CLUSTAL format seed alignment for MF_02089

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

QUEH_HAEIN        ---------------MNTELQPKLEKSAVNFQAKPRKQKIRKDPNAPFIREKLELPDGHN
QUEH_HAES1        ------------------MHRTKLEQKQPHFDAQKRRKKECKNSNTPFVRPKLELPHGHN
A8AFW8_CITK8      ---------------------------MLKFLKVSLLPKHPFMKNADFKRPQLTLPNGAD
B2VFG5_ERWT9      ------------------------------------------MSTP--QRDLLTLPNDAK
Q5GUN2_XANOR      -------------------------------------------MNATTERTPLPLPDGHT
QUEH_BORPE        --------------------------------------------MSQLVRPTLELPAGRR
QUEH_ACIAD        ---------------------------------------------MSKPRIKLKLPDNAD
Q5F8S8_NEIG1      ------------------------------------METQNKPTVTDIDRPILVPPGGHK
Q9JZI2_NEIMB      ------------------------------------METQNKPTVTDIDRPILVPPGGHK
Q83AB1_COXBU      MNKGCDLCMAGTIYQSASSSRLGRESAVFFTTPRTVLREKKGLIMINKNQTKLKLPNGAD
Q9ZCA9_RICPR      ------------------------------------------------MTEVFEIPNGEN
B2KCB6_ELUMP      ----------------------------------------------------------MK
R5BJK6_9BACT      -------------------------------MFVTEMPNGNIHKRGFVPELPGGCDLSGE
R6WWD8_9BACT      -------------------------------MFVTEMPNKNIHKKGFSPEPPEGCDLSKE
R6PX86_9BACT      ---------------------------------MKIQPEE--QYKFLKISLPDGVSANEH
G8QS62_SPHPG      -------------------------------------------MVAREILEMYSIGMDEN
F0RYF7_SPHGB      --------------------------------------------------------MEAR
QUEH_STAES        -----------------------MIEANQILAKMK-NQKINYDKVLRKIISQWERDGERP
Q5HL40_STAEQ      -----------------------MIEANQILAKMK-NQKINYDKVLRKIISQWERDGERP
QUEH_STAAM        -----------------------MINAEPIISKMK-NQKINYDKVLKKLIGQWEREAIRP
Q2FV28_STAA8      -----------------------MINAEPIISKMK-NQKINYDKVLKKLIGQWEREAIRP
Q9CFU8_LACLA      ----------------------MMENSLNIIEKMNPNQKINYDRVFQKVRESWERDSVRP
QUEH_STRP1        -----------------------MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRP
A8AZE0_STRGC      -----------------------MIDVEEILSKMNPNQKINYDRVMQKMVQDWEKDQKRP
Q8RG01_FUSNN      -------------------------------------MKINYDLKMEEILKEVTQSEKKK
Q97IR3_CLOAB      ------------------------------------MMKVNYQKKLDETIEEILKENKVP
Q73KU6_TREDE      ----------------------------------MMPQKINYDRLMQETIKNLGSNDK--
J9UQV3_BRAPL      ---------------------------------------------------------MKE
Q0PBN3_CAMJE      ------------------------------------------------------------
A7I314_CAMHC      ------------------------------------------------------------
A7GWE4_CAMC5      ------------------------------------------------------------
QUEH_HELPY        ------------------------------------------------------------
O66919_AQUAE      --------------------------------------------------------MKKS
D1B5R9_THEAS      -------------------------------------------------MGQSLRRPPKP
QUEH_THEMA        ----------------------------------------------------------MG
A6LML2_THEM4      ------------------------------------------------------------
A9BHS6_PETMO      -----------------------------------------------------------M
Q74E83_GEOSL      -----------------------------------------------------------M
B8IYX1_DESDA      ------MSGNIRSSVTNANGTAFGKPDFPEAADVHTPSLAATTPGGATPAAPEKLPRHSR
Q726Q0_DESVH      ----------------------------------------------------------MS
C4XPL5_DESMR      ---------------------------------------------------------MAG
F2N874_CORGP      ----------------------------------------------------------MR
C8W768_ATOPD      ----------------------------------------------MLQSIETLSIEPGT
C8WP64_EGGLE      -----------------------------------------------------------M
C7N4D8_SLAHD      -----------------------------------------------------------M
QUEH_DEHM1        ---------------------------------------------------------MAP
E4QC40_CALH1      ------------------------------------------------------------
B8FH14_DESAL      -----------------------------------------------------------M
B8E2P0_DICTD      --------------------------------------------------------MTDK
B5YKE8_THEYD      -----------------------------------------------------------M
L0HKR8_ACIS0      -----------------------------------------------------------M
                                                                              

QUEH_HAEIN        KLLLHSCCAPCSGEVMEAILASGI--EFTIYFYNPNIHPLKEYLIRKEENIRFAKKFG--
QUEH_HAES1        KLLLHSCCAPCSGEVMEAIHASGI--DFTIYFYNPNIHPLKEYLIRKEENIRFAEKWG--
A8AFW8_CITK8      KLLLHSCCAPCSGEVMEAIQASGI--DYTIFFYNPNIHPQKEYLIRKEENIRFAEKHG--
B2VFG5_ERWT9      KLLLHSCCAPCSGEVMEALQASGI--DYTIFFYNPNIHPQKEYLLRKEENIRFAEQHG--
Q5GUN2_XANOR      KVLLHSCCAPCSGEVMEAMLASGI--DYTIFFYNPNIHPRKEYELRKDENVRFAEQFG--
QUEH_BORPE        KVLLHSCCAPCSGEVMEAMTASGI--DYAIYFYNPNIHPVKEYEIRKNENIRFAEEHG--
QUEH_ACIAD        KLLLHSCCAPCSGEVMETLLYSGI--DYSIFFYNPNIHPVKEYLIRKEENIRFAEKHN--
Q5F8S8_NEIG1      KVLLHSCCAPCSGEVMEAMLASGI--GYTIYFYNPNIHPHKEYMLRKEENMRFAEKFG--
Q9JZI2_NEIMB      KVLLHSCCAPCSGEVMEAMLASGI--DYTIYFYNPNIHPHKEYMLRKEENVRFAEKFG--
Q83AB1_COXBU      RLLLHSCCAPCAGAIMEKLAASGI--HFTIFFYNPNIHPEKEYLIRKNENIRFAEKLG--
Q9ZCA9_RICPR      KVLLHCCCAPCVGPIMEKMIDSRI--EYTLFFYNPNIHPKKEYELRKNENIKFAKKHN--
B2KCB6_ELUMP      KTLLLSCCAPCSAAVIEKLTLEKK--AFSVLFYNPNIAPFEEYEKRKEENKKLCRKYN--
R5BJK6_9BACT      RILLHCCCAPCSTAIIEWMVGEGL--RPGIFFSNSNIVPFREYEIRRDELRRYAAAHG--
R6WWD8_9BACT      RILLHCCCAPCSTAIIEWMVGEGL--RPGIFFSNSNIVPFHEYSIRRDELCRYAAAHG--
R6PX86_9BACT      SVLLHACCAPCSAAIVECMLRNGI--RPTVYFSNSNIYPQQEFDIRKHELIRFLQQQD--
G8QS62_SPHPG      EILVHACCGPCSTASIERLLSEGW--KPVIFFSNSNIYPASEADKRFAELLKVADFFH--
F0RYF7_SPHGB      DILVHACCGPCSTASIERLLEDGW--NPVLYFSNSNIFPQEEAERRYEALLQVAHSYQ--
QUEH_STAES        KILLHSCCAPCSTYTLEFL-TQYA--DIAIYFANPNIHPKSEYLRRAKVQEQFVNDFNNK
Q5HL40_STAEQ      KILLHSCCAPCSTYTLEFL-TQYA--DIAIYFANPNIHPKSEYLRRAKVQEQFVNDFNNK
QUEH_STAAM        KILLHSCCAPCSTYTLEFL-TQYA--DIAIYFANSNIHPKNEYLRRAKVQEQFVEDFNRK
Q2FV28_STAA8      KILLHSCCAPCSTYTLEFL-TQYA--DIAIYFANSNIHPKNEYLRRAKVQEQFVEDFNRK
Q9CFU8_LACLA      KILLHSCCAPCSTYSLEYL-TQSA--DVTIYFANSNIHPSTEYTRRKMVQEQFVKDFNER
QUEH_STRP1        SILMHVCCAPCSTYTLEYL-TQFA--DITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAK
A8AZE0_STRGC      TILMHTCCAPCSTYTLEYL-SQYA--DVTIYFANSNIHPKAEYQRRAYVTQKFVSDFNEK
Q8RG01_FUSNN      RLLIHSCCGPCSSSVLEYL-KDYF--KIDIYYYNPNITFDYEYYARKQEQKDMLKKLN--
Q97IR3_CLOAB      SLLLHSCCAPCSTYVVEYL-SNYF--NITVFYYNPNIYPEDEYRRRVQEEKDFISEFNTK
Q73KU6_TREDE      TLLLHSCCAPCSSSVILKL-APFF--KLTVFYYNSNIDTSEEYEKRAEEQRHLISIYNEE
J9UQV3_BRAPL      KLVVHTCCAVCMCYPRTLL-EDY---DTVFYFYNPNIYPIEEYNRRRDEFIKFTKDNNIE
Q0PBN3_CAMJE      -MLVHICCSVDSHYFIEELRKTYPDEKIIGYFYDPNIHPLSEYELRFLDVKRSCDKLG--
A7I314_CAMHC      -MVVQICCAVDSSYFFRELKKLT-NESIIGYFYDPNIHPYSEFLLRFMEVKRDCKKLG--
A7GWE4_CAMC5      -MLVHICCSVDSHYFLRRLRADFPNERLVGYFYDPNIHPYSEFLMRFHDVKRSCGALG--
QUEH_HELPY        -MLIHICCSVDNLYFLKKAKEAFAGEKIVGFFYNPNIHPYSEYLLRLEDVKRTCEMLG--
O66919_AQUAE      KILVHICCAPDAIYFLKKLREDYPESEIIGYFYDPNIHPYEEYRLRYLETERICKELG--
D1B5R9_THEAS      KLLLHICCAPDATVPWPRLMEDF---MVTGYFYGSNVHPGDEYLLRARAVEALARHLD--
QUEH_THEMA        TVLIHVCCAPDLLTTIFHVRDAE------FFFYNPNIQPLSEYEKRREAVDKVANHFS--
A6LML2_THEM4      -MLLHVCCAPDLVAAYFHLKDKIK----YIYFYNPNIHPKGEYIKRLNEVKKLAKLWN--
A9BHS6_PETMO      KIFLHVCCAPDLTVSYRKLVEQGF--EPVVFFYNPNIYPLQEYSKRFEEVKKLRDIWG--
Q74E83_GEOSL      KLLLHICCAPCAIYPVSRLRDSGA--DVTGFFFNHNIHPYQEYRRRLDTVLEYADRIE--
B8IYX1_DESDA      SLLLHVCCGPCAIMPATRLLDEGF--AVTAWYMNPNIHPLSEYLRRRDAATECARHLG--
Q726Q0_DESVH      RLLLHVCCGPCSIATVRMLRDEGY--EVTGLFVNPNIHPLQEYLKRREAMQETAARLD--
C4XPL5_DESMR      RVLLHICCGPCAIAPLARLTEAGL--EVVGLFANDNIQPAAEWLRRRDGAAQVAARFG--
F2N874_CORGP      RLLLHACCAPCALEPLRALRAEGF--DPIICWANPNIQPPQESARRLEELRRWT--AR--
C8W768_ATOPD      PLLLHACCGPCSLEPLKHLREEGF--EPTICWTNPNIQPVEEHDKRLQTLLTWAK-EE--
C8WP64_EGGLE      KILLHACCGPCSLEPVRLLRAAGH--DLTIAYMNSNIAPADEYARRLSTLRAWA--AG--
C7N4D8_SLAHD      KLLLHACCGPCTLEPLRLLQEEGH--DISIAYMNSNIAPKAEYEHRLQTLLDYA--KT--
QUEH_DEHM1        KLLLHGCCAHCTAYSFKYWQEQGF--AVSVYWYNPNIHPFMEHQSRLEAMRKLSAEMG--
E4QC40_CALH1      ---MHTCCGPCSVYPLEKLSEEGH--EVFGLFFNPNIHPYTEFKNRLDSAKLFYDLRG--
B8FH14_DESAL      KILLNICCGPCSIYCLKVLREQGH--DVMGTFYRHNIHPFTECMKREYTLREYAAAQD--
B8E2P0_DICTD      RLFLHICCAPCLTYPLKRLREEGF--DITGFWYNPNIHPYTEYLMRLNTLKDFAEKQS--
B5YKE8_THEYD      RILLHTCCSNCAIYPYEVLKNKGF--DVVLFWYNPNIHPYTEYQLRLDSLKKLQKLWN--
L0HKR8_ACIS0      QLLMHACCAPCLAAPYKHLKNE-H--EITVFWYNPNIQPYREYLRRLKAFQEYTRRIG--
                     :  **.                      :   *:    *   *              

QUEH_HAEIN        ------IPFIDADYDRQN----WFDRAKGME-----------------------------
QUEH_HAES1        ------IPFIDADYDRQN----WFDRAKGME-----------------------------
A8AFW8_CITK8      ------VPFVDADYDTDN----WFERAKGME-----------------------------
B2VFG5_ERWT9      ------IPFVDADYDSDN----WFERAKGME-----------------------------
Q5GUN2_XANOR      ------VPFIDADYDRDN----WFERARGME-----------------------------
QUEH_BORPE        ------IEFIDADYDMDN----WFERVKGME-----------------------------
QUEH_ACIAD        ------IPFIDCDYDTDN----WFERAKGME-----------------------------
Q5F8S8_NEIG1      ------IPFIDKDDDYENDRKEWFAKAKGME-----------------------------
Q9JZI2_NEIMB      ------IPFIDKDDDYENDRKEWFAKAKGME-----------------------------
Q83AB1_COXBU      ------VPFVDADYDRDN----WLARAKGME-----------------------------
Q9ZCA9_RICPR      ------IEFIDADYDPQN----WFRRAKGME-----------------------------
B2KCB6_ELUMP      ------INFIELHYDNAA----WHEFIKGLE-----------------------------
R5BJK6_9BACT      ------LETIDDEYDHAA----WLAFVSRLETGVAADDC----------------PVARI
R6WWD8_9BACT      ------LETIDDEYDHAA----WLAFVRRLETIPVAESVEATNSGGAASHRQAQGPVIRI
R6PX86_9BACT      ------VPYVEDEYDHAD----WKKAIAGLE-----------------------------
G8QS62_SPHPG      ------LRVIREEQDHAS----WLSSVAGLE-----------------------------
F0RYF7_SPHGB      ------LQVIHERYDHES----WLQSIQGHE-----------------------------
QUEH_STAES        --TGASVKYIEAEYEPHK--FMKMAKDKGLT-----------------------------
Q5HL40_STAEQ      --TGANVKYIEAEYEPHK--FMKMAKDKGLT-----------------------------
QUEH_STAAM        --TGANVKYIEAPYEPHK--FVKMVKDKELA-----------------------------
Q2FV28_STAA8      --TGANVKYIEAPYEPHK--FVKMVKDKELA-----------------------------
Q9CFU8_LACLA      --TGNNVQFIAAEYEPNV--FLQMVRQKHLE-----------------------------
QUEH_STRP1        --TGNTVQFLEADYVPNE--YVRQVR--GLE-----------------------------
A8AZE0_STRGC      --TGYTVQYLEAPYAPQE--FFRKVH--GLE-----------------------------
Q8RG01_FUSNN      ----YDMNVIEGIYNPKED-FFEKIK--GLE-----------------------------
Q97IR3_CLOAB      ----YKVNFIEGDYETKR--FYECIQ--GFE-----------------------------
Q73KU6_TREDE      NLSSHKIEIIKEAYDPQE--FYEISQ--GLE-----------------------------
J9UQV3_BRAPL      IHIEENEEYIKDWYNDIK----------GFE-----------------------------
Q0PBN3_CAMJE      ------IKLYKGEYEYEK----WLNAVRGYE-----------------------------
A7I314_CAMHC      ------IKVYAGEYDFND----WLNGAKGLE-----------------------------
A7GWE4_CAMC5      ------IDLICGEYDYES----WLEGTKGLE-----------------------------
QUEH_HELPY        ------IELLEGDYELEK----FLDKAKGKE-----------------------------
O66919_AQUAE      ------INLIEGEYDLEN----WLERVKGYE-----------------------------
D1B5R9_THEAS      ------GDVLFEPYDPEG----WMDRTRRLE-----------------------------
QUEH_THEMA        ------LNVRYGEYSTEEIRKWYTAVKDYKDL----------------------------
A6LML2_THEM4      ------LKMIESKYNPDE---FFQYVKGLENL----------------------------
A9BHS6_PETMO      ------FQLYVGDYEPDK------FLERIKGK----------------------------
Q74E83_GEOSL      ------LPLEVRDE-YRLEEFLAAVAGNPA------------------------------
B8IYX1_DESDA      ------IPIVYDDASWDITAWLRAVAGRDAA-----------------------------
Q726Q0_DESVH      ------LPMIWRDDVYDVPAWLRGMAWREAP-----------------------------
C4XPL5_DESMR      ------VGL--RVDAYDPLPHMRRSLADPA------------------------------
F2N874_CORGP      ------ARIRLIETHEDTDAWERLVAPIGA------------------------------
C8W768_ATOPD      ------AHVEVIVAGDPREQWERAVAPQG-------------------------------
C8WP64_EGGLE      ------EQLDVLEGAYDPAAWEACAGRVGTAEG---------------------------
C7N4D8_SLAHD      ------QDIDVVEGVYDPKAWAREAGVIGP------------------------------
QUEH_DEHM1        ------FELITEPSYHMAEYFKNVSANVDG------------------------------
E4QC40_CALH1      ------KKLIVIDEY-PLEEFLRNCAFRENA-----------------------------
B8FH14_DESAL      ------LRMVWQQGY-EIEEFLRNAAFRETE-----------------------------
B8E2P0_DICTD      ------LPVVYEDDY-ALEEFIRQVVYREKD-----------------------------
B5YKE8_THEYD      ------LEVIYDADYSEFYKFLKLVSGREKE-----------------------------
L0HKR8_ACIS0      ------AKVIYDYSY-PLEEWLYRASILSKRS----------------------------
                                                                              

QUEH_HAEIN        -WEPERGIRCTMCFDMRFEKAAEYAHKHGFPVFTSCLGISRWKDMNQINGCGHRAA----
QUEH_HAES1        -DEPERGIRCTMCFDMRFEKAAQYAHENGFPVFTSCLGISRWKDMNQINGCGHRAA----
A8AFW8_CITK8      -WEPERGVRCTMCFDMRFERTALYAAEHGFSVISSSLGISRWKNMQQINDCGQRAA----
B2VFG5_ERWT9      -MEPERGVRCTMCFDMRFERTALYAWENDFPVISSSLGISRWKNMQQINDCGDRAA----
Q5GUN2_XANOR      -NEPERGVRCTMCFDMRFERTALYAHEHGFPVITSSLGISRWKNMQQINDCGVRAA----
QUEH_BORPE        -NEPERGIRCTACFDMRFERTALYAHEHGFDTITSSLGISRWKDMNQINGCGERAA----
QUEH_ACIAD        -NEPEKGIRCTMCFDMRFERAALYAYENGFKVFSSSLGISRWKNMEQINDCGIRAA----
Q5F8S8_NEIG1      -FEPERGIRCTMCFDMRFEKAAQYAHEHGFPVFTSSLGISRWKNMAQINDCGHRAA----
Q9JZI2_NEIMB      -FEPERGIRCTMCFDMRFEKAAQYAHEHGFPVFTSSLGISRWKNMAQINDCGHRAA----
Q83AB1_COXBU      -YEPERGARCTMCFDMRFERTALYAYENGFPIISSTLGISRWKNMDQINECGVRAA----
Q9ZCA9_RICPR      -FEQERGKRCTMCFDMRFERTALYAYENGFKVITSSLGISRWKDITQINESGIRAA----
B2KCB6_ELUMP      -REPERGERCKKCFLFRLKKAAIYAKENNFDSFTSVLGVSKYKKLEDVNQISVLLS----
R5BJK6_9BACT      ADMPERGPRCLECFKFRLLRAARYASSNGYRMLTTTLASSRWKDLAQVDAAGRWACDRVN
R6WWD8_9BACT      ADMPERGPRCLECFKFRLLRAARYAVANGYTLLTTTLASSRWKDLEQVDTAGRWACDVVN
R6PX86_9BACT      -NEPERGSRCSVCFQYRLHHAACYAQAHGFKWLTTTLASSRWKNIRQIDTAGMVAV----
G8QS62_SPHPG      -QEREGGKRCEKCFLYNLRQASAKAEELGFKHFCTTLTVSRFKNSKLIFDIGEQFP----
F0RYF7_SPHGB      -MEKEGGLRCEKCFAYNLSQAAAKAQALGFSHFTTTLTVSRFKNSKLIFAVGQQLE----
QUEH_STAES        -EEPEGGLRCTACFEMRLEIVAKAALEHGYDYFGSAITLSPKKNAQLINELGMDVQNIY-
Q5HL40_STAEQ      -EEPEGGLRCTACFEMRLEIVAKAALEHGYDYFGSAITLSPKKNAQLINELGMDVQNIY-
QUEH_STAAM        -DEKEGGLRCTACFEMRLDIVAKAAVEHGYDYFGSAITLSPKKNAQLINELGMDVQKIY-
Q2FV28_STAA8      -DEKEGGLRCTACFEMRLDIVAKAAVEHGYDYFGSAITLSPKKNAQLINELGMDVQKIY-
Q9CFU8_LACLA      -NEPEGGKRCTSCFEMRLDIVAEKALELGFDYFGSALTLSPKKNSQLINEIGLDIQKIY-
QUEH_STRP1        -EEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNSQTINDVGIDVQKVY-
A8AZE0_STRGC      -DEPEGGDRCKVCYDYRLDKTAEVAVELGFDYFGSALTISPHKNSQTINSVGIEVQKVY-
Q8RG01_FUSNN      -NEKEGGKRCYSCYDIRIRETAKKAKEEGYDFFSTVLSISPMKNVNYINEIGEKYSKEY-
Q97IR3_CLOAB      -KEREGGERCFKCYELRLLEAAKLAKNENYDYFTTTLSISPYKNAQKLNEIGERLSKEY-
Q73KU6_TREDE      -DCPEGGERCMRCYLLRLKKTAERAKKDGFDFFTSTLSVSPLKNAEKLNTIGLSLESE--
J9UQV3_BRAPL      -NEPEKGARCNICFKHRIAKAFEYADSINAKYVTTVMSVSPHKNSKAIEMIGSSIASKYD
Q0PBN3_CAMJE      -DEPEKGARCEICFDVRMGSSVKFAAKIGEKKLTTTLLTSPKKDLEQLKNALQKECEPY-
A7I314_CAMHC      -NEPEKGKRCQYCFDFRMSETAEFAKKIGEKKISTTLLMSPKKSHLQLVDSLKKICDEQ-
A7GWE4_CAMC5      -NEPEKGKRCVYCFEFRVGNSARKALEIGETSVTTTLLMSPKKDFAQLEAALNRAVAGT-
QUEH_HELPY        -LLGEKSERCFECFDLRLEASALKAFELGEEKFTTTLLTSPKKDPNQLIAKGQSIAQRH-
O66919_AQUAE      -DEPERGKRCQICFDYRLEKSAEVAKELGCDALTTTLLMSPKKSIPQLKKAGEEATKRT-
D1B5R9_THEAS      -GEVEGGGRCGLCFALQLLQCAKRAVAGGFDHMCTTLTISPHKDPAGINRIGFAVSSLF-
QUEH_THEMA        ---GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKT--IEEK
A6LML2_THEM4      ---GENSARCDKCIYLRLLNTANTAKKHNFTSFATTLTGSRKKILEKINNIGKI--VGEE
A9BHS6_PETMO      ---EHSPNRCYECMKLRLEKTKSEAKRMNFSIYSTTLLASPRKSHDDILEITDN--LDME
Q74E83_GEOSL      -------DRCWYCYFSRLDAAAAAAAAGGFDGFTSSLLYSRYQKHDDIRIAAER--AAAR
B8IYX1_DESDA      ------PQRCAYCCTSRIEAAFATAARLGFAFVSSSLLYSRYQPHEVIREAGARLAQAAD
Q726Q0_DESVH      ------ETRCRICYATRIETTLAVARHGGFDAFSTTLLYSRHQRHETIREVCEG--AAAD
C4XPL5_DESMR      -------GRCRPCWEERLARAAVVAREQGCDAFTSSLLYSRYQDHAAIAALGRA--AGEA
F2N874_CORGP      ---LDRTRRCRACYSLRLARACRVALDQGCTHVATTLAVSPYQLLDVCNEELER--LSRA
C8W768_ATOPD      ---FERDRRCRACYAIRLAESCRVAVERGFEYVSTTLAVSPYQLFDACEDELVS--IAHA
C8WP64_EGGLE      -DPARRKARCRACYRLRFEEASALAAEQGFDALGTTLSVSPYQYTDVIREELER--AASA
C7N4D8_SLAHD      -DPETRESRCRACYRLRLQEAAQYAADHGFDGLATTLTVSPYQYTEVIHEELVD--ACGT
QUEH_DEHM1        --------RCRICFDMRLGQTAAYAAGHGYEYFSSSLFISPHQKHQDAVCSAEA--LAKE
E4QC40_CALH1      --------RCIYCYSVRLERTALIAKKSGFDAFTTTLLVSPYQKHELIKELGEA--ISKK
B8FH14_DESAL      --------RCRYCYHSRLKAAAMIAKKGKFDAFTTTLLYSKFQKHELIREIGEA--LGKQ
B8E2P0_DICTD      --------RCPVCYYMRLKKTVEKAKELGFDLFSTTLLVSPYQKHDLIKEIANY--LANE
B5YKE8_THEYD      --------RCEICYRIRLEKTAEKAKVIGITDFTTTLLVSPYQKFDKIIKIGMQ--ISKN
L0HKR8_ACIS0      -----NVLRCKYCYAERLYKTAVKAKEIGFDAFTTTLLLAPYQKHELIREIGKS--IEKS
                          **  *    .      *         : :  :  :                 

QUEH_HAEIN        ---------------------EKYDDVIYWDYNWR-----KEGGSQRMIEISKRERFYQQ
QUEH_HAES1        ---------------------EKYDDVVYWDYNWR-----KGGGSQRMIEISKRERFYQQ
A8AFW8_CITK8      ---------------------AHYPGMAYWDYNWR-----KQGGSSRMIEISKREQFYQQ
B2VFG5_ERWT9      ---------------------APYPGISYWDYNWR-----KKGGSARMIEISKRERFYQQ
Q5GUN2_XANOR      ---------------------AKYPGLIYWEYNWR-----KGGGASRMIEISKRENFYQQ
QUEH_BORPE        ---------------------ARYDDLVYWTYNWR-----KGGGSQRMIEISKRENFYQQ
QUEH_ACIAD        ---------------------SHYPDIHYWDYNWR-----KNGGATRMLEISKREEFYQQ
Q5F8S8_NEIG1      ---------------------APYDDVAYWDFNWR-----KGGGGARMIEISKRENFYQQ
Q9JZI2_NEIMB      ---------------------APYDDVVYWDFNWR-----KGGGSARMIEISKRENFYQQ
Q83AB1_COXBU      ---------------------HKYPNMFYWTLNWR-----KQGGSQRMIELSKEENFYQQ
Q9ZCA9_RICPR      ---------------------SHYDGVTYWTYNWR-----KNGGASRIYEIAKEEHFYKQ
B2KCB6_ELUMP      ---------------------KEF-DILFDDTNWR-----KNGLEERRRELIKQENLYSQ
R5BJK6_9BACT      GTGGDGCAIGHGAETNAETHPSVRHEVLWWNQNWR-----RGGLQERRCALIKEWEMYNQ
R6WWD8_9BACT      GACDNESVIDLDSEVGPESLLSGRNKVLWWNQNWR-----RGGLQERRNALIKEWDMYNQ
R6PX86_9BACT      ---------------------SDCPDVEWWSQNWR-----KGGLQLRRSELLRLNEFYNQ
G8QS62_SPHPG      ---------------------------LFEKIDFK-----KKGGFDRSLVMSRDLDLYRQ
F0RYF7_SPHGB      ---------------------------GFECIDFK-----KKGGFEKSVQLSKELGIYRQ
QUEH_STAES        -------------------------NVKYLPSDFK-----KNKGYERSIEMCNDYNIFRQ
Q5HL40_STAEQ      -------------------------NVKYLPSDFK-----KNKGYERSIEMCNDYNIFRQ
QUEH_STAAM        -------------------------DVNYLPSDFK-----KSKGYERSIEMCNDYNIFRQ
Q2FV28_STAA8      -------------------------DVNYLPSDFK-----KSKGYERSIEMCNDYNIFRQ
Q9CFU8_LACLA      -------------------------DVNYLPSDFK-----KNNGYKRSVEMCKEYDVYRQ
QUEH_STRP1        -------------------------TTKYLPSDFK-----KNNGYRRSVEMCEEYDIYRQ
A8AZE0_STRGC      -------------------------ATHYLPSDFK-----KNQGYKRSVEMCEEYDIYRQ
Q8RG01_FUSNN      -------------------------DIPFLFADFK-----KKNRYLRSVQISKELNMYRQ
Q97IR3_CLOAB      -------------------------KVKYLYSDFK-----KKNGYKRSIELSNIYKLYRQ
Q73KU6_TREDE      -------------------------GCKWLPSDFK-----KRNGYLDSINLSKKYGLYRQ
J9UQV3_BRAPL      -------------------------NIEYLHIDFK-----KKDGFKKTNIIANEAGLYRQ
Q0PBN3_CAMJE      -------------------------GVEFLAPDFR-----KNGGTQRQFALAKKEMLYHQ
A7I314_CAMHC      -------------------------NLEFIAPDFR-----KNGGTNAQFALARDLKVYHQ
A7GWE4_CAMC5      -------------------------NLTPVAIDYR-----KNGGTNEQFELAKKDKLYHQ
QUEH_HELPY        -------------------------NLEFVVFRNDNFEHFKSELDLNLQALARENELYRQ
O66919_AQUAE      -------------------------GIEFLAPDYR-----KGGGTQEMFKLSKEREIYQQ
D1B5R9_THEAS      -------------------------GIRWVERVWR-----KGDGFKKSVSESRRLGLYRQ
QUEH_THEMA        Y------------------------GVKFFFKNFRKGG-----AYQEGVRLSKELGIYRQ
A6LML2_THEM4      E------------------------KVKYVETHFRKGI-----ESHLAARFIKENKIYRQ
A9BHS6_PETMO      E------------------------NPSFKYVNFRSNN-----GVHMAAQICKTYNIYRQ
Q74E83_GEOSL      H------------------------GVAFVYDDYRRG-------WQDGIRVSKEMGLYRQ
B8IYX1_DESDA      A------------------------GPDFVYRDFRAD-------WQEGIDRSKSLELYRQ
Q726Q0_DESVH      G------------------------PVSFVYRDFRTG-------WQEGIDTSRGWGIYRQ
C4XPL5_DESMR      A------------------------GVAFHYADYRTH-------WDEGVALSKDWGVYRQ
F2N874_CORGP      R------------------------GLVPVVRDFRPW-------YPRACLRSRELGMYRQ
C8W768_ATOPD      H------------------------GLTPVWRDFRPY-------YPEATKESRELGMYRQ
C8WP64_EGGLE      A------------------------GVQPLFEDYRPF-------YDEATHRSREMGMYRQ
C7N4D8_SLAHD      R------------------------GLKPVFHDYREQ-------YPEATRRSRALGMYRQ
QUEH_DEHM1        T------------------------GVRFAYADLRKR-------YSDSRHITKPLDLYRQ
E4QC40_CALH1      Y------------------------EIEFYYRDFREG-------FKEGRQKAREIGLYMQ
B8FH14_DESAL      Y------------------------SVPFYYHDFREG-------WKYGIEESKRLGMYRQ
B8E2P0_DICTD      Y------------------------KIEFYYEDFRVG-------YREGVNLSKEYGLYRQ
B5YKE8_THEYD      Y------------------------NINFIAEDFRKG-------FRKAMNTAQEIELYRQ
L0HKR8_ACIS0      T------------------------GIRFLYIDMRPW-------FEEGEELAKKAGIYRQ
                                                                      .   .: *

QUEH_HAEIN        EYCGCVYSLRDSNKWREETGRQKIEIGKLYYSAD--------------------------
QUEH_HAES1        EYCGCVYSLRDTNKWREANGRQKIEIGKLYYSADK-------------------------
A8AFW8_CITK8      EYCGCVYSLRDTNMHRKSQGRPLIKLGKLYYGKEGEEQ----------------------
B2VFG5_ERWT9      EYCGCVYSLRDTNLHRKSQGRPLIKLGVLYYGDDQAE-----------------------
Q5GUN2_XANOR      EYCGCVYSLRDTNRHRVDSGRKRIQLGVQFYGNDAQDD----------------------
QUEH_BORPE        EYCGCVYSLRDTNRHRRAQGRERIHLGVKFYGVEEKL-----------------------
QUEH_ACIAD        EYCGCVYSLRDTNRWRMSQGRDRIQLGVKFYSASDPD-----------------------
Q5F8S8_NEIG1      EYCGCAYSLRDSNAHRKSQGRIPVKLGVLYYGDESTQYEPAPVRVDK-------------
Q9JZI2_NEIMB      EYCGCAYSLRDSNAHRKSQGRIPIKLGVLYYGDESTQYEPAPIRVDK-------------
Q83AB1_COXBU      EYCGCVYSLRDTNRWRLKNGRSRIEIGLKFYGKNEPSKISQ-------------------
Q9ZCA9_RICPR      EFCGCIYSLRDTNAWRVANDRPKIDIGKEYY-----------------------------
B2KCB6_ELUMP      KYCGCVYSQNKKP-----------------------------------------------
R5BJK6_9BACT      TFCGCEFSERH-------------------------------------------------
R6WWD8_9BACT      TFCGCEFSERH-------------------------------------------------
R6PX86_9BACT      LYCGCEFSLAASKAMRNQDE----------------------------------------
G8QS62_SPHPG      QYCGCEFSMQH-------------------------------------------------
F0RYF7_SPHGB      QYCGCEFSMH--------------------------------------------------
QUEH_STAES        CYCGCVFAAMKQGIDFKQINKDAQAFLQQF------------------------------
Q5HL40_STAEQ      CYCGCVFAAMKQGIDFKQINKDAQAFLQQF------------------------------
QUEH_STAAM        CYCGCVFAAMQQGIDFKTVNKEAKAFLEQYPD----------------------------
Q2FV28_STAA8      CYCGCVFAAMQQGIDFKTVNKEAKAFLEQYPD----------------------------
Q9CFU8_LACLA      CYCGCIFAAKAQGIDLKEQNREAIKFIRNQS-----------------------------
QUEH_STRP1        CYCGCVYAAKMQGIDLVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM------------
A8AZE0_STRGC      CYCGCIFGAQDQGIDLVKVKKEATAFMAGKDLEKDYSHIKFTVID---------------
Q8RG01_FUSNN      EYCGCVFSKVEKEQRDREKAEKEKQEGKIKND----------------------------
Q97IR3_CLOAB      DYCGCIFSKNE---RNEEK-----------------------------------------
Q73KU6_TREDE      DYCGCKYSKR--------------------------------------------------
J9UQV3_BRAPL      HYCGCEFSIRN-------------------------------------------------
Q0PBN3_CAMJE      NYCGCIYGLKKQKQDK-NFIDELMSSVNKQILPVSIEARIALYKKVVLWEKKGIKFEILR
A7I314_CAMHC      NYCGCIYALRAQRKE--SEIFELMSPVNRQILPNSIEDKIRLYRKISKLEKKGIKFEILR
A7GWE4_CAMC5      NYCGCVFGLSKQRDAQGLPIAELMSDVCGRALPGSIDERLGLYERVRGCEERGERFHLSR
QUEH_HELPY        NYCGCQFALKIQKESQNRSPFELYSPLKRQILPASIEERTQVFRTLDMAKKDANKPFLAQ
O66919_AQUAE      DYCGCIYGLFKQKNGK--IFWDLVGFLGRR--PGSKEERNFIKEIRIFAEENSFPVKEYE
D1B5R9_THEAS      RWCGCLWSMGGV------------------------------------------------
QUEH_THEMA        NYCGCVFSLLERREKHAEISRK-RGHM---------------------------------
A6LML2_THEM4      NYCGCIFSKIENEEKIKKLKEK-AKEKLKEMGLEYLQPFPETFKITKSSPKEIIENLKEV
A9BHS6_PETMO      NYCGCSFSLEESKRYEEESKQKNYKSLVEILGEELTQKYFKYYKKDLLRIPQDIPAKFLE
Q74E83_GEOSL      QYCGCIYSEKDRYHPRQGKK----------------------------------------
B8IYX1_DESDA      PYCGCIYSEAERYEKKLARLIKNNL-----------------------------------
Q726Q0_DESVH      QWCGCIYSENERHAADFSKATGRRPDSRRRAEGPVSSPPSGGGRTGRSPAQRG-------
C4XPL5_DESMR      PYCGCVLSELDRYAKKLRRPPVIDG-----------------------------------
F2N874_CORGP      RYCGCRFSAAEAALGRARMREQRRAARDGAGRDGG-------------------------
C8W768_ATOPD      NYCGCRYSAAEAQIERHEARDARKAARHAN------------------------------
C8WP64_EGGLE      NYCGCRFSDVEAATERAERKAQRAAAREAEAAAHAEERAAAETARAAKKAERAAYDAKQA
C7N4D8_SLAHD      DYCGCAYSKVEADTERAERAAERARKKAEHDAEMAPIRAAQEAERKRKRAEKQAYAEKRA
QUEH_DEHM1        QYCGCVYSEYERFGKPNSPA----------------------------------------
E4QC40_CALH1      KYCGCIYSEKERFYKRKNDKDLKAFEENLLL-----------------------------
B8FH14_DESAL      QYCGCIYSEKDRYYNAKKDQEAR-------------------------------------
B8E2P0_DICTD      KYCGCIYSEKDRYYKGGKK-----------------------------------------
B5YKE8_THEYD      KYCGCIYSEAERYLKKIDYE----------------------------------------
L0HKR8_ACIS0      GYCGCIFSEADRYWRDDP------------------------------------------
                   :***  .                                                    

QUEH_HAEIN        ------------------------------------------------------------
QUEH_HAES1        ------------------------------------------------------------
A8AFW8_CITK8      ------------------------------------------------------------
B2VFG5_ERWT9      ------------------------------------------------------------
Q5GUN2_XANOR      ------------------------------------------------------------
QUEH_BORPE        ------------------------------------------------------------
QUEH_ACIAD        ------------------------------------------------------------
Q5F8S8_NEIG1      ------------------------------------------------------------
Q9JZI2_NEIMB      ------------------------------------------------------------
Q83AB1_COXBU      ------------------------------------------------------------
Q9ZCA9_RICPR      ------------------------------------------------------------
B2KCB6_ELUMP      ------------------------------------------------------------
R5BJK6_9BACT      ------------------------------------------------------------
R6WWD8_9BACT      ------------------------------------------------------------
R6PX86_9BACT      ------------------------------------------------------------
G8QS62_SPHPG      ------------------------------------------------------------
F0RYF7_SPHGB      ------------------------------------------------------------
QUEH_STAES        ------------------------------------------------------------
Q5HL40_STAEQ      ------------------------------------------------------------
QUEH_STAAM        ------------------------------------------------------------
Q2FV28_STAA8      ------------------------------------------------------------
Q9CFU8_LACLA      ------------------------------------------------------------
QUEH_STRP1        ------------------------------------------------------------
A8AZE0_STRGC      ------------------------------------------------------------
Q8RG01_FUSNN      ------------------------------------------------------------
Q97IR3_CLOAB      ------------------------------------------------------------
Q73KU6_TREDE      ------------------------------------------------------------
J9UQV3_BRAPL      ------------------------------------------------------------
Q0PBN3_CAMJE      EKFLNYRLLSALIKLDKK--PVKSHILFYSHFKNAYTRFSLDEENLKQNLKEGFYRSTKD
A7I314_CAMHC      DKFINYRLLSFVIKFDGI--AQNSVVLFNSHFKLNFVKFMIPDKCHK-------FFSDKE
A7GWE4_CAMC5      KYFLNYRLLRALVKFNGR--VVASYFLQYSNFKRENVKFSVSEAACV-------CDELRE
QUEH_HELPY        KTIATYRLLNGGVWLSKNSNPLNCCILARSKSK-AKVRINDLRWVFSQRLSVLVGYSQRD
O66919_AQUAE      FPFLNWKVLKGKIEVDGEVIPSYVYPYSQSIRGIVKGKVEHVHGDKLFLNKQFVRIILKE
D1B5R9_THEAS      ------------------------------------------------------------
QUEH_THEMA        ------------------------------------------------------------
A6LML2_THEM4      LKLTRPKLLYIDTYVMKKFNLKEGWNRLGNYNQKIKLIKESL------------------
A9BHS6_PETMO      KVGLQFFKYLKPQIILIKKEIAQDFNIFTSSRYKIDNWKGKVILW---------------
Q74E83_GEOSL      ------------------------------------------------------------
B8IYX1_DESDA      ------------------------------------------------------------
Q726Q0_DESVH      ------------------------------------------------------------
C4XPL5_DESMR      ------------------------------------------------------------
F2N874_CORGP      ------------------------------------------------------------
C8W768_ATOPD      ------------------------------------------------------------
C8WP64_EGGLE      RKRAVLKALRDQERDEG-------------------------------------------
C7N4D8_SLAHD      AQRAALKAYKQAHAND--------------------------------------------
QUEH_DEHM1        ------------------------------------------------------------
E4QC40_CALH1      ------------------------------------------------------------
B8FH14_DESAL      ------------------------------------------------------------
B8E2P0_DICTD      ------------------------------------------------------------
B5YKE8_THEYD      ------------------------------------------------------------
L0HKR8_ACIS0      ------------------------------------------------------------
                                                                              

QUEH_HAEIN        ------------------------------------------------------------
QUEH_HAES1        ------------------------------------------------------------
A8AFW8_CITK8      ------------------------------------------------------------
B2VFG5_ERWT9      ------------------------------------------------------------
Q5GUN2_XANOR      ------------------------------------------------------------
QUEH_BORPE        ------------------------------------------------------------
QUEH_ACIAD        ------------------------------------------------------------
Q5F8S8_NEIG1      ------------------------------------------------------------
Q9JZI2_NEIMB      ------------------------------------------------------------
Q83AB1_COXBU      ------------------------------------------------------------
Q9ZCA9_RICPR      ------------------------------------------------------------
B2KCB6_ELUMP      ------------------------------------------------------------
R5BJK6_9BACT      ------------------------------------------------------------
R6WWD8_9BACT      ------------------------------------------------------------
R6PX86_9BACT      ------------------------------------------------------------
G8QS62_SPHPG      ------------------------------------------------------------
F0RYF7_SPHGB      ------------------------------------------------------------
QUEH_STAES        ------------------------------------------------------------
Q5HL40_STAEQ      ------------------------------------------------------------
QUEH_STAAM        ------------------------------------------------------------
Q2FV28_STAA8      ------------------------------------------------------------
Q9CFU8_LACLA      ------------------------------------------------------------
QUEH_STRP1        ------------------------------------------------------------
A8AZE0_STRGC      ------------------------------------------------------------
Q8RG01_FUSNN      ------------------------------------------------------------
Q97IR3_CLOAB      ------------------------------------------------------------
Q73KU6_TREDE      ------------------------------------------------------------
J9UQV3_BRAPL      ------------------------------------------------------------
Q0PBN3_CAMJE      EIVLVEFWRFNAFFKNKWKNFEDFLKKPLSVQAEIKWRNKLFGTYN--------------
A7I314_CAMHC      QIKILNFKEFCKISNVKFKNFDEFAACPLSVKKELKIRKKIVGAGS--------------
A7GWE4_CAMC5      GVTLLNLAKFNELAGAKFASVRELCRKPLGVEAELKLRRELCGEFS--------------
QUEH_HELPY        ETLFLTLEGLNTLMAKNYDNLKELNLNPLNYEEELSLRALVSGSES--------------
O66919_AQUAE      PFGDVPLLENTPLSNPTFIVPYAYREKILKGKVKAELQTEFMPEKSSVLFIGSPSAKELW
D1B5R9_THEAS      ------------------------------------------------------------
QUEH_THEMA        ------------------------------------------------------------
A6LML2_THEM4      ------------------------------------------------------------
A9BHS6_PETMO      ------------------------------------------------------------
Q74E83_GEOSL      ------------------------------------------------------------
B8IYX1_DESDA      ------------------------------------------------------------
Q726Q0_DESVH      ------------------------------------------------------------
C4XPL5_DESMR      ------------------------------------------------------------
F2N874_CORGP      ------------------------------------------------------------
C8W768_ATOPD      ------------------------------------------------------------
C8WP64_EGGLE      ------------------------------------------------------------
C7N4D8_SLAHD      ------------------------------------------------------------
QUEH_DEHM1        ------------------------------------------------------------
E4QC40_CALH1      ------------------------------------------------------------
B8FH14_DESAL      ------------------------------------------------------------
B8E2P0_DICTD      ------------------------------------------------------------
B5YKE8_THEYD      ------------------------------------------------------------
L0HKR8_ACIS0      ------------------------------------------------------------
                                                                              

QUEH_HAEIN        ------------------------------------------------------------
QUEH_HAES1        ------------------------------------------------------------
A8AFW8_CITK8      ------------------------------------------------------------
B2VFG5_ERWT9      ------------------------------------------------------------
Q5GUN2_XANOR      ------------------------------------------------------------
QUEH_BORPE        ------------------------------------------------------------
QUEH_ACIAD        ------------------------------------------------------------
Q5F8S8_NEIG1      ------------------------------------------------------------
Q9JZI2_NEIMB      ------------------------------------------------------------
Q83AB1_COXBU      ------------------------------------------------------------
Q9ZCA9_RICPR      ------------------------------------------------------------
B2KCB6_ELUMP      ------------------------------------------------------------
R5BJK6_9BACT      ------------------------------------------------------------
R6WWD8_9BACT      ------------------------------------------------------------
R6PX86_9BACT      ------------------------------------------------------------
G8QS62_SPHPG      ------------------------------------------------------------
F0RYF7_SPHGB      ------------------------------------------------------------
QUEH_STAES        ------------------------------------------------------------
Q5HL40_STAEQ      ------------------------------------------------------------
QUEH_STAAM        ------------------------------------------------------------
Q2FV28_STAA8      ------------------------------------------------------------
Q9CFU8_LACLA      ------------------------------------------------------------
QUEH_STRP1        ------------------------------------------------------------
A8AZE0_STRGC      ------------------------------------------------------------
Q8RG01_FUSNN      ------------------------------------------------------------
Q97IR3_CLOAB      ------------------------------------------------------------
Q73KU6_TREDE      ------------------------------------------------------------
J9UQV3_BRAPL      ------------------------------------------------------------
Q0PBN3_CAMJE      --------------------------------LSPIIILENILPSRYEVIAKSEIYHDNQ
A7I314_CAMHC      --------------------------------FSPIIIVDKIPRAKCEISANSKIYIDIR
A7GWE4_CAMC5      --------------------------------QNPIIVLDEIPVGRYEIYAKNVLYNDSR
QUEH_HELPY        --------------------------------INPIIVLEERTEKTLFVEIKSVFQEEKV
O66919_AQUAE      GVPADTLQDGRGVSKEEVIELIENNGEKIMKEEVGLIILGAESLRGGSSFVKDFLGREVK
D1B5R9_THEAS      ------------------------------------------------------------
QUEH_THEMA        ------------------------------------------------------------
A6LML2_THEM4      ------------------------------------------------------------
A9BHS6_PETMO      ------------------------------------------------------------
Q74E83_GEOSL      ------------------------------------------------------------
B8IYX1_DESDA      ------------------------------------------------------------
Q726Q0_DESVH      ------------------------------------------------------------
C4XPL5_DESMR      ------------------------------------------------------------
F2N874_CORGP      ------------------------------------------------------------
C8W768_ATOPD      ------------------------------------------------------------
C8WP64_EGGLE      ------------------------------------------------------------
C7N4D8_SLAHD      ------------------------------------------------------------
QUEH_DEHM1        ------------------------------------------------------------
E4QC40_CALH1      ------------------------------------------------------------
B8FH14_DESAL      ------------------------------------------------------------
B8E2P0_DICTD      ------------------------------------------------------------
B5YKE8_THEYD      ------------------------------------------------------------
L0HKR8_ACIS0      ------------------------------------------------------------
                                                                              

QUEH_HAEIN        -------
QUEH_HAES1        -------
A8AFW8_CITK8      -------
B2VFG5_ERWT9      -------
Q5GUN2_XANOR      -------
QUEH_BORPE        -------
QUEH_ACIAD        -------
Q5F8S8_NEIG1      -------
Q9JZI2_NEIMB      -------
Q83AB1_COXBU      -------
Q9ZCA9_RICPR      -------
B2KCB6_ELUMP      -------
R5BJK6_9BACT      -------
R6WWD8_9BACT      -------
R6PX86_9BACT      -------
G8QS62_SPHPG      -------
F0RYF7_SPHGB      -------
QUEH_STAES        -------
Q5HL40_STAEQ      -------
QUEH_STAAM        -------
Q2FV28_STAA8      -------
Q9CFU8_LACLA      -------
QUEH_STRP1        -------
A8AZE0_STRGC      -------
Q8RG01_FUSNN      -------
Q97IR3_CLOAB      -------
Q73KU6_TREDE      -------
J9UQV3_BRAPL      -------
Q0PBN3_CAMJE      EVLVKI-
A7I314_CAMHC      EILVRIR
A7GWE4_CAMC5      EVLVVE-
QUEH_HELPY        FYLL---
O66919_AQUAE      LILEWK-
D1B5R9_THEAS      -------
QUEH_THEMA        -------
A6LML2_THEM4      -------
A9BHS6_PETMO      -------
Q74E83_GEOSL      -------
B8IYX1_DESDA      -------
Q726Q0_DESVH      -------
C4XPL5_DESMR      -------
F2N874_CORGP      -------
C8W768_ATOPD      -------
C8WP64_EGGLE      -------
C7N4D8_SLAHD      -------
QUEH_DEHM1        -------
E4QC40_CALH1      -------
B8FH14_DESAL      -------
B8E2P0_DICTD      -------
B5YKE8_THEYD      -------
L0HKR8_ACIS0      -------