------------------------------PKVEKIVVLGLDPHCGDGGAIGSQDL-IVQ
                                                           : .::**..:   :* ::   : 

V8CKL4_9HELI          AALDSANAAI--GRE-------------------------VFVG-VVAPDSAFTPAMRER
T1CSF4_9HELI          KAIQKVNARLTQEAQKQKIQKTNAQKTRAKTAQE------IFVG-PYPPDTAFIPHLRNE
Q7MAP7_WOLSU          RAIERANQAL--GRE-------------------------LFFG-PLVPDVAFIPSWRAK
A0A4U8S934_9HELI      EAITFVNTSL--GKE-------------------------VYIG-PLVPDTAFV---GKH
D1B2K3_SULD5          KAIAKANHFL--ERE-------------------------VFIG-PLVPDMAFTKANREK
A0A5B9TRU8_SULMU      KAILKVNHFL--ERE-------------------------VFVG-PLVPDIAFSKNNREN
PDXA_CAMJE            KAIAFVNAFLHSKKDEKFFKKALKDENLQKELLLNFKGKGVYLPYPLVADTAFTKTGLKN
A5KG59_CAMJU          KAIAFVNAFLHSKKDEKFFKKALKDENLQKELLLNFKGKGVYLPYPLVADTAFTKTGLKN
B9KCG5_CAMLR          KAIKMANVFL--KDSTLNLQNLENEDFLNQKEKELSYKENIFLSEPLVADSAFTPFALSK
PDXA_CAMFF            KAIKSANNRL--KKE-------------------------VFTG-PLVPDAAFTKSSLKR
A6Q3Y7_NITSB          KAIDKANEAI--KQE-------------------------IFFG-PVVPDVAFTSNFRKK
PDXA_SULDN            KAIKSANKKV--CFE-------------------------QFIG-PLVPDIAFTPHIREK
B9L5H9_NAUPA          PAINEANKIL--DKE-------------------------FYYG-PLVPDTAFCSRKGR-
A8ESJ0_ARCB4          KAIKKANKYF--QKD-------------------------IFKG-PMVPDTVFSPLSRKN
PDXA_HELAH            KAIQESNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRQI
PDXA_HELPS            KAIQKSNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRKI
PDXA_HELPJ            KAIQESNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRKI
PDXA_HELPY            KAIQKSNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRKI
PDXA_HELP2            KAIQKSNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRKI
PDXA_HELPH            KAIQKSNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRKI
PDXA_HELPG            KAIQKSNQTL--GFE-------------------------CFLG-PLPADSAFAPNKRQI
Q7VHV2_HELHP          AAVSEANMQL--GYE-------------------------IFFG-AYPPDSAFSPSNRER
D3UFK7_HELM1          QSILSANKIL--NRE-------------------------IFFG-PFSADSAFAPLMRER
E7ABT4_HELFC          EAIEKANIAL--KAP-------------------------KFLG-PIPADSAFAPHFREK
F8KS88_HELBC          EAIKRANQLL--GRA-------------------------LFVG-PIPADSAFAPHMRAR
                       .:   *  .                               :      .* .*       

V8CKL4_9HELI          FCVFVAPYHDVGLAPLKALYFDQSINISLNLPIVRTSVDHGVAFDIAY-Q--GI-ACTAS
T1CSF4_9HELI          FKVFVAPYHDIGLATLKALYFDSSINISLNLPIIRTSVDHGVAYDLAY-K--GI-CNTQS
Q7MAP7_WOLSU          FDHYVAMYHDQGLIALKILYFEESINLSLGLPFVRTSVDHGTAFDIAY-R--GGNPSLLS
A0A4U8S934_9HELI      LHYYVAMYHDQGLIPLKTLYFKESINITLNLPIIRTSVDHGTAFDIAY-Q--NK-AKSKS
D1B2K3_SULD5          FRYFVCMYHDQGLIPLKALYFDESINVSLNAGVVRTSVDHGTAFDIAY-K--DAHPSILS
A0A5B9TRU8_SULMU      FTYFVCMYHDQGLIPLKTLYFDESINVSLNAGVVRTSVDHGTAFDIAY-K--EGNPSCLS
PDXA_CAMJE            CNRLVAMYHDLALAPLKALYFDKSINVSLNLPIIRVSVDHGTAFDKAY-K--NAKINTKS
A5KG59_CAMJU          CNRLVAMYHDLALAPLKALYFDKSINVSLNLPIIRVA----------LIM--ARLDSYKM
B9KCG5_CAMLR          CKYLVSMYHDVGLAPLKALYFEKSINVSLNLPIIRTSVDHGTAYDKAY-K--NEKINLQS
PDXA_CAMFF            CNRLVSMYHDVGLAPLKALYFDKSINVSLNLPIVRTSVDHGTAFDIAY-K--GK-AETKS
A6Q3Y7_NITSB          LSHIVAMYHDQGLAPLKALYFDESINVSLNLPILRTSVDHGTAFDIAY-K--KM-ANTTS
PDXA_SULDN            FKYFIAMYHDQGLAPLKALYFDESINVSLNLPIIRTSVDHGTAFDIAY-E--KK-AKTLS
B9L5H9_NAUPA          ---FIAMYHDQGLAPLKALYFDESINVSLNLPILRTSVDHGTAFDIAY-K--GK-ANTKS
A8ESJ0_ARCB4          FKYFVAMYHDQGLAPLKALYFEESINVSLNLPIIRTSVDHGTAFNIAY-K--NENVNTQS
PDXA_HELAH            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRASTDHGTAFDIAY-Q--NK-ANNKS
PDXA_HELPS            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRASTDHGTAFDIAY-Q--NK-ANNKS
PDXA_HELPJ            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRASTDHGTAFDIAY-Q--NK-ANHKS
PDXA_HELPY            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRTSTDHGTAFDIAY-Q--NK-ANNKS
PDXA_HELP2            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRVSTDHGTAFDIAY-Q--NK-ANNKS
PDXA_HELPH            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRASTDHGTAFDIAY-Q--NK-ANNKS
PDXA_HELPG            TPFYVSMSHDVGLAPLKALYFDESINVSLNAPILRASTDHGTAFDIAY-Q--NK-ANNKS
Q7VHV2_HELHP          FRYFVSMYHDVGLAPLKALYFEQSINVSLNLPILRTSVDHGVAYDKAY-KKGSN-ISVQS
D3UFK7_HELM1          FSTFVALYHDVGLAPLKALHFYESINVTLNIPILRTSVDHGVGFDIAY-Q--NK-ADTRS
E7ABT4_HELFC          YRYFAALYHDVGLAPLKALYFEESINVSLNLPIRRASVDHGCAFDIAY-Q--NK-ASIKS
F8KS88_HELBC          YTHFVALYHDVGLAPLKALYFEESINVSLNLPIKRASVDHGCGFDIAY-Q--NK-ASPQS
                           .  ** .* .** *:* .***::*.  . *.:                       

V8CKL4_9HELI          FRNALHFALTSLQARI----------------------
T1CSF4_9HELI          YKNAVCMALELIQKQAKNKATKSNSKKEKNRHKKGIKK
Q7MAP7_WOLSU          YQNAIKMALKLGSDKR----------------------
A0A4U8S934_9HELI      YLNAIKEAVLRAKLQNEKAKIYC---------------
D1B2K3_SULD5          YVNAIKEAVKLANGKK-LLTF-----------------
A0A5B9TRU8_SULMU      YINAIKEAVKLSSGKEPLLTF-----------------
PDXA_CAMJE            YFEAAKFAINLHSKA-----------------------
A5KG59_CAMJU          Y-------------------------------------
B9KCG5_CAMLR          YMQAVKSALQFLKIKEKTK-------------------
PDXA_CAMFF            YIEAIKFAIKLCDY------------------------
A6Q3Y7_NITSB          YLNAVQYAISHLR-------------------------
PDXA_SULDN            YINAIKSAIALGERL-----------------------
B9L5H9_NAUPA          YENAIKYVLNHKTLM-----------------------
A8ESJ0_ARCB4          YINAIKEAINLIQNKK----------------------
PDXA_HELAH            YLNAIKYLSQRL--------------------------
PDXA_HELPS            YVNAIKYLA-----------------------------
PDXA_HELPJ            YLNAIKYLA-----------------------------
PDXA_HELPY            YLNAIKYLA-----------------------------
PDXA_HELP2            YLNAIKYLA-----------------------------
PDXA_HELPH            YLNAIKYLA-----------------------------
PDXA_HELPG            YLNAIKYLA-----------------------------
Q7VHV2_HELHP          YLNAVKYAINNV--------------------------
D3UFK7_HELM1          YINAILLGNQLKHNKAE---------------------
E7ABT4_HELFC          YCNVIYYLLA----------------------------
F8KS88_HELBC          YINAIRWLVSLSRDF-----------------------
                      :