CLUSTAL format seed alignment for MF_02090

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NADE_MYCBO        -------MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDG-AALAVFPE
NADE_MYCTO        -------MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDG-AALAVFPE
NADE_MYCTU        -------MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDG-AALAVFPE
NADE_MYCLE        -------MDFYNSYSQGFVRVAACTHHASIGDPTTNAASVLRLARQCHDDG-VAVAVFPE
A0R143_MYCS2      -------MDFFSAYRHGFARLAACTHHTSLADPPANAESVLRLAQACHDDG-VAVAVFPE
Q89LJ7_BRADU      -------MTFHSIYAHGFARVAACVTTSHVADPSANAKAILAAANACHEQS-AAVAVFPE
Q9A2E6_CAUVC      ----MGSPSFFSPYRHGFVRVATAVPKVKLADPAANAQNVVALAREAHAEG-VAVVVFPE
A9W9W6_CHLAA      ------MQPFFSIYRHNLARLAVAIPAVRIAEPVFNAERTIALARRAAAEG-AILVLFPE
Q8ABA5_BACTN      -------------MNYGFVKVAAAVPHVKVADCKFNVERIESQIAIAEGKG-VQIIVFPE
Q97K69_CLOAB      -------------MNHSFVKISSACPKTNVADVDFNVKNIKLCIDKALADN-SKVVVFPE
Q97I71_CLOAB      ---------MQMKKDFGYIRVGVASCELKVANPNYNVKSIISIMKKAYRRHHIKVLVFPE
Q7URG9_RHOBA      MTSSNELTFPKQRRQHGFYRIAAVSPKVVVADPAANAAETIQAMDAVVQQSDPDLILFPE
NADE_SYNY3        -----------------MFTIALAQLNPTIGAIAENAEKIVTAALQ-AQARGADLLLTPE
Q8DJP2_THEEB      ----------------MAVHLWIAQLNSTVGSLRTNAEAIASAVQEICSQHPVDLVITPE
Q7VA68_PROMA      ------------------MRLSLAQLNPLIGDLSGNSKKIIAACKD-AYKNNANLLITPE
Q7NHF0_GLOVI      ------------------MRVALLQLNSTVGDLVGNAGRIERAARE-AAAAGADLAITHE
Q2S5I3_SALRD      ------------------MQIALAQINPTIGDLEGNREKILDYARR-ADDRGADLVVFPE
Q1INM5_KORVE      ---------MFAGRYTGFVKIALGQINPTVGDFVGNAEKIVHYAAR-ARTAGAEVILFPE
NADE_AQUAE        -----------------MLNLTLAQLNFTVGDVEGNKEKILKVIDEYSEK--SHIIAFPE
NADE2_THEMA       ---------------MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDR-GSDLLVFPE
B5YJ78_THEYD      ---------------MKKIRLALCQINPIVGDIEGNFSKILSFKEKAVKE-KADIIVFPE
NADE_XYLFT        --------------MSEFLRIAMAQFDFPVGAVAQNAERIIALIEQARDEHGADVVMFPE
NADE_XYLFA        --------------MSEFLRIAMAQFDFPVGAVAQNAERIIALIEQARDEHGADVVMFPE
Q5H2H2_XANOR      --------MMESAVTAHTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPE
NADE_RHOCA        --------------MTDRFRITLAQLNPTVGALAANAEKAMAAWQAGRAA-GADLVALPE
Q3J3Z6_RHOS4      --------------MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAA-GSDMLALTE
A9CIT1_AGRFC      --------MSDRHDIQNHLRIAVGQFNPTVGDVAGNLARAREARADAATQ-GADLLLLTE
Q63W64_BURPS      ------MARGGRADPVMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDA-GAHLLIAPE
Q6MGT5_BDEBA      ------------------MRIAVAQINPVLADFQFNKEKILDFVNQAVQR-KCDLVVFPE
Q18H53_HALWD      --------------MSLPIKIAIVQHNPIVGDVSGNCTQIIEAYEQATDA-GVGLIITPE
D8IX05_HERSS      -----------------MLRIAIAQCNPTIGDFEGNLALHLDGLQRAAQA-GADLVVFPE
C9LUR9_SELS3      -------------------------MEIQPGRPDANTANILRQMEEAKAN-HADIVIFPE
A4J4I7_DESRM      ----------------MKLKIMIGQMEVIPGHPDQNTNTMLEMIGQAREA-RADMVVFPE
NADE_YEAST        --------------MSHLITLATCNLNQWALDFEGNRDRILQSIKIAKERG-ARLRVGPE
D5G3Y4_TUBMM      --------------MGHLAVLATCSLNQWALDFEGNAERIIESIRIAKEAG-ASLRVGPE
NADE_SCHPO        --------------MERYVTIASCQLNQWAMDFEGNRLRIIDSIKEAKRQN-ASLRVGPE
NADE_DICDI        ---------------MKTVTLATCNLNQWAMDFKGNLERIIESINIAKSKG-AKYRLGPE
NADE_MOUSE        --------------MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKG-ARYRLGPE
NADE_RAT          --------------MGRKVTVATCALNQWALDFEGNFQRILKSIQIAKGKG-ARYRLGPE
NADE_MACFA        --------------MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRG-ARYRLGPE
NADE_HUMAN        --------------MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRG-ARYRLGPE
NADE_BOVIN        --------------MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKHRG-ARYRLGPE
NADE_CHICK        --------------MGRAVSVAACALNQWALDFEGNAERILRSISIAKSKG-ARYRLGPE
NADE_DROME        --------------MGRKVTVAVSTLNQWALDFEGNMVRILQSILEAKDMG-ASYRTGPE
NADE_ORYSI        ---------------MRLLRVATCNLNQWAMDFDTNLRNVKESIARAKAAG-AAVRVGPE
NADE_ORYSJ        ---------------MRLLRVATCNLNQWAMDFDTNLRNVKESIARAKAAG-AAVRVGPE
M0S5G6_MUSAM      ---------------MRLLKVASCNLNQWAMDFDNNLQNIKDSISRAKEAG-ARIRIGPE
NADE_ARATH        ---------------MRLLKVATCNLNQWAMDFESNMKNIKASIAEAKAAG-AVIRLGPE
A8IGM5_CHLRE      -------------MPRRLAVLATCNLNQWAMDFEGNLGRIKQSIREAKAKG-ATYRVGPE
C7YLC3_NECH7      ---------------MALVTVAAATLPSIPLDFLGNKERILESIRIAKDKG-ATLRTGPE
C4LAL2_TOLAT      --------------MRQTLTIATASINTTPLDLDGNLALIRAAVADAVQQQ-ADVLLLPE
Q8F1Y8_LEPIN      ---------------MQSVRLTSVSLKTKVFDFQGNLEKIKRVLK--LEKK-SDLILFPE
I3RAN1_HALMT      ----------------MDIDVTLSQVNPTTGDIKGNTDRIVDSLERAEQDG-SDVVVFPE
E7FYA0_ERYRH      ------------------MKIAIAQLRVKANNPQANFEMIQEIVEKSKGK--ADLIVFPE
S4XKD4_SORCE      ---------------MRLVKIGIANVNATVGAVRSNTDRCLALARSMARDD-VTLAVFPE
                                                     *                       *

NADE_MYCBO        LTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRI---------
NADE_MYCTO        LTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRI---------
NADE_MYCTU        LTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRI---------
NADE_MYCLE        LTLSGYSIEDILLQDLLLEAVEDTVLDIVVASADLLPVLVIGAPLRYRHRI---------
A0R143_MYCS2      LTLSGYSIEDILLQDTLLESVQEALTELVAATSVLTPVLVIGAPLRHRHRI---------
Q89LJ7_BRADU      LCLSGYAIEDLVKQDPLLDAVERGLAAIVEASDALMTVLIVGAPLRFGHRI---------
Q9A2E6_CAUVC      LGLTGYTIDDLLQQEALLDAVEAAIATLTEASAGLAPMIVVGGPLRDAGRL---------
A9W9W6_CHLAA      LGISAYSNDDLFQQSTLLDAVEQALLTIAAAANDINALLLVGAPLRHEGRL---------
Q8ABA5_BACTN      MSITGYTCGDLFGQQILLEEAEMGLMQILNNTRQLDIISIVGMPVVVNSTV---------
Q97K69_CLOAB      LSITSYTCGDLFGQSTLINNSLKGIKELCDFLIDKDIVVVVGAPLLYNYCL---------
Q97I71_CLOAB      LCVTGYTCGDLFNQNLLIKRAENELNNLLVSTSNINMITAVGMPVKADNQL---------
Q7URG9_RHOBA      LGLSAYTCGDLFATQTLLDASLDALRTIVTHSHSCDAAIIVGLPLRVGTSV---------
NADE_SYNY3        LALCGYPPKDLLLNPSFVEQLEEELQWLAEKMPPSIAILVGTVTPHHQAER---------
Q8DJP2_THEEB      LALCGYPPKDLLLNRHFVEAMQQELHHLASALPPAVAVLVGTVLPNPDADV---------
Q7VA68_PROMA      LSILGYPPRDLLFNPLFLEHQWDILDEIVTYIAEKTPQLTLLVGIAEPAQD---------
Q7NHF0_GLOVI      LALPGYPPRDLLLDRAFVADVQQTAQRLAHALAGVVPVLVGTAVPSAVG-----------
Q2S5I3_SALRD      LCVTGYPPEDLLENPFFKRAVQRTVDHLARALPADLGVIIGAPVPNGDR-----------
Q1INM5_KORVE      LSICGYPPRDLVERATFVAHNREIAEAIAR-MTVGITVVAGLVTPANGK-----------
NADE_AQUAE        LSLSGYPPEDLLLQPHFLKECEKAFDQIIHHTRNYD-VIVAVGLPYYEFDL---------
NADE2_THEMA       LFLPGYPPEDLMLRLSFLRENRKYLQKFAQHTRNLG-VTVLMGFIDSDEDA---------
B5YJ78_THEYD      LILTGYTPEDLLFYPSFIKKANEALNKLIENVKDF---VMILGLPVKEEDL---------
NADE_XYLFT        LALSGYPPEDLLLRPGFLAHCQVAIERIAAATHGI---VAVVGWPQSAGSV---------
NADE_XYLFA        LALSGYPPEDLLLRPGFLAHCQVAIERIAAATHGI---VAVVGWPQSAGSV---------
Q5H2H2_XANOR      LAISGYPPEDLLLRPGFLAHCEQALARIAAATRGI---VAVVGWPQSAGSV---------
NADE_RHOCA        MFLTGYQTQDLVLKPAFLRDAMAAMAALAAQVVDG--PALGIGGPYVDETG---------
Q3J3Z6_RHOS4      MFVTGYQTQDLVLRRAFVEEAMATIERLAADCAEG--PAIGIGGPCLEDGR---------
A9CIT1_AGRFC      LFISGYPPEDLVLKPAFLKACLKAVEELAAETADGG-PGVVIGFPRQGETG---------
Q63W64_BURPS      LALSGYPPEDLLLRPAFYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNA
Q6MGT5_BDEBA      CTLFGYHPFDLLEREKLVAKQEAEFKDLIKKLPKNIGVIMGLITRNPAKKG---------
Q18H53_HALWD      LALLGYPPRDLLHRQRVRDAEQTALETLRHLTEQGPPLIVGHTASADRTSG---------
D8IX05_HERSS      LSICGYYPGDLLEEARFLDRAEATLQDVIDATRRLPGLTAVIGAPRRNPGP---------
C9LUR9_SELS3      MAIPGYLLGDTWEQDAFLRDAEACAADVIAASEGIAVIFGSVAVDWTKKNN---------
A4J4I7_DESRM      MCIPGYLLGDTWEQQSFLRDCEEYGREIVAASQGLTVLFGNVGIDWDKKGD---------
NADE_YEAST        LEITGYGCLDHFLENDVCLHSWEMYAQIIKNKE--THGLILDIGMPVLHKN---------
D5G3Y4_TUBMM      LEITGYGCLDHFLEGDTYLHSWEILAKIIAHED--CQDILLDIGMPIGHKN---------
NADE_SCHPO        LEVTGYGCEDHFLESDTYYHSWEMLCSIIHDPD--CQDILLDIGMPVMHKA---------
NADE_DICDI        LEICGYGCEDHFLEQDTMLHCWQSLAVILKDPEL-TKDILVDVGMPVLHKD---------
NADE_MOUSE        LEICGYGCWDHYHESDTLLHSLQVLAALLDSPV--TQDIICDVGMPIMHRN---------
NADE_RAT          LEICGYGCWDHYHESDTLLHSLQVLAALLDAPA--TQDIICDVGMPIMHRN---------
NADE_MACFA        LEICGYGCWDHYYESDTLLHSFQVLAALLESPV--TQDIICDVGMPVMHRN---------
NADE_HUMAN        LEICGYGCWDHYYESDTLLHSFQVLAALVESPV--TQDIICDVGMPVMHRN---------
NADE_BOVIN        LEICGYGCWDHYYESDTLLHSLQVLAALLESPV--TQDIICDVGMPVMHRN---------
NADE_CHICK        LEICGYGCADHYYESDTLLHSFQVLAKLLESPA--TQDIICDVGMPLMHRN---------
NADE_DROME        LEVCGYSCEDHFREPDTFLHSWEVLLEVMMSPM--CENMLVDVGMPVMHRN---------
NADE_ORYSI        LELTGYGCEDHFLEQDTAAHAWECLKDILSGGY--TDGILCSIGMPVIFKS---------
NADE_ORYSJ        LELTGYGCEDHFLEQDTAAHAWECLKDILSGGY--TDGILCSIGMPVIFKS---------
M0S5G6_MUSAM      LEVTGYGCEDHFLEQDTVSHAWECLKDILLGDW--TEDILCSIGMPIIHAG---------
NADE_ARATH        LEVTGYGCEDHFLELDTVTHAWECLKELLLGDW--TDDILCSIGMPVIKGA---------
A8IGM5_CHLRE      LEVPGYGCEDHFLELDTVTHSWEVLAALLADPEGLTDGILVDVGMPVIHRG---------
C7YLC3_NECH7      LEIPGYCALDHHLEGDTFLHSWEVLADIISDEV--CKGMLIDLGLGVRHRN---------
C4LAL2_TOLAT      LALTGYGCEDMFFSADWVSGVPAYLSQLAETLP--PSMMVAVGFPLLITGG---------
Q8F1Y8_LEPIN      LCISGYGCEDAFYFPRIWKRSWNSLIQLLPHTE--NKIIVVG--LPIFQNP---------
I3RAN1_HALMT      MAITGYCIRDLIEDETFVDENRRALDYIRRRTGDTAVVVGVIDRDDRG------------
E7FYA0_ERYRH      LAVGGYLVGDRMNNQSNIDELMAYNDRIRLLSDEIGIVWGNIYQKNDR------------
S4XKD4_SORCE      QVIGGYASEDLVQWPAFVASQQRELRRFAEETASLRTVFVIGVTVGVGGDL---------
                    : .*   *                 .                                

NADE_MYCBO        -------------YNTAVVIHRGAVLG--------VVPKSYLPTYREFYERRQMAPGDGE
NADE_MYCTO        -------------YNTAVVIHRGAVLG--------VVPKSYLPTYREFYERRQMAPGDGE
NADE_MYCTU        -------------YNTAVVIHRGAVLG--------VVPKSYLPTYREFYERRQMAPGDGE
NADE_MYCLE        -------------YNTAVIIHRGVVLG--------VAPKSYLPTYREFYERRQLAPGDDE
A0R143_MYCS2      -------------YNTAVVIHRGAVLG--------VVPKSYLPTYREFYERRQMAAGDQT
Q89LJ7_BRADU      -------------YNCAVVIHRGNVLG--------VVPKSYLPTYREFYEGRHFASGAGI
Q9A2E6_CAUVC      -------------YNTAIVIQGGKVLG--------VVPKSFLPNYREFYERRWFTPGAGL
A9W9W6_CHLAA      -------------FNCAVAIYRGQIIG--------VTPKSYLPNYREFYEKRHFAAARDA
Q8ABA5_BACTN      -------------INAAVVIQKGKVLG--------VAAKTYLPNYKEFYEQRWFTSALQL
Q97K69_CLOAB      -------------YNCAYVLFNGSILG--------IVPKSYIPNYVEFYEKRWFTEGLNL
Q97I71_CLOAB      -------------FNCAVIINNGNILG--------VVPKTFIPTYNEFYEKRNFAGAISR
Q7URG9_RHOBA      -------------MNVAALVRGGVIRG--------LVPKTFLPNYREFYEARHFRAASAT
NADE_SYNY3        -------QGQKKLWNSAVLIEQGQIKQ--------WFHKCLLPTYDVFDEDRYFASAA--
Q8DJP2_THEEB      -------KGQKPLYNGAALLREGEVQQ--------VFAKQLLPTYDVFDECRYFAPGS--
Q7VA68_PROMA      -------LQVPNLFNSIALLKSSGWEV--------IARKQLLPTYDVFDEKRYFRAAQ--
Q7NHF0_GLOVI      ----------RPLANAALLLEGGECRE--------TVLKGLLPTYDIFDEDRYFEAGQ--
Q2S5I3_SALRD      --------FGKPLHNAALLLENGAVQD--------RVYKTLLPTYDIFDEDRHFEPAE--
Q1INM5_KORVE      --------TGKSVMNSAAVLRDGRIVH--------VQSKRLLPTYDVFDEMRNFAPAD--
NADE_AQUAE        -------------YNALAVIHRGEVLG--------IYKKHFLPNYSVFDEYRYFRKGE--
NADE2_THEMA       -------------YNAAAVVKDGEILG--------VYRKISLPNYGVFDERRYFKPGE--
B5YJ78_THEYD      -------------YNSAVILAEQKVID--------TYHKIYLPNYSVFDEMRYFKSGK--
NADE_XYLFT        ------------VYNVASVLCDGQVEQ--------TYRKRELPNYAVFDERRYFEVDPNG
NADE_XYLFA        ------------VYNVASVLCDGQVEQ--------TYRKRELPNYAVFDERRYFEVDPNG
Q5H2H2_XANOR      ------------VYNAASVLRDGRIEA--------TYRKRELPNYAVFDERRYFDVDPDG
NADE_RHOCA        ------------SYNAWWVLKDGRVIA--------RALKHHLPHDDVFDEMRLFDQGP--
Q3J3Z6_RHOS4      ------------LMNAYWVLEGGRVSA--------RVFKHHLPNAEVFDEKRVFSSGE--
A9CIT1_AGRFC      ------------RHNSVALLDGGKIIA--------LRDKIDLPNYGEFDEKRVFEEGS--
Q63W64_BURPS      NRPIERGAAPVDTYNAASLIVGGEVVG--------TYRKQDLPNTEVFDEKRYFATDA--
Q6MGT5_BDEBA      ----------RPYFNSAALIAKGEKPR--------FFHKQLLPTGDVFDEARFIESGD-V
Q18H53_HALWD      ----------PPLTNSATVFVDGEATV--------QYNKRLLPTYDIFDEHRYFSRGTES
D8IX05_HERSS      ---------GKPLFNALLAVREGRIVA--------EYHKQLLPVYGVFDDGRHFEAGP-E
C9LUR9_SELS3      -------DGRPRKYNACFVASEGKLCHPEAMPYP-FVIKTLLPNYREFDDTRHFFSLQKL
A4J4I7_DESRM      -------DGRVRKYNAFFVAQNGKLLGRENFPYS-FRIKTLQPNYREFDDERHFYSLRKL
NADE_YEAST        -----------VRYNCRLLSLDGEILF--------IRPKIWLANDGNYREMRFFTPWMKP
D5G3Y4_TUBMM      -----------IRYNCRVIAHNKRILL--------IRPKIYLANDGNYREMRYFTGWGRT
NADE_SCHPO        -----------MRHNCRILALNGKILL--------IRPKIWLCDDGNFRESRWFTPWLRP
NADE_DICDI        -----------VRYNCRVILLNQKIYL--------IQPKKAMAMDGNYREGRWFTPWIKP
NADE_MOUSE        -----------VRYNCRVIFLNRKILL--------IRPKMALANEGNYRELRWFTPWTRS
NADE_RAT          -----------VRYNCLVIFLNRKILL--------IRPKMALANEGNYRELRWFTPWARS
NADE_MACFA        -----------VRYNCRVIFLSRKILL--------IRPKMALANEGNYRELRWFTPWSRS
NADE_HUMAN        -----------VRYNCRVIFLNRKILL--------IRPKMALANEGNYRELRWFTPWSRS
NADE_BOVIN        -----------VRYNCRVIFLNRKILL--------IRPKMALANEGNYRELRWFTPWSRS
NADE_CHICK        -----------VRYNCRVIFLNKKILL--------IRPKISLANAGNYRELRWFTPWNKA
NADE_DROME        -----------VAYNCRVAFFNRQILL--------IRPKMAMCDDGNYRESRWFTAWTKA
NADE_ORYSI        -----------VRYNCQVFCLNSKIVM--------IRPKISLANDGNYREFRWFSAWTFK
NADE_ORYSJ        -----------VRYNCQVFCLNSKIVM--------IRPKISLANDGNYREFRWFSAWTFK
M0S5G6_MUSAM      -----------VRYNCQVFCLNRRILM--------IRPKMALANDGNYREFRWFSAWTFK
NADE_ARATH        -----------ERYNCQVLCMNRRIIM--------IRPKMWLANDGNYRELRWFTAWKQR
A8IGM5_CHLRE      -----------VMYNCRVFLLNRRVLL--------IRPKLHLANDGNYRETRYFATWKHR
C7YLC3_NECH7      -----------VRYNSRVLCTYRKIFC--------IRPKTALANDGLYREARHFTAWSKP
C4LAL2_TOLAT      -----------QVFNAVALLSQYQVHG--------VVCKQHLARNGIHYEPRWFTPWPAG
Q8F1Y8_LEPIN      -----------YLFNCAAVLCNGVVAG--------IVPKSNLASTGVHYENRWFTRGEES
I3RAN1_HALMT      ------------VYNAAAVLQNGTVRG--------IARKVLLPNYRYFDDERYFEAGEDI
E7FYA0_ERYRH      ------------LYNAAFFAYKGEWVERANHESAGVYMKHLLPNYGIFDDKRYFEPGDHN
S4XKD4_SORCE      -------------FNAGAIVHAGQVLA--------FSPKEKLPTYNIFYEARTFSRGMPF
                                *                       *        . : * :      

NADE_MYCBO        RG--TIRIGGADVAFGTDLLFAA---------------SDLPGFVLHVEICEDMFVPM--
NADE_MYCTO        RG--TIRIGGADVAFGTDLLFAA---------------SDLPGFVLHVEICEDMFVPM--
NADE_MYCTU        RG--TIRIGGADVAFGTDLLFAA---------------SDLPGFVLHVEICEDMFVPM--
NADE_MYCLE        HG--TIGIGDLRAPFGPDLLFAA---------------ADLLGLVLHVEICEDMFVPV--
A0R143_MYCS2      RG--TIRVAGAEVPFGPDLLFAA---------------SDVPGLVLHVEICEDMFVPI--
Q89LJ7_BRADU      AGE-TIVFGGLHAPFGVDLLFAA---------------EDVPGLTIGVEICEDMWIPV--
Q9A2E6_CAUVC      TGK-TLTLAGQTVPFGTDILFRG---------------EGVAPFTVGVEICEDVWTPT--
A9W9W6_CHLAA      IGD-TIQLAGQNVPFGTDVIYDV---------------TTLPGLAVHVEICEDLWTPL--
Q8ABA5_BACTN      TEDTVRL-CGQIVPIGANLLFE------------------TSDTTFGIEICEDLWATI--
Q97K69_CLOAB      KGQFAQFPFQQDVPFGCDLIFR------------------CGDLKLGIEICEDLWAPI--
Q97I71_CLOAB      ISDEIIL-CGKKVPFGENLLFKD---------------I-YSELCIGIDICEDLWVNI--
Q7URG9_RHOBA      DPATVRI-DRQDIPFGTDLLFQ------------------DGAATLGVEICEDLWVPV--
NADE_SYNY3        KSEYFIYK----------------------------------NVKIGVTICEDLWNDEAF
Q8DJP2_THEEB      TENLLTLTT----------ATD--------------------QLKIGVTICEDLWNNEQF
Q7VA68_PROMA      KSGVILLTE----------NER--------------------TWRLGLTICEDLWVEEGI
Q7NHF0_GLOVI      RAYPIEIA----------------------------------GVAMGVHVCEDIWNDREF
Q2S5I3_SALRD      ERRLLEWR----------------------------------GLRIGLHVCEDMWNVHQP
Q1INM5_KORVE      HQELFCQG----------------------------------STSIALTICEDAWNDKNF
NADE_AQUAE        EPLMIEVN----------------------------------GHKVSFSICEDIWYPD--
NADE2_THEMA       ELLVVKIG----------------------------------NIKVGVTICEDIWNPV--
B5YJ78_THEYD      RASVYEYS----------------------------------GVLFGVNICEDIFHPT--
NADE_XYLFT        SRCVFKVK----------------------------------GVPVGVLICEDLWFS---
NADE_XYLFA        SRCVFKVK----------------------------------GVPVGVLICEDLWFS---
Q5H2H2_XANOR      ENCVVTVK----------------------------------GVQVGVVICEDLWFA---
NADE_RHOCA        VSDPLRLG----------------------------------PVALGVPVCEDAWHP---
Q3J3Z6_RHOS4      VHGPCRVG----------------------------------PLRIGIPICEDSWHP---
A9CIT1_AGRFC      ISGPYNFR----------------------------------GVRIGIPICEEIWNDM--
Q63W64_BURPS      APYVFELN----------------------------------GVRFGVVICEDVWHA---
Q6MGT5_BDEBA      SKNYFKWK----------------------------------GKKFFLTICEDIWAWPDA
Q18H53_HALWD      QTTHIDDT------------------------------------TVGITICEDAWYDHEV
D8IX05_HERSS      TACVLPLK----------------------------------GMRVGFLICEDGWNDDLR
C9LUR9_SELS3      ARELGTTPKSLISPVSLKIRGR--------------------RWKIGCLLCEDGWSDN--
A4J4I7_DESRM      AQEYGKSPEELLSPVYVNIGGQ--------------------KLALGCLLCEDGWSEDF-
NADE_YEAST        GVVEDFILPPEIQKVTGQRL-----------VPFGDAVINSLDTCIGTETCEELFTPQ--
D5G3Y4_TUBMM      KYVEEYYLPRIIMTITGQRK-----------VPFGDAAISTLDTCIAPETCEEMFTPN--
NADE_SCHPO        RVVETHYLPTFVAKSLNQTT-----------VPIGDAILQCNETVVGVETCEELFTPN--
NADE_DICDI        RVVETFYLPRIISQITGQDE-----------CQIGDAIISTLDTAISSETCEELFTPN--
NADE_MOUSE        RQTEEYVLPRMLQDLTKQKT-----------VPFGDVVLATQDTCVGSEICEELWTPR--
NADE_RAT          RQTEEYVLPRMLQDLTKQET-----------VPFGDVVLATQDTCIGSEICEELWTPC--
NADE_MACFA        RHTEEYLLPRMIQDLTKQET-----------APFGDAVLATWDTCIGSEICEELWTPH--
NADE_HUMAN        RHTEEYFLPRMIQDLTKQET-----------VPFGDAVLVTWDTCIGSEICEELWTPH--
NADE_BOVIN        RQTEEYFLPRMLQDLTKQET-----------VPFGDAVLSTWDTCIGSEVCEELWTPH--
NADE_CHICK        RHVEEYLLPRIIQEVTGQDT-----------VPFGDAVLATKDTCLGTEICEELWAPN--
NADE_DROME        LQTEEYVLPRMIAQHTGQQT-----------VPFGDAVIATRDTCLGYEICEELWNVR--
NADE_ORYSI        DALVDFQLPLDISEVTSQDT-----------VPFGYGFIQFLDVSLASETCEELFTAN--
NADE_ORYSJ        DALVDFQLPLDISEVTSQDT-----------VPFGYGFIQFLDVSLASETCEELFTAN--
M0S5G6_MUSAM      DKLIEFQLPTDVSESISQHS-----------APFGYGYIQLLDASVAAETCEELFTAN--
NADE_ARATH        EELEEFQLPIEISEALEQKS-----------VPFGYGYIQFIDTAVAAEVCEELFSPL--
A8IGM5_CHLRE      GKVECHRLPDCVARAAAAAAAAAAAPPPPVDVPFGDAVLKLRDALLAAETCEELFTPQ--
C7YLC3_NECH7      RQVETYYLDGPVRKVTGQSS-----------VPIGDMILSTPDTAVTCESCEEMFVPL--
C4LAL2_TOLAT      E--------VMTLELAGQHV------------PVGDIVFEVEGIRLGFEICEDSWVAS--
Q8F1Y8_LEPIN      Q--------ENFIAPDGSTI------------PFGSLIFETDHFSFGVEICEDSWVLQ--
I3RAN1_HALMT      SPIQIAVNGE--------------------------------QMDLGVTVCEDMWDEEYD
E7FYA0_ERYRH      FEPFIFK-----------------------------------GDRISIQVCEDLWDKSSD
S4XKD4_SORCE      MELDADGVICGDRILAFDFG------------------------TIAVEVCEDIWSPD--
                                                               .    **: :     

NADE_MYCBO        ------------PPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYA
NADE_MYCTO        ------------PPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYA
NADE_MYCTU        ------------PPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYA
NADE_MYCLE        ------------PPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASLRCLAAYVYA
A0R143_MYCS2      ------------PPSAQAALAGATVLANLSGSPITVGRAEDRCLLARSASARCLAAYVYA
Q89LJ7_BRADU      ------------TPASELALAGASVLINLSGSPITIGRARSRALLCQSTSARCLAAYVYS
Q9A2E6_CAUVC      ------------PPSTAQALAGAEILLNLSASNITIGKSETRRLLCASQSSRMIAAYVYS
A9W9W6_CHLAA      ------------PPSTFAALAGATVLCNLSASNITIGKADYRRALCMNQSARTLAAYLYS
Q8ABA5_BACTN      ------------PPSSSLALQGAEIIFNMSADNEGIGKHHYLCSLISQQSARCIAGYVFS
Q97K69_CLOAB      ------------PPSSYLSLMGANVILNISASNEVVSKADYRRSLISNQSGRCMCSYIYS
Q97I71_CLOAB      ------------PPSSYHTLNGANLILNLSASDEIVAKSDYRRDLVRLQSAKCITSYAYA
Q7URG9_RHOBA      ------------PPSSHAAIAGANVVVNLSASNELIGKAQWRRDLVVSQSGRLIAAYAYS
NADE_SYNY3        WGQ---KFYQVNPLMDLIDQ-GVNLVVNLSASPYSCGKHYLRESLISHSAKRFNVPLIYV
Q8DJP2_THEEB      WGQ---RYYERNPVAELVAE-GADLIVNLSASPYCVGKPKLRQALIEHTARQYHCPLIYA
Q7VA68_PROMA      QGH---RIEGPDPIADLTSK-KIDLLLNLSASPFTHGKGLLRQRLASKAAKRLNCPVIYL
Q7NHF0_GLOVI      WPR---PRYRRDPVEELAGQ-GARYLLNLSSSPFYAGKQQLRERLLAHAARRHRLPVLYV
Q2S5I3_SALRD      EGVDQSERYERDPVAELAAL-DPDLFVNISASPFSIGKHEVRDKLVEHICRRHERPFLLC
Q1INM5_KORVE      WDR---RLYGNDPVEDLMVG-GGKLLLNISASPFYVAKQELRRKMLTAIARKYHTVVAMC
NADE_AQUAE        -----------GVERQTALS-GAELIVNVNASPYHVNKYSFKESFLKSRAEDNLCFVAYV
NADE2_THEMA       -----------EPSASLSLGEGVHLIANLSASPYHVGKPVLRKDYLSMKAYDYHVAMAYC
B5YJ78_THEYD      -----------LPSPIQASS-GAELIINISASPFYAGKFEKKLRMLSTRAYDMGVFIAYL
NADE_XYLFT        -----------EPLADTVCG-GAELVLVPNASPYERGKHAQRDALLAERARETGAAIAYL
NADE_XYLFA        -----------EPLADTVCG-GAELVLVPNASPYERGKHAQRDALLAERARETGAAIAYL
Q5H2H2_XANOR      -----------EPLANTVKA-GAELVLVPNASPYERGKHAQRDALLAERTRESGAAIAYL
NADE_RHOCA        -----------DVAGALAAA-GAEVLMVPNGSPYRRGKLDLRRQVTGARVAETGLPLLYL
Q3J3Z6_RHOS4      -----------DVCETLAET-GAEILLVPNGSPYHREKLDVRVNLMVTRVVETGLPLVYL
A9CIT1_AGRFC      -----------GVCETLAES-GAEILLVPNGSPYYRGKLDVRHQVALRQVIESGLPLVFA
Q63W64_BURPS      -----------SAAQLAKAA-GAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYV
Q6MGT5_BDEBA      KGN---SPYRENPLAKVKKQ-KIDMVINLSASPYFVGKMKQREYVTQKTAAYFNAPIMYV
Q18H53_HALWD      TGQ---QRHQTDPIAPYETA-DVDLLVNLSASPYRVNKSSARFDRFGRHARRIDAPVVFA
D8IX05_HERSS      SYR-------VNPFEKLAQA-DAQLVVSINASPSDVGKRSQRHALFQAACLRRQMALLYV
C9LUR9_SELS3      --------YETAPMKLLEEYEDLDFYVNISSSPYTLGKDEKRRRLFSAAAKAAGTPLIYV
A4J4I7_DESRM      --------YVTKPVTALKEKGPIDLFINISSSPFTVGKNQKRNRIFSRQAQEAAVPLIYV
NADE_YEAST        ------------SPHIAMSLDGVEIMTNSSGSHHELRKLNKRLDLILNATKRCGGVYLYA
D5G3Y4_TUBMM      ------------SPHIGMSLDGIEIMTNSSGSHHELRKLQTRIELMTEATKKCGGIYLYA
NADE_SCHPO        ------------SPHIDMALDGVEIFINASGSHHELRKLTTRVNLIQNATEKCGGIYLYS
NADE_DICDI        ------------SPHIQMGLDGVEIFTNGSGSHHQLRKLDTRVDLIRSATSKSGGIYLYS
NADE_MOUSE        ------------SPHIDMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLA
NADE_RAT          ------------SPHVNMGLDGVEIITNASGSHHVLRKAHTRVDLVTMATSKNGGIYLLA
NADE_MACFA        ------------SPHIDMGLDGVEIITNASGSHHVLRKANTRVDLVTMATSKNGGIYLLA
NADE_HUMAN        ------------SPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLA
NADE_BOVIN        ------------SPHVDMGLDGVEIFTNASGSHHVLRKAHARVDLVTMATTKNGGIYLLA
NADE_CHICK        ------------SPHIEMGLDGVEIFTNSSGSHHVLRKAHTRVDLVNSATAKNGGIYILS
NADE_DROME        ------------SKHIEMSLAGVELIVNSSGSYMELRKAHITSDLIRNASFKAGGAYLFS
NADE_ORYSI        ------------APRIDLALNGVEVFVNASGSHHQLRKLSLRIDSMRNATLACGGVYMYA
NADE_ORYSJ        ------------APRIDLALNGVEVFVNASGSHHQLRKLSLRIDSMRNATLACGGVYMYA
M0S5G6_MUSAM      ------------APRIALALKGVEIFTNASGSHHQLRKLNLRMDAIKNATRFCGGVYMYS
NADE_ARATH        ------------PPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYS
A8IGM5_CHLRE      ------------APHIDLALAGVEIISNGSGSHHQLRKLNQRLDLIRGATAKAGGVYLYA
C7YLC3_NECH7      ------------NPSTFAGLNGAEIILNSSASHAELRKLRTRLELIANSTRKLGGIYVYA
C4LAL2_TOLAT      ------------RPGRSLYERQVDVIMNPSASHFALGKQKVRRQFVCEGSRAYGAVYVYT
Q8F1Y8_LEPIN      ------------KPSIPLAEAGTDLILSPGASHFAFGKQRIRRQIFQESSRRESNVYLFS
I3RAN1_HALMT      -----------RQPITELADAGADLLININASPFEAGKRQTRHEIIQRHIEQTGLPLIYV
E7FYA0_ERYRH      -----------LKPTELMMQHSPDLMINISCSPWHKHKESMRLEEIRRQ--NLDIPFIYV
S4XKD4_SORCE      ------------GPMRRRCYAGAEIVCNISASPFRAGVTGTRREMIATRAADNQCTIAYA
                                               . .                            

NADE_MYCBO        AAGEGEST--TDLAWDGQTMIWE-NGALLAESERFPKGV-------RRSVADVDTELLRS
NADE_MYCTO        AAGEGEST--TDLAWDGQTMIWE-NGALLAESERFPKGV-------RRSVADVDTELLRS
NADE_MYCTU        AAGEGEST--TDLAWDGQTMIWE-NGALLAESERFPKGV-------RRSVADVDTELLRS
NADE_MYCLE        AAGEGEST--TDLAWDGQTMIWE-NGVLLAESERFPKGE-------HRSVADVDTELLRS
A0R143_MYCS2      AAGEGEST--TDLAWDGQTMIWE-NGNLLAESERFPRGE-------RRAVADVDLELIRN
Q89LJ7_BRADU      AAGAGEST--TDLAWDGQTSIYE-NGVLLAEGERFRQGG-------QITFADVDLDLLRQ
Q9A2E6_CAUVC      AAGAGESS--TDLAWDGHVDIHE-MGALLAETPRFSTGP-------AWTFADVDVQRLRQ
A9W9W6_CHLAA      AAGPGEST--TDLAWDGHALICE-NGELLAESQRFCDEE-------QIIFADVDLERLLQ
Q8ABA5_BACTN      SCGFGEST--TDVVFAGNGLIYE-NGSLLARSKRFCMEE-------QLIISEIDVERIRA
Q97K69_CLOAB      SAGVFESS--TDVVFSGHLLICE-NGRILSENDRFERDN-------LVLTSMIDLEKLQS
Q97I71_CLOAB      SSGQTEST--SDLVFSGHSIIAD-NGSIL-KDIKFEEAS-------YVKYADVDIEKLIS
Q7URG9_RHOBA      SAGGGEST--SDLVFGGHCLIAE-NGALIGESRRIGDTDDEDLPVQTQLIRDVDLQRLDH
NADE_SYNY3        NQVGGNDD----LIFDGGSFAVNSQGKIIG-RSPLFQEDL--------ALLSYDLSSGEL
Q8DJP2_THEEB      NQVGGNDD----LVFDGTSLAVNRQGEVVS-RAKGFREDY--------LAVRWQDGD-LQ
Q7VA68_PROMA      NQVGGNDE----LIFDGSSFITDQKGKKTL-SLPLCKES----------IVTWDATS---
Q7NHF0_GLOVI      NQVGGNDE----LLFDGRSCVFDGEGRLTA-RARAFAEDM--------LLVDLDSLA---
Q2S5I3_SALRD      NQVGANTE----IIHDGDSRVHAADGTQVA-CAASFEEDL--------LFWDTESSP---
Q1INM5_KORVE      NQVGGNDS----IVFDGSSVVIGPDGSVIA-QARSFEEDL--------IFCDTDALT---
NADE_AQUAE        NLVGGQDE----LVFDGRSIVISPFGKLVA-RAKAFEEDI--------LTVTLDLGE--A
NADE2_THEMA       NMVGGQDE----LVFDGGSMVVDASGEVIN-YGKLFEEEI--------ITVDLDLDE--N
B5YJ78_THEYD      NTVGGQDE----IVFDGRSMVISPSGEIIT-MGKAFEEDF--------IVVDLDLEE--V
NADE_XYLFT        NVVGGQDA----LVFDGASVVVDGHGRVHP-AAAAFSDQW--------LVVDYMRSE--R
NADE_XYLFA        NVVGGQDA----LVFDGASVVVDGHGRVHP-AAAAFSDQW--------LVVDYMRSE--R
Q5H2H2_XANOR      NVVGGQDA----LVFDGASVVADGDGTVHP-AAAAFVDQW--------LVVDYAAGE--R
NADE_RHOCA        NMVGGQDD----QLFDGASFVLNPDGSVAV-QLPAFEEAV--------VHVDLERGA--A
Q3J3Z6_RHOS4      NMVGGQDD----QVFDGASFVLNPHGRLMA-QLPAFEEAL--------VHVDFEAAD--E
A9CIT1_AGRFC      NQLGGQDE----LVFDGASFGFNADKTLAF-QMSQFEATL--------AVTDWKRTA--D
Q63W64_BURPS      NLVGGQDE----LVFDGGSFVLDGAGELVA-KMPQFEEGH--------AIVEF------D
Q6MGT5_BDEBA      NLVGAQDE----IIFDGGSFVLDKKGKKLL-TCQQFSEDI--------NVIDLNTLEVWN
Q18H53_HALWD      NQVGGNDD----ILFDGTSFILDSDGSQIA-SATSGEPRV--------LIGQPKNNS---
D8IX05_HERSS      NQVGGQDQ----LVYDGGSFAMSPLQGLAF-EAARLAEDF--------QVLAFEGGRFLR
C9LUR9_SELS3      NNVGLQNNGKTVYTFDGASAVYSAEGLCVT-AAPSYEEGL--------HYIDVEEIASLP
A4J4I7_DESRM      NNVGIQNNGKTIYAFDGSSTVYAKNGEVINYCSEPFSQSA--------EIFELHLNSDGS
NADE_YEAST        NQRGCDGD---RLYYDGCALIAI-NGTIVAQGSQFSLDDV------EVVTATVDLEEVRS
D5G3Y4_TUBMM      NQQGCDGD---RLYYDGSAMIGI-NGKIVAQGTQFSLQDV------EVITATVDLEEVRS
NADE_SCHPO        NQRGCDGG---RLYYDGSSMIFA-NGKMLAQGHQFSLKDV------EVISATVDVDTVRS
NADE_DICDI        NQQGCDGS---RLYYDGSCMIMI-NGDCVSQGSQFSLVDI------EVITATVDLEDVRS
NADE_MOUSE        NQKGCDGD---RLYYDGCAMIAM-NGSIFAQGTQFSLDDV------EVLTATLDLEDVRS
NADE_RAT          NQKGCDGH---LLYYDGCAMIAM-NGSIFAQGTQFSLDDV------EVLTATLDLEDVRS
NADE_MACFA        NQKGCDGD---RLYYDGCAMIAM-NGSVFAQGSQFSLDDV------EVLTATLDLEDVRS
NADE_HUMAN        NQKGCDGD---RLYYDGCAMIAM-NGSVFAQGSQFSLDDV------EVLTATLDLEDVRS
NADE_BOVIN        NQKGCDGD---RLYYDGCALIAM-NGSIFAQGSQFSLDDV------EVLTATLDLEDIRS
NADE_CHICK        NQKGCDGD---RLYYDGCAMISM-NGETVAQGSQFSLDDV------EVLVATLDLEDVRS
NADE_DROME        NLRGCDGQ---RVYFNGCSAIAL-NGEILARSQQFALQDV------EVTLATIDLEEIRA
NADE_ORYSI        NQQGCDGG---RLYYDGCCCIAV-NGDVVAQGSQFSLKDV------EVLDALVDLDAVSS
NADE_ORYSJ        NQQGCDGG---RLYYDGCCCIAV-NGDVVAQGSQFSLKDV------EVLDALVDLDAVSS
M0S5G6_MUSAM      NHQGCDGG---RLYYDGCSCIAV-NGDIVAQGSQFSLKDV------EVSTAIVDLDAVSS
NADE_ARATH        NQQGCDGS---RLYYDGCACIVV-NGNVVAQGSQFSLRDV------EVIISQVDLDAVAS
A8IGM5_CHLRE      NQRGCDGG---RLYFDGCACVAV-NGQLVAQGGQFGLAEV------ECVAACVDLDEVVS
C7YLC3_NECH7      NATGVDGDA--RMMHDGSSMVIQ-NGEVFAQGSQFSLASV------EVTVATVDIEKVRS
C4LAL2_TOLAT      NLLGCEAG---RAVYDGDAMIAS-NGELVMSSDRLSFAPW------RVQSATVDIGLNRS
Q8F1Y8_LEPIN      NLCGNESG---RLIFEGGSMIVQ-NGKLLSESERLFFGDF------SLCSNEIDFEASQA
I3RAN1_HALMT      NTVGVADVEKNILVFDGDSLAYAADGTLLAKAAQFTEDSVHVTVSQDDAVLSQSRSQSQS
E7FYA0_ERYRH      NATGMQNNGKNVVLFDGGSMVVS--SESVTYLDANFKQTF--------DIVDLKVQVTN-
S4XKD4_SORCE      NLVGGNDG----LVFDGGGFINQ-NGRPMLEAPRFREGYA-------AAVVDLDRTTRCR
                                  *                                           

NADE_MYCBO        ERLRMGTFDDNRRH----------HRELTESFRRIDFALDP------------PAGDIGL
NADE_MYCTO        ERLRMGTFDDNRRH----------HRELTESFRRIDFALDP------------PAGDIGL
NADE_MYCTU        ERLRMGTFDDNRRH----------HRELTESFRRIDFALDP------------PAGDIGL
NADE_MYCLE        ERLRMGTFNDNRRR----------HRALVEPFRRIEFRLEP------------PVGNIGL
A0R143_MYCS2      ERVRMGTFDDNARH----------HGAAVDAFRRIEFQLDP------------PTGDIGL
Q89LJ7_BRADU      ERALMGTFDDNRRQ----------REAF---FRKVTFALKP------------PASDIGF
Q9A2E6_CAUVC      ERMRVGSFGDAMA-----------LSPASTPFRIVPFAFDA------------PEGDLAL
A9W9W6_CHLAA      ERARQTSFSDSIGD----------YRSHVRHMRRIPLAITL------------PVV-TDL
Q8ABA5_BACTN      ERRINTTFAASQG------------NPGDKKAISVATEFVN-------------SKELTL
Q97K69_CLOAB      ERLKNSTFKDSV-------------RLCDFKPNYIDFNLSN-------------WDIGDF
Q97I71_CLOAB      DRIKFNTYMGRI---------------EDKEYRTINFHLGY-------------NENMHL
Q7URG9_RHOBA      DRRVVGSFDDFQASLPRPYRTIDVAWAGSKKQSSSTTLLRTGKGNEKDATHSDQSDFNRL
NADE_SYNY3        TGQKLA------------------------------------------------------
Q8DJP2_THEEB      PTAMIA------------------------------------------------------
Q7VA68_PROMA      NSSISS------------------------------------------------------
Q7NHF0_GLOVI      --GRIE------------------------------------------------------
Q2S5I3_SALRD      ---EAC------------------------------------------------------
Q1INM5_KORVE      --GDIH------------------------------------------------------
NADE_AQUAE        KRKRLLDLRWREGS-----------------------------------YGREKVNVKRS
NADE2_THEMA       LRVSLVDPRRRYMK-----------------------------------TQNYPVKTVEA
B5YJ78_THEYD      TRVRMREPKIRWESEFER-------------------------------AEIIKISGEQK
NADE_XYLFT        RFVPLQWV----------------------------------------------------
NADE_XYLFA        RFVPLQWV----------------------------------------------------
Q5H2H2_XANOR      SFTPVVWV----------------------------------------------------
NADE_RHOCA        DWRAVPAD----------------------------------------------------
Q3J3Z6_RHOS4      GWRALPAP----------------------------------------------------
A9CIT1_AGRFC      GWHCDSGP----------------------------------------------------
Q63W64_BURPS      GARALPAP----------------------------------------------------
Q6MGT5_BDEBA      K-----------------------------------------------------------
Q18H53_HALWD      ------------------------------------------------------------
D8IX05_HERSS      SDGVGAPQ----------------------------------------------------
C9LUR9_SELS3      ARTPEK------------------------------------------------------
A4J4I7_DESRM      PSTAGKLI----------------------------------------------------
NADE_YEAST        YRAAVMSRGLQASLAEIKFKRIDIPVELALMTSRFDPTVCP-------------------
D5G3Y4_TUBMM      FRFAP-SRGVQA-VQNTPYQRIEVDISISAPSDRAEISLKP-------------------
NADE_SCHPO        YRFQP-SHGIQG-VTRPSYERIHVNFSLSSYQQDYDIYRKP-------------------
NADE_DICDI        VRASFMARCAQA-NLTKEFPRVRCPIQLTHI----DYCHPP-------------------
NADE_MOUSE        YKAEISSRNLEA-TRVSPYPRVTVDFALSVSE---DLLEPV-------------------
NADE_RAT          YRAKISSRNLEA-TRVNPYPRVTVDFALSVSE---DLLEPV-------------------
NADE_MACFA        YRAEISSRNLAA-SRASPYPRVKVDFALSCHE---DLLAPV-------------------
NADE_HUMAN        YRAEISSRNLAA-SRASPYPRVKVDFALSCHE---DLLAPI-------------------
NADE_BOVIN        YRAEISSRNLAA-SRVSPYPRVKVDFALSCHE---DLLEPV-------------------
NADE_CHICK        YRAEISSRNLAA-SKVNPFPRIKVNFALSCSD---DLSVPI-------------------
NADE_DROME        YRVSLRSRCTAA-ASAAEYPRIHCDFEMSTHS---DIFKTS-------------------
NADE_ORYSI        YRASVSSFREQA-SHRTKVPFVKVPYKLCKPF---QSGMVP-------------------
NADE_ORYSJ        YRASVSSFREQA-SHRTKVPFVKVPYKLCKPF---QSGMVP-------------------
M0S5G6_MUSAM      YRGSTSSFREQA-SHQEDVPSVRAPYKLCQAF---NLGMVP-------------------
NADE_ARATH        LRGSISSFQEQA-SCKVKVSSVAVPCRLTQSF---NLKMTL-------------------
A8IGM5_CHLRE      YRCSISSLREQA-SSTTPPAMVDVDFSLCRPPPGAAQPAHP-------------------
C7YLC3_NECH7      FRSSISRNVQAA--AQPEFPRVECDLVLSRPAEEIWLSNRPEI-----------------
C4LAL2_TOLAT      QRMISS--------QRLQPAEQRGIVIVPFDWQEEDYHRAL-------------------
Q8F1Y8_LEPIN      DRAKNFRPSGNRFSKTKSTEENKIYLGIEFPKRAPKVNKSL-------------------
I3RAN1_HALMT      RSQSQSRSQSDS------------------------------------------------
E7FYA0_ERYRH      ------------------------------------------------------------
S4XKD4_SORCE      REASTWRSDLEEFRRASPHMVDVLRATGQTADRSRLAYPAP-----------------PP
                                                                              

NADE_MYCBO        LREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDYP-KVV-IGVSGGLDSTHAL
NADE_MYCTO        LREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDYP-KVV-IGVSGGLDSTHAL
NADE_MYCTU        LREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDYP-KVV-IGVSGGLDSTHAL
NADE_MYCLE        LREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDYP-KVV-IGVSGGLDSTHAL
A0R143_MYCS2      LREIERFPFVPSNYERLQQDCYEAYNIQVSGLEQRLRALNYP-KIV-LGVSGGLDSTHAL
Q89LJ7_BRADU      LRKVERFPFVPSDESLLEQDCYEAYNIQVAGLVQRMRATGTK-RVV-IGVSGGLDSTHAL
Q9A2E6_CAUVC      ARPIERFPFTPSDPARLRENCYEAYNIQVQGLARRLEASGLK-KLV-IGISGGLDSTQAL
A9W9W6_CHLAA      RRSVARFPFVPNDPATRDERCYEAYNIQMHGLMQRMRSAGVE-KVV-IGVSGGLDSTQAL
Q8ABA5_BACTN      TRDFNSHPFVPQGA-ELDEHCEEVFSIQIAGLAQRLVHTKAK-TAV-VGISGGLDSTLAL
Q97K69_CLOAB      DRFIDSHPFVPSNERQREERCKEIFNIQTAGLAKRFTHTGLK-RAV-IGISGGLDSTLAL
Q97I71_CLOAB      ERYVEASPFVPSNKSKRNIRCREILDLQASGLYQRLNKTGIN-KAV-VGISGGLDSTLAL
Q7URG9_RHOBA      LRRVDPHPFVPDDLSKREERCGEILAIQTAGLVKRLQQLPAD-LPLTIGISGGLDSTLAL
NADE_SYNY3        --------------SLPMVDTEELWQALVLGVGDYLHKCG-F-SKAILGLSGGIDSSLVA
Q8DJP2_THEEB      --------------PLAKGEAAEIWQALVLGVRDYARKCG-F-RQVVIGLSGGIDSALVA
Q7VA68_PROMA      --------------PSLKEDQEILLQALVLGVKDYVGKCG-F-KSVLLGLSGGIDSALVA
Q7NHF0_GLOVI      --------------PQP-TGEAEIWEALVMGTADYARKCG-F-QQGLVALSGGIDSALTL
Q2S5I3_SALRD      --------------TTGRDAIADLHDALVLGVRDYYEKTGIF-DKALVGLSGGIDSAVTC
Q1INM5_KORVE      --------------PELGSEDANAYAALVLGTRDYVGKCG-F-RKVIIGLSGGIDSALTA
NADE_AQUAE        VSLPDKE-FFRGRIEENPKEEEEIYAALKLSLRDYVRKNG-F-EKVVLGLSGGIDSSFVA
NADE2_THEMA       GNLREKSGHFEPVVNPLPVREEEMFRALITGLRDYVRKNG-F-EKVVIGLSGGMDSSLVA
B5YJ78_THEYD      KSLAVQSLQPSAFSLKILSEEEEIFKALKTGLRDYVEKNG-F-SRVCLGLSGGIDSSFVA
NADE_XYLFT        -------------VESEVSINALVWRAVVRGVQDYCRKNG-F-SKVWVGLSGGIDSALVL
NADE_XYLFA        -------------AESEVSINALVWRAVVRGVQDYCRKNG-F-SKVWVGLSGGIDSALVL
Q5H2H2_XANOR      -------------DDGDESMDALAWRAVVRGLQDYCSKNG-F-SKVWLGLSGGIDSALVL
NADE_RHOCA        -------------IVAPPGDIEQDYRAMVLGLQDYLRKSG-F-SRVVLGLSGGIDSALVA
Q3J3Z6_RHOS4      -------------IVAQPDLWEADYHAMVLSLRDYLGKSG-F-SRVLLGLSGGIDSALVA
A9CIT1_AGRFC      -------------FSKIPEGEEADYRACMLGFRDYVNKNG-F-KSVVLGLSGGIDSAICA
Q63W64_BURPS      -------------IAPALPVEAQVYRALVLGVRDYIGKNG-F-PGAIVGLSGGVDSALVL
Q6MGT5_BDEBA      --------------NPKLEAIEELRRALVLGIRDFCEKTG-I-KKVHLGLSGGIDSAVVA
Q18H53_HALWD      ------------TSGTTPSETAQLRRMLELGIRDYLDKSG-F-DDVIIGLSGGIDSSVTA
D8IX05_HERSS      ------------CIDQTMATPEFHRRQILLGLRDYARRCG-F-GKVVVGSSGGIDSAVTI
C9LUR9_SELS3      -----------------KTEIAQIYEALSYGVRNFLDSID-M-KKVVVGASGGIDSAVAA
A4J4I7_DESRM      ----------------DNQETISVYQALNYGVRQFLSSIG-M-KKVVIGISGGIDSAVSA
NADE_YEAST        --------TKVREPFYHS-PEEEIALGPACWMWDYLRRCNG--TGFFLPLSGGIDSCATA
D5G3Y4_TUBMM      --------TPTIDIRYHS-PEEEIALGPACWLWDYLRRCGGV-SGYFLPLSGGIDSCATA
NADE_SCHPO        --------TDPIEVTIPL-PEEEITFGPACWLWDYLRRSHA--AGFFLPLSGGLDSCSTA
NADE_DICDI        --------DRVIHINYNT-PAEEIGFGPACWLWDYLRRSGL--SGYFLPLSGGADSAATA
NADE_MOUSE        --------SEPMEWTYHR-PEEEISLGPACWLWDFLRRSKQ--AGFFLPLSGGVDSAASA
NADE_RAT          --------SEPVEWTYHR-PEEEISLGPACWLWDFLRRNNQ--AGFFLPLSGGVDSAASA
NADE_MACFA        --------SEPIEWKYHS-PEEEISLGPACWLWDFLRRSQQ--GGFLLPLSGGVDSAATA
NADE_HUMAN        --------SEPIEWKYHS-PEEEISLGPACWLWDFLRRSQQ--AGFLLPLSGGVDSAATA
NADE_BOVIN        --------SEPIEWKYHS-PAEEISLGPACWLWDFLRRSRQ--AGFFLPLSGGVDSAATA
NADE_CHICK        --------CVPIQWRHHS-PEEEICLGPACWLWDYLRRSKQ--AGFLLPLSGGIDSSATA
NADE_DROME        --------TPPLNWPMHT-PEEEIALGPACWLWDYLRRSGQ--GGFFLPLSGGVDSSSSA
NADE_ORYSI        --------TGPVEVMYHR-PEEEIAFGPSCWLWDYLRRSRA--SGFLLPLSGGADSSSVA
NADE_ORYSJ        --------TGPVEVMYHR-PEEEIAFGPSCWLWDYLRRSRA--SGFLLPLSGGADSSSVA
M0S5G6_MUSAM      --------SSPVEIRYHC-PEEEIALGPSCWLWDYLRRSGA--SGFLLPLSGGADSSAVA
NADE_ARATH        --------SSPKKIIYHS-PQEEIAFGPACWMWDYLRRSGA--SGFLLPLSGGADSSSVA
A8IGM5_CHLRE      --------SPPISPKAGRAPQEEIAYGPACWLWDYLRRCGA--SGFLIPLSGGADSSAVC
C7YLC3_NECH7      --------SPAIQLKILD-PMEEIYMATAVYLWQYLTRTNS--PGFFLPLSGGLDSSSVA
C4LAL2_TOLAT      ---------SPQTTFADEDPHAAACRAIALGLWDWQRKTYT--SGYALSLSGGADSALCG
Q8F1Y8_LEPIN      ---------LEISVSKEEESYLDFTKAVALGLFDYLMYSNT--KGYTLSLSGGADSSACA
I3RAN1_HALMT      ------HSQYTPTTISTERREKELYDALVMGVRDYARKTG-F-EKILEPISGGIDSSLGL
E7FYA0_ERYRH      ----------------KPSYEDKMYHALISAIRYFDEEALSYGPKWIVGVSGGLDSSVSI
S4XKD4_SORCE      GTTPFLPSAALPAISARDELLDDFYEVLALGVADYYRKIGAF-KGIGLALSGGRDSLLTL
                                                                    *** **    

NADE_MYCBO        IVATHAMDREGRP----------------------------------RSDILAFALPGFA
NADE_MYCTO        IVATHAMDREGRP----------------------------------RSDILAFALPGFA
NADE_MYCTU        IVATHAMDREGRP----------------------------------RSDILAFALPGFA
NADE_MYCLE        IVAARAMDREGRP----------------------------------RSDILAFTLPGFV
A0R143_MYCS2      IVAARAMDREGRP----------------------------------RSDILAFTLPGFA
Q89LJ7_BRADU      IVAAKAVDLLGLP----------------------------------RENILAYTMPGFA
Q9A2E6_CAUVC      LVAAKAMDQLGLP----------------------------------RSNILAYTLPGFA
A9W9W6_CHLAA      IVAARTMDRLGLP----------------------------------RQNVLAYTMPGFA
Q8ABA5_BACTN      LVCVKTFDKLGLP----------------------------------RKDILGVTMPGFG
Q97K69_CLOAB      VVTVKTFDMLGID----------------------------------RKNIITVTMPGFG
Q97I71_CLOAB      LVIVEAFKKLKAP----------------------------------MKNIIGITMPGFG
Q7URG9_RHOBA      LVAVSAVDQLKRD----------------------------------RKVIDAIIMPGFG
NADE_SYNY3        AIAVEALG---------------------------------------KENVLGILMPSPY
Q8DJP2_THEEB      AIATAAVG---------------------------------------KEQVLGVLMPSPY
Q7VA68_PROMA      IIACAALG---------------------------------------AEKVSGILMPSPW
Q7NHF0_GLOVI      AIVAAALG---------------------------------------PVNVLAVMMPSPY
Q2S5I3_SALRD      ALAVEALG---------------------------------------PERVVGVTMPSEI
Q1INM5_KORVE      AIAVDALG---------------------------------------AENVMGVGMPGPY
NADE_AQUAE        CLAVDALG---------------------------------------RENVKGVYMPSQF
NADE2_THEMA       VIATEALG---------------------------------------KENVKGVLMPSMY
B5YJ78_THEYD      LVATDALG---------------------------------------SDRVTGVFMPSRY
NADE_XYLFT        AIAVDALG---------------------------------------ADQVTAVRLPSRY
NADE_XYLFA        AIAVDALG---------------------------------------ADQVTAVRLPSRY
Q5H2H2_XANOR      AMAVDALG---------------------------------------GDNVTAVRLPSRY
NADE_RHOCA        VIAADALG---------------------------------------AGNVHCVMLPSRY
Q3J3Z6_RHOS4      AIAADALG---------------------------------------PEAVRCVMLPSRF
A9CIT1_AGRFC      ALAVDALG---------------------------------------EERVRCIMLPYRY
Q63W64_BURPS      AVAVDALG---------------------------------------AERVRAVMMPSRY
Q6MGT5_BDEBA      VLAVDALG---------------------------------------PANVVGVGLPGPF
Q18H53_HALWD      ALAAEAIG---------------------------------------PSNVHGITLPSAI
D8IX05_HERSS      ALAAEALG---------------------------------------AQNVVAVTMPSVF
C9LUR9_SELS3      ALYTSVLG---------------------------------------AENVLLVNMPSRF
A4J4I7_DESRM      ALYADAIG---------------------------------------PENLLLVNMPSKF
NADE_YEAST        MIVHSMCRLVTDAAQNGNEQVIKDVRKITRSGD-D--WIPDSPQDLASKIFHSCFMGTEN
D5G3Y4_TUBMM      TIVHSMCRLVHEACENGEEQVIKDARRVCGEPE-ESTWVPRTPQELAGRIFHTCFMGTKN
NADE_SCHPO        VLVYSMCRIVCKAMEEDDAQVLSDVRRIVG----DPSYSSTDPKKLLNHLFYTAFMGSEH
NADE_DICDI        AIIGIMCQLVILDVSKGNKQVLKDAQRITNSPE-D--YIPTDSREFASRLFFTAYLGSKN
NADE_MOUSE        CIVYSMCCLVCDAVKSGNQQVLTDVQNLVD----ESSYTPQDPRELCGRLLTTCYMASEN
NADE_RAT          CVVYSMCCLVCEAVKSGNQQVLTDVQNLVD----ESSYTPQDPRELCGRLLTTCYMASEN
NADE_MACFA        CLVYSMCCQVCKSVRSGNQEVLADVRTIVN----QISYTPQDPRDLCGHILTTCYMASKN
NADE_HUMAN        CLIYSMCCQVCEAVRSGNEEVLADVRTIVN----QISYTPQDPRDLCGRILTTCYMASKN
NADE_BOVIN        CLVYSMCHQVCEAVKRGNLEVLADVRTIVN----QLSYTPQDPRELCGRVLTTCYMASEN
NADE_CHICK        CIVYSMCRQVCLAVKNGNSEVLADARKIVH----DETYIPEDPQEFCKRVFTTCYMASEN
NADE_DROME        TIVHSMCRQIVQAVQQGDAQVLHDIRQLLA----DSDYTPDNAAGLCNRLLVTCYMGSVN
NADE_ORYSI        AIVGCMCQLVVKDIENGDEQVKADAMRIGQYK---DGEFPKDSRELAKRLFYTVYMGTEN
NADE_ORYSJ        AIVGCMCQLVVKDIENGDEQVKADAMRIGQYK---DGEFPKDSRELAKRLFYTVYMGTEN
M0S5G6_MUSAM      AIVGCMCQLVIKDIEDGDDQVKADALRIGQYK---NGEFPTDSREFAKRIFYTVYMGTEN
NADE_ARATH        AIVGCMCQLVVKEIAKGDEQVKADANRIGNYA---NGQFPTDSKEFAKRIFYTVFMGSEN
A8IGM5_CHLRE      AIVGAMCQLVVAAVREGDAQVSADVRRVAGAAA-GGAALPTDARELAGRLLSCVYMGTAN
C7YLC3_NECH7      LFVYGMARLVMVSIKAGENSTLEALRRVTG----DKEFTPTTPQEIVGRLLHTCYMGTVN
C4LAL2_TOLAT      TLVWFAQVQAVLTLGEEAYAQTLAQGRINVALRGDKPLLAWIHDDVMPNVLTTVYQGSAH
Q8F1Y8_LEPIN      LLVTAMKKIAKLELGENFFKSKGIPEE---------------------SILCTLYQSTSN
I3RAN1_HALMT      AVCVDALG---------------------------------------PENVIAFNLPSAV
E7FYA0_ERYRH      ALLVKALG---------------------------------------KDRVVGVTMPSQF
S4XKD4_SORCE      LVAWRAVQLLHPGLEGEALRAQ------------------------MKASLHAFFMPSRY
                   .                                                .         

NADE_MYCBO        TGEHTKNNAIKLARALGVTFSEIDIGDTARLMLHTIGHPYS-------------------
NADE_MYCTO        TGEHTKNNAIKLARALGVTFSEIDIGDTARLMLHTIGHPYS-------------------
NADE_MYCTU        TGEHTKNNAIKLARALGVTFSEIDIGDTARLMLHTIGHPYS-------------------
NADE_MYCLE        TGDRTKSNATELCRALGVTFTEIDIRDTATLMLKKIGHPFS-------------------
A0R143_MYCS2      TGDRTKNNAVRLSRALGVTFEEIDIKQTAQLMLTEMGHPFG-------------------
Q89LJ7_BRADU      TGSESKTNALALMKSLQTNWQELDIRTTATQMLKDIGHPFG-------------------
Q9A2E6_CAUVC      TSDRTKSNAWALMKAMAVTAAELDIRPAATQMLKDLDHPFG-------------------
A9W9W6_CHLAA      TSSQTRRNAHALMTALGVSAHEIDIRPSALQMLRDLGHPAG-------------------
Q8ABA5_BACTN      TTDRTYNNAIDLMKSLGISIREISIQDACIQHFKDIDHD---------------------
Q97K69_CLOAB      TTDKTYNNAVDLCKHLGCDFREIDIVPACLLHFKDINHP---------------------
Q97I71_CLOAB      TTRRTYNNAVELMKKLGITIKEISIKKACIQHFNDIGQD---------------------
Q7URG9_RHOBA      TTQHTNDSATQLVEGLGVTSESIDIRPLALRTFLDIGHSPLGLAIDVSTKIDDLQSRLQK
NADE_SYNY3        SSDHSIQDALALAKNLGMNTQTIPIGPIMATYDQALVPLFQDA-----------------
Q8DJP2_THEEB      SSEHSITDAKDLAANLGIATQVLPIAPLMQTYSEVLAPLFAGT-----------------
Q7VA68_PROMA      SSEGSIIDANNLAKRLGIKTSTIPIASLMENYDITLKTTLGKL-----------------
Q7NHF0_GLOVI      SSAGSIDDSLALAANLGVETLKLPIAPAMAAFDQILAPAFADL-----------------
Q2S5I3_SALRD      SSEGSVTDSQALADNLGIEFKEIPIKPAVDAFDDMLADEFAGT-----------------
Q1INM5_KORVE      SSQGSIDDAAALAENLGIRFEIVPIGDVVQAFRNTLAPVFSGF-----------------
NADE_AQUAE        SSKESYEDAKALAQNLGIEFHVIPIKEIYRAYFNEFEKEICEI-----------------
NADE2_THEMA       TSKESIEDAQTLAKNLGIETFIIPITDVFHSYLETLKGVFAGR-----------------
B5YJ78_THEYD      TSRESKEDVYELVKNLGIELIEISIDEIFEEYLRRLADTFKGL-----------------
NADE_XYLFT        TAELSNDLAAEQCHSLGVRLETVAIEPVFEGLLAALGPLFAGM-----------------
NADE_XYLFA        TAELSNDLAAEQCHSLGVRLETVAIEPVFEGLLAALGPLFAGM-----------------
Q5H2H2_XANOR      TANLSNDLADEQCRALGVKLETVAIEPAFEGLLAALGPLFAGT-----------------
NADE_RHOCA        TSQGSLDDAADLARRLGARLDTVEIEGPRAAVEGALAHVLAGT-----------------
Q3J3Z6_RHOS4      TSQASLEDAAAVARALGCRLDEVGIGGPQEAVGAALGPLFEGT-----------------
A9CIT1_AGRFC      TSEESLKDAADCARALGCRYDIVPIVEPVEGFLSALSELFEGT-----------------
Q63W64_BURPS      TADISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGL-----------------
Q6MGT5_BDEBA      NAPQSLTLAKDLASNMGVDFKTVEIGPMYESVLKALNKGLGLE-----------------
Q18H53_HALWD      TTENNRTDAERVAQNLGIQFDEIGIEHLSQSLLDAINGVTPGDD----------------
D8IX05_HERSS      SSAGSVSDSETLCQALGVTLFRHPIADLVREFEDGFATAFGAP-----------------
C9LUR9_SELS3      NSETTKDLAHALAKNLGCYYAVFPIEESVQHTMEQIAATPIELLKTGE-----------K
A4J4I7_DESRM      NSQTTKNLARELAENLRCFYTVLPIQKSVDYTLKQIESTPIINAASGD-----------R
NADE_YEAST        SSKETRNRAKDLSNAIGSYHVDLKMDSLVSSVVSLFEVATG-----------KKPIYKIF
D5G3Y4_TUBMM      SSADTRARAKELADAIGAYHIDLDMDFLVKAVTDLFSLVTG-----------KRPQFRVH
NADE_SCHPO        SSKETRSRAKELSSLIGSYHTDVNIDTMTSAVVKLFALVTG-----------KTPQFRSN
NADE_DICDI        SSKETRDRAMEIAKDIGSVHKEVDIDDISQSFNDAFSQITK-----------KQPQFRAH
NADE_MOUSE        SSQETHSRATKLAQLIGSYHINLSIDTAVKAVLGIFSLMTG-----------KLPRFSAH
NADE_RAT          SSQETHNRATELAQQIGSYHISLNIDPAVKAILGIFSLVTG-----------KFPRFSAH
NADE_MACFA        SSQETCTRARELAQQIGSHHISLNIDPAVKAVTGIFSLVTG-----------KSPLFAAH
NADE_HUMAN        SSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTG-----------KSPLFAAH
NADE_BOVIN        SSQETCDRARELAQQIGSHHIGLHIDPVVKALVGLFSLVTG-----------ASPRFAVH
NADE_CHICK        SSQDTRNRAKLLAEQIGSYHINLNIDAAVKAIVGIFSMVTG-----------RTPRFSVY
NADE_DROME        SSKETRRRAAQLANQLGSYHIEISIDSAVNALLSIFNAVTG-----------LTPRFRTQ
NADE_ORYSI        SSEGTRSRAKMLAEEIGSFHLDVPIDSIVSALLSLFERLTG-----------KRPRYKVD
NADE_ORYSJ        SSEGTRSRAKMLAEEIGSFHLDVPIDSIVSALLSLFERLTG-----------KRPRYKVD
M0S5G6_MUSAM      SSEATRSRAKRLADEIGSWHLNVDIDSVVSALLSLFQTLTG-----------KRLRYKVD
NADE_ARATH        SSEETKRRSKQLADEIGAWHLDVCIDGVVSAVLSLFQTVTG-----------KRPRYKVD
A8IGM5_CHLRE      SSRETRERARALCDQVGGYHLSLSMDGVVEAVVGLFAAVVTGG---------RRPAFKAH
C7YLC3_NECH7      SSEETEGRAKKLADVLGSYHSSIKIDETVAANELMVEKALS-----------FKPKYQVE
C4LAL2_TOLAT      SGNVTRNAAAGLADEMGALHYDWSIAELVAGYLKLVNDLTP----------------DDP
Q8F1Y8_LEPIN      NSDRTKFLAKSLAKEIQSIHGDLTIDSEIQSISEKISKLT-----------------GIS
I3RAN1_HALMT      NTETTKSIAKVLAANFGVEYRTIPVQSIYDEILDTYEKHYDDI-----------------
E7FYA0_ERYRH      NRDITKNNAYHLSKVLGFKFLEIPIAAMTDATVESMKFGAYSD-----------------
S4XKD4_SORCE      SSDATHRAAAQIADDLGASFAVIPIEDAFPRELEAAQAMVGEG-----------------
                  .   .          .        :                                   

NADE_MYCBO        VGEKVYDVTFENVQAGLRT-DYLFRIAN-----------QRGGIVLGTGDLSELALGWST
NADE_MYCTO        VGEKVYDVTFENVQAGLRT-DYLFRIAN-----------QRGGIVLGTGDLSELALGWST
NADE_MYCTU        VGEKVYDVTFENVQAGLRT-DYLFRIAN-----------QRGGIVLGTGDLSELALGWST
NADE_MYCLE        RGEVSYDVTFENVQAGVRT-DYLFRLAN-----------QHGGIVLGTGDLSELGLGWST
A0R143_MYCS2      RGEKVYDVTFENVQAGLRT-DYLFRLAN-----------QRGGIVLGTGDLSEIALGWST
Q89LJ7_BRADU      KGEKVYDVTFENVQAGLRT-DYLFRLAN-----------HHGGIVIGTGDLSELALGWCT
Q9A2E6_CAUVC      RGEAVYDVTFENVQAGLRT-DYLFRLAN-----------HNAALVVGTGDLSELALGWCT
A9W9W6_CHLAA      EGAAVYDVTFENVQAGERT-SHLFRLAN-----------YHNAIVVGTGDLSELALGWCT
Q8ABA5_BACTN      --INVHDVTYENSQARERT-QILMDIAN-----------QTWGMVVGTGDLSELALGWAT
Q97K69_CLOAB      --EEKHDVTYENVQARERT-QILMDIAN-----------KEGGLLIGTGDLSELALGWCT
Q97I71_CLOAB      --LNTHDTIYENSQARERT-QILMDIAN-----------KEGAIVVGTGDLSELALGWCT
Q7URG9_RHOBA      VDVNATDLKFENVQARLRT-MLLM----------------SRGFVLGTGDLSEQALGWST
NADE_SYNY3        ----PFGLAEENLQSRIRG-NLLMAIAN-----------KFGHLLLSTGNKSELAVGYCT
Q8DJP2_THEEB      ----PSGVAEENIQARIRG-TLLMAIAN-----------KFGHLLLSTGNKSELAVGYCT
Q7VA68_PROMA      ----PQGLTAENLQARIRG-TLLMAIAN-----------EQKHLLLSTGNKSELAVGYCT
Q7NHF0_GLOVI      ----AADVTEENLQARIRG-TLMMALSN-----------KWNRLVFITGNKSETAVGFNT
Q2S5I3_SALRD      ----EPGVAEENVQSRARG-VTLMALSN-----------KFGHLLLSTGNKSEVAIGYVT
Q1INM5_KORVE      ----HEDTTEENIQARTRG-NILMSLSN-----------KFGAMVLSTGNKSELAVGYCT
NADE_AQUAE        ----TFDVADENIQARIRA-NILFYFSN-----------KFRYLVLSTSNKSETAVGYTT
NADE2_THEMA       ----EPDITEENLQARIRG-NYLMALSN-----------KFGWLVLTTGNKSEMATGYAT
B5YJ78_THEYD      ----PEDTTEENIQSRIRG-NILMAISN-----------KFGWLVITTGNKSEMAVGYAT
NADE_XYLFT        ----APDATEENLQSRSRG-VILMALAN-----------KFGGLLLTTGNKSEYAVGYAT
NADE_XYLFA        ----APDATEENLQSRSRG-VILMALAN-----------KFGGLLLTTGNKSEYAVGYAT
Q5H2H2_XANOR      ----EPDITEENLQSRSRG-VILMALSN-----------KFGGLVLTTGNKSEYAVGYAT
NADE_RHOCA        ----APDVTEENIQSRLRG-VILMAISN-----------KFGAMLLTTGNKSEVAVGYCT
Q3J3Z6_RHOS4      ----EPGITEENIQSRLRG-LLLMALSN-----------KFGEMLLTTGNKSEVAVGYCT
A9CIT1_AGRFC      ----EEGITEENLQSRTRG-TILMAVSN-----------KFGSMVVTTGNKSEMSVGYAT
Q63W64_BURPS      ----AEDATEENIQARIRG-TLLMALSN-----------KFGSIVLTTGNKSEMAVGYCT
Q6MGT5_BDEBA      ----GFSIVNENLQARLRG-LTLMAWSN-----------KENSMLLTTGNKSEYASGYST
Q18H53_HALWD      ----TRGITRENVQARVRG-LLLMGVSN-----------DLDALVLTPDNKSEAAVGYCT
D8IX05_HERSS      ----LRGLPLENLQARVRG-AILMEYSN-----------GYDALLLTTGNKSEISVGYCT
C9LUR9_SELS3      KTLAVSSFLAENIQARDRSSRILAALAA-----------AFGGGFSCNANKAETSVGYST
A4J4I7_DESRM      IQLKISSFMAENIQARDRSSRILAAVAA-----------AFGGGFTCNANKAETTVGYST
NADE_YEAST        GGSQIENLALQNIQARLRM-VLSYLFAQLLPWVRGIPN-SGGLLVLGSANVDECLRGYLT
D5G3Y4_TUBMM      GGTKTENLALQNIQARLRM-VLAYLFAQLLPWCRGK---QGGLLVLGSANVDECLRGYMT
NADE_SCHPO        GGTNAENLALQNIQARSRM-LLGYLFAQLLPWVRGY---SGSLLVLGSSNVDECLRGYLT
NADE_DICDI        GGTPRENLALQNVQARTRM-VLSYHLASLLLWEQGR---PGSLLVLGSANCDESLRGYMT
NADE_MOUSE        GGSSRENLALQNVQARIRM-VLAYLFAQLSLWSRGA---RGSLLVLGSANVDESLLGYLT
NADE_RAT          GGSSRENLALQNVQARIRM-VLAYLFAQLSLWSRGA---RGSLLVLGSANVDESLLGYLT
NADE_MACFA        GGSSRENLALQNVQARIRM-VLAYLFAQLSLWSRGI---RGGLLVLGSANVDESLLGYLT
NADE_HUMAN        GGSSRENLALQNVQARIRM-VLAYLFAQLSLWSRGV---HGGLLVLGSANVDESLLGYLT
NADE_BOVIN        GGSDRENLALQNVQARVRM-VIAYLFAQLSLWSRGA---PGGLLVLGSANVDESLLGYLT
NADE_CHICK        GGSRRENLALQNVQARVRM-VPAYLFAQLTLWTRGM---PGGLLVLGSANVDESLRGYLT
NADE_DROME        GGCARQNLALQNMQSRIRM-VLAYIFAQLTLWVRNR---PGGLLVLGSANVDESLRGYLT
NADE_ORYSI        GGSNTENLGLQNIQARIRM-VLAFMMASLMPWVHNK---SGFYLVLGSSNVDEGLRGYLT
NADE_ORYSJ        GGSNTENLGLQNIQARIRM-VLAFMMASLMPWVHNK---SGFYLVLGSSNVDEGLRGYLT
M0S5G6_MUSAM      GGSNTENLALQNIQARVRM-VLAFMLASLMPWVHSK---SGFFLVLGSSNVDEGLRGYLT
NADE_ARATH        GGSNAENLGLQNIQARMRM-VLAFMLASLLPWVHSK---PGFYLVLGSSNVDEGLRGYLT
A8IGM5_CHLRE      GGTTAENLALQVRVAVYVW-LWLWLCVCVCVC------------VCVCVCVCVCVCVCLC
C7YLC3_NECH7      GGSRAENLAKQNIQARSRM-VIAYSLAQLSTTARDLPRAGAALLVLGSGNVDENLRGYFT
C4LAL2_TOLAT      MTWERDDLALQNIQARVRS-PGIWLIANRQNK-----------LLMATSNLSEASVGYCT
Q8F1Y8_LEPIN      LRWDEHNLTLQNIQARVRS-PIIWMLANLNGH-----------LLLSTGNRSEASVGYTT
I3RAN1_HALMT      ----DSETAKENVYARVRGLLMMLVANDSP--------ADESAMLVSNGNETEMALGYVT
E7FYA0_ERYRH      ----VTGLAFENVQARLRGHTLMTVSSL------------ENGVVMNNGNKIEVALGYAT
S4XKD4_SORCE      --RQLTELTRQNVQARIRG-GRMWNWAN-----------TSGALFLQTGNMSEKALGYTT
                            :   :                             .               

NADE_MYCBO        YGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVG--------EVLQSVLDTEITP
NADE_MYCTO        YGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVG--------EVLQSVLDTEITP
NADE_MYCTU        YGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVG--------EVLQSVLDTEITP
NADE_MYCLE        YGVGDQMSHYNINAGVPKTLVQHLIRWVIASSQFEEQVD--------KVLQSVLDTEITP
A0R143_MYCS2      YGVGDQMSHYNVNGGVPKTLIQHLIRWVISSGEFNDEVN--------EVLQSVLDTEITP
Q89LJ7_BRADU      YGVGDQMAHYNVNAGVPKTLIQHLIRWVIASQQFSDDVN--------RTLASILSAEISP
Q9A2E6_CAUVC      YGVGDHMSHYNPNCGAPKTLIQHLIRFVAHSGDVGAETT--------ALLDDILATEISP
A9W9W6_CHLAA      YGVGDQMAHYNVNASVPKTLIQHLIRYVIRSGELGDEAN--------RVLESILATEISP
Q8ABA5_BACTN      YN-GDHMSMYGVNGSIPKTLVKYLVQWVAEND-MDEDAK--------ATLLDIVDTPISP
Q97K69_CLOAB      YN-GDHMSMYAVNCSIPKTLVRYLVDYVAEKE-LTGEVS--------KTLIDILNTPVSP
Q97I71_CLOAB      YN-GDQMSMYGVNSSIPKTLVKYLIMWYAEAS-KDNDIR--------NILLDIYNTPVSP
Q7URG9_RHOBA      YN-GDHMSMYNVNASVPKTLVRYLVQYAADHR-YRSSLH--------ETLHRIADTPISP
NADE_SYNY3        LY-GDMNGGLAAIADVPKTQVFELCRWLNREQT--------------IIPPSVLTKPPSA
Q8DJP2_THEEB      LY-GDMNGGLAAIADVPKTRVYELCHWLNGQAAQGRPIPDLPIAGPVVIPPHILSKAPSA
Q7VA68_PROMA      LY-GDMNGGLAVIGDLYKTNIFDLCHWLDSNNAYQCRSDLGLPKTGDLVGSAILNKPPSA
Q7NHF0_GLOVI      LY-GCTAGALAVIADLYKGEVYRLAHWLNRDGA--------------VIPEGILTKAPSA
Q2S5I3_SALRD      LY-GDTNGGVAVLSDVLKTRVYELARHINVRAG------------ANVIPQNTIEKPPSA
Q1INM5_KORVE      LY-GDMAGGLAVISDVPKTMVYRLSHYVNRGRE--------------IIPQNTITKPPSA
NADE_AQUAE        IY-GDMAGGFAPIKDVYKTWVYKLARYRNSISPD--------------IPERVFKKPPSA
NADE2_THEMA       LY-GDMAGGFAVIKDVYKTDVYRIGRWYNSWRGKE------------IIPENIFVKPPTA
B5YJ78_THEYD      LY-GDMAGGFAVIKDVYKTQVYRVAKWAS--RDR--------------IPERIFKKPPSA
NADE_XYLFT        IY-GDMCGGYAPLKDIYKSQVFELAQWRNRVSD------------VLAIPPGVIHRPPSA
NADE_XYLFA        IY-GDMCGGYAPLKDIYKSQVFELAQWRNTVSD------------VLAIPPGVIHRPPSA
Q5H2H2_XANOR      IY-GDMCGGYAPLKDLYKTEVFGLAKWRNTVDG------------APVIPPAVISRPPSA
NADE_RHOCA        IY-GDMAGGYNPLKDLYKTRVFETCRWRNATHRPWMQAP-----AGEIIPVAIIDKPPSA
Q3J3Z6_RHOS4      IY-GDMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGP-----EGEVIPPRVIDKPPSA
A9CIT1_AGRFC      LY-GDMNGGFNPIKDLYKMQVYAISSWRNAHVPPGALGP-----SGEVIPANIIAKAPSA
Q63W64_BURPS      LY-GDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGAL---------DVIPERILTRAPSA
Q6MGT5_BDEBA      LY-GDMCGGLAPLGDLTKAQVYALARYYNKQGE--------------VIPQEIIDRPPSA
Q18H53_HALWD      LY-GDAVGAIAPLGDCTKRRVYALAEDFNTDIPTWADST--------PIPHSVIQKAPTA
D8IX05_HERSS      LY-GDTNGGLGLIGDLYKTEVYALARHLNAQAGR------------EIIPAAIIDKAPSA
C9LUR9_SELS3      LY-GDQAGFLAALADLWKHQVYDLARYMNEHIFKR-----------EVVPQATIDIVPSA
A4J4I7_DESRM      LY-GDQAGFLAAIADLWKYQVYDLARYLNQQVYHR-----------EVIPQGIIDIVPSA
NADE_YEAST        KY-DCSSADINPIGGISKTDLKRFIAYASKQ-------------YNMPILNDFLNATPTA
D5G3Y4_TUBMM      KY-DCSSADINPIGGISKTDLKRFISYATAK-------------FNLPILHSFLTAIPTA
NADE_SCHPO        KY-DCSSADINPIGGISKTDLKSFLRYAKEA-------------LDLPILQEFLDATPTA
NADE_DICDI        KY-DCSSADINPIGGMSKIDLRSFIEWAGKF-------------RDMKSILSVLTATPTA
NADE_MOUSE        KY-DCSSADINPIGGISKTDLRAFVQFCAER-------------FQLPVLQTILSAPATA
NADE_RAT          KY-DCSSADINPIGGISKTDLRAFVQLCAER-------------FQLPVLQAILSAPATA
NADE_MACFA        KY-DCSSADINPIGGISKTDLRAFVQFCIER-------------FQLTALQSIISAPVTA
NADE_HUMAN        KY-DCSSADINPIGGISKTDLRAFVQFCIQR-------------FQLPALQSILLAPATA
NADE_BOVIN        KY-DCSSADINPIGGISKTDLRAFVQLCVER-------------FQLPALQSILAAPATA
NADE_CHICK        KY-DCSSADINPIGGISKTDLKNFIQYCIEN-------------FQLTALRSIMAAPPTA
NADE_DROME        KY-DCSSADINPIGGISKMDLRRFLTYAKDK-------------FNLPVLESIIDAPPTA
NADE_ORYSI        KY-DCSSADINPIGSVSKQDLRAFLRWAAVH-------------LHYSSLAEVEAAPPTA
NADE_ORYSJ        KY-DCSSADINPIGSVSKQDLRAFLRWAAVH-------------LHYSSLAEVEAAPPTA
M0S5G6_MUSAM      KY-DCSSADINPIGSVSKQDLRSFLRWAAIH-------------LHYPSLAEVEAAPPTA
NADE_ARATH        KY-DCSSADINPIGSISKMDLRLFLKWAATN-------------LGYPSLAEIEAAPPTA
A8IGM5_CHLRE      LC-LCPKLERTPALCVCVCDLRSFLQWAATH-------------LHYPVLAEVEAAPPTA
C7YLC3_NECH7      KY-DASSADLAPLGSISKNDAKDFQRWARAN-------------WDLPILTDFIDATPTA
C4LAL2_TOLAT      MD-GDTSGVLSPIGGVSKSRVLQINRYIMEQGIPLQDSPDLPR-LALAAMEAIVNQAPTA
Q8F1Y8_LEPIN      MD-GDSSGSIAPLTGVSKEFILKWLRFVSEGKDPILP--------AYPSIKEIVNSPPSA
I3RAN1_HALMT      LY-GDMDGGLDILGDLSKMEVYDVARYVNERHGE------------ELIPAETFEIEPSA
E7FYA0_ERYRH      LY-GDAIGALAILGDLTKMEVGMIGRTLNRIEGQ------------EIVPENLIPVELEN
S4XKD4_SORCE      VG-GDLEGAFSVIANLPKTVVIALIERLSQRFGF-------------KGIQQTLATTAGP
                                                                              

NADE_MYCBO        ELIPT-GEEEL-------------QSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWH
NADE_MYCTO        ELIPT-GEEEL-------------QSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWH
NADE_MYCTU        ELIPT-GEEEL-------------QSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWH
NADE_MYCLE        ELIPSDGEEKL-------------QSTEAKVGPFALQDFSLFQVLRYGFRPSKIAFLTWH
A0R143_MYCS2      ELVPTGEDEEI-------------QSSEAKVGPYALQDFSLFQVLRFGFRPSKVAFLAWH
Q89LJ7_BRADU      ELVPVKPGEKP-------------QSTEASVGPYELQDFNLFYTLRFGMRPSKIAFMALQ
Q9A2E6_CAUVC      ELVPGEA----------------VQATESFVGPYALQDFNLYYMTRYGMAPSKIAFLAWS
A9W9W6_CHLAA      ELVPASSSDDKP-----------AQRTEEIIGPYALQDFNLYYITRYGFRPGKVAFLAMH
Q8ABA5_BACTN      ELIPADENGEI------------KQKTEDLVGPYELHDFFLYYFLRFGFRPSKIYYLANI
Q97K69_CLOAB      ELLPKDAKGNI------------SQKTEDIIGPYELHDFFLYYFIKQGSEPEKIIFMAEK
Q97I71_CLOAB      ELLPPDKEGNI------------KQKTEDLIGSYELNDFFLYNMLRSGYEPLKILYLANI
Q7URG9_RHOBA      ELLPPTEDGEI------------RQNTEASIGPYELHDFFLYHFVRGGCDVAKMCFMAEQ
NADE_SYNY3        ELKPGQVDTD-------------------SLPPYDVLDGILGRLVEKH------------
Q8DJP2_THEEB      ELKPGQRDQD-------------------SLPPYDILDGILARMIDRH------------
Q7VA68_PROMA      ELSPNQLDSD-------------------SLPDYEVLDKILKALIEDR------------
Q7NHF0_GLOVI      ELRPDQRDSD-------------------ILPPYDVLDGILRAHLEGG------------
Q2S5I3_SALRD      ELRAGQKDTD-------------------TLPPYETLDAILERYVEQK------------
Q1INM5_KORVE      ELRPNQKDTD-------------------SLPEYEVLDAILDDYVEEM------------
NADE_AQUAE        ELRPNQTDQD-------------------VLPPYEILDQILMLYIEEN------------
NADE2_THEMA       ELRPGQTDQE-------------------KLPPYEVLDEILRLYIEEG------------
B5YJ78_THEYD      ELRPGQTDQD-------------------TLPPYEILDEILKRHIEKC------------
NADE_XYLFT        ELRAQQTDQD-------------------SLPPYEVLDGILSLYVDQE------------
NADE_XYLFA        ELRAQQTDQD-------------------SLPPYEVLDGILSLYVDQE------------
Q5H2H2_XANOR      ELRDNQTDQD-------------------SLPPYDVLDAILYRYVDQE------------
NADE_RHOCA        ELRENQTDQD-------------------SLPPYEVLDAILERLVEGD------------
Q3J3Z6_RHOS4      ELREDQKDED-------------------SLPPYATLDAILEGLVDRE------------
A9CIT1_AGRFC      ELRPNQTDQD-------------------SLPPYPVLDDILECLVEKE------------
Q63W64_BURPS      ELRENQTDQD-------------------SLPPYDVLDAIMRMYMEED------------
Q6MGT5_BDEBA      ELRPNQKDQD-------------------SLPEYDDLDKAVTYLVEKS------------
Q18H53_HALWD      ELAEGQTDVD-------------------DIPPYEITDAVVSQYVGDK------------
D8IX05_HERSS      ELAPDQRDTD-------------------SLPPYEVLDEILKWHIEGSRLPA--------
C9LUR9_SELS3      ELSDAQNVDEGKGDPLLYPYHDYLFRAFVERWEKATPEDILDWYVKGTLEQQ--------
A4J4I7_DESRM      ELSFDQAVDDGKGDPLVYPYHDYLFRAFVQWWDKATPEDILTWYGDGNLEEK--------
NADE_YEAST        ELEPMTK--DYVQSDEID-----------MGMTYEELGVFGYLRKVEKCGPYSMFLKLLH
D5G3Y4_TUBMM      ELEPITS--TYVQSDEAD-----------MGFTYDELSTFGQLRKNHKLGPWSAFNRLLH
NADE_SCHPO        ELEPTTE--SYVQSDEAD-----------MGMTYAELSVFGRLRKISKCGPYSMFTQLMH
NADE_DICDI        ELEPITE--NYTQSDEID-----------MGMTYEELSIFGKLRKVNRCGPVSMFERLVA
NADE_MOUSE        ELEPLAD-GQVSQMDEED-----------MGMTYAELSIFGRLRKVAKAGPYSMFCKLLN
NADE_RAT          ELEPLAD-GQVSQMDEED-----------MGMTYTELSIFGRLRKVAKAGPYSMFCKLLN
NADE_MACFA        ELEPLAD-GQVSQTDEED-----------MGMTYAELSVYGKLRKVAKMGPYSMFCKLLG
NADE_HUMAN        ELEPLAD-GQVSQTDEED-----------MGMTYAELSVYGKLRKVAKMGPYSMFCKLLG
NADE_BOVIN        ELEPLAH-GRVSQTDEED-----------MGMTYAELSVYGRLRKVAKTGPYSMFCKLLD
NADE_CHICK        ELEPLMD-GQVSQTDEAD-----------MGMTYAELSIYGKLRKIAKAGPYSMFCKLIN
NADE_DROME        ELEPLQENGELQQTDEAD-----------MGMTYAELSQFGRLRKQSFCGPYSMFCHLVA
NADE_ORYSI        ELEPIRA--DYNQLDEVD-----------MGMTYEELSIYGRLRKIFRCGPVSMFQNLCH
NADE_ORYSJ        ELEPIRA--DYNQLDEVD-----------MGMTYEELSIYGRLRKIFRCGPVSMFQNLCH
M0S5G6_MUSAM      ELEPIRS--DYNQLDEVD-----------MGMTYEELSIYGRLRKIFRCGPVSMFQNLCH
NADE_ARATH        ELEPIRS--DYSQLDEVD-----------MGMTYEELSVYGRMRKIFRCGPVSMFKNLCY
A8IGM5_CHLRE      ELEPLIE-GQQPQLDEVD-----------MGMTYAELTLYGRLRKVARAGPVAMYNACAA
C7YLC3_NECH7      ELLPLSA-GVQDDESEQE-----------MGMTYEELSVFGILRKVDKLGPWSAYLRLLS
C4LAL2_TOLAT      ELRPVE-------QTDEA-----------DLMPYPVMDAIRRINQTQNVTPKGVLQVLLR
Q8F1Y8_LEPIN      ELKPPED-----KQEDEK-----------DLMPYPLLQKIEELFIVRGAGYSEIIQLLSE
I3RAN1_HALMT      ELAADQVDPFD------------------YSTVAPLVDDLLENRMDPAELVAQFETEELD
E7FYA0_ERYRH      RVDWEFAPSAELAQDQFDPMKWGYHDLLIDELMHGRLGIVLNSYLDGSIYESNLGK----
S4XKD4_SORCE      ELAENQSGEA-------------------ELMPFEVLDACLYLYGAEKLAADELAAA---
                  .:                                                          

NADE_MYCBO        AWNDAERGNWPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGA
NADE_MYCTO        AWNDAERGNWPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGA
NADE_MYCTU        AWNDAERGNWPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGA
NADE_MYCLE        AWSDPNCGKWPPGFPEDKRLSYSLKEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGA
A0R143_MYCS2      AWHDVGAGDWPPGFPEHERPSYSLKEIRHWLQVFAQRFYSFSQFKRSAMPNGPKVSHGGA
Q89LJ7_BRADU      AWKDVAKGEWPPAFPNDRRKAYELPEIRRWLEVFLRRFFAFSQFKRSAMPNGPKVSAGGS
Q9A2E6_CAUVC      AWHDADQGGWPVGLPDNARRAYDLPEIKRWLELFLKRFFA-NQFKRSAVPNGPKISSGGA
A9W9W6_CHLAA      AWGNADVGAWPEGLPANERRAYDLPTILHWLRVFLFRFFQISQFKRSAMPNGPKVGSGGS
Q8ABA5_BACTN      A----------------FKDVYDKETIKKWLSTFFRRFFN-QQFKRSCLPDGPKVGSI-S
Q97K69_CLOAB      A----------------FKNTYSRETIEKWFNLFIKRFFN-QQFKRSAIPDGPKVGTI-S
Q97I71_CLOAB      A----------------FKDKYSEDVIHSALKNFYKRFFT-QQFKRNCMPDGVKIGSV-S
Q7URG9_RHOBA      TK---------------FDLPHSAELIEATAKTFVRRFFQ-NQFKRNCVPDGPKIGSV-S
NADE_SYNY3        ---------------QSPQEIINA-GFEREVVLKICQLVQKSEFKRRQAAPGLKVTDR--
Q8DJP2_THEEB      ---------------QSDQEIAAA-GYDLDLVQHVRRMVQRAEFKRQQAAPGLKITDR--
Q7VA68_PROMA      ---------------SNYKTLASK-EYPSALVTKVKKLLKNAEFKRRQAPPTLKVSEQ--
Q7NHF0_GLOVI      ---------------RTPEEIAGE-GYHPEVIKKVLAMVRRAEFKRKQLPPGLRVSPR--
Q2S5I3_SALRD      ---------------KELGTIVGETGLDEDLVRGVLRQVDQNEYKRRQAPPGLRVTEK--
Q1INM5_KORVE      ---------------KSAKEIAEAHGFDIALVRRVIALIERTEYKRQQAAPGLKISTK--
NADE_AQUAE        ---------------LSPEEIIRK-GLPRDAVYKTINMIRKNEYKRKQAPIGPKITSR--
NADE2_THEMA       ---------------LDPEEIASK-GFDRKTVLDVTEMIRKNEYKRKQAAIGVKISTR--
B5YJ78_THEYD      ---------------MSEEEIVEQ-GFDRDTVRKVLRMVKKAEFKRRQSPPGIKISPV--
NADE_XYLFT        ---------------QSREDIIAA-GYAAGVVDYVLNLVRINEWKRHQAAPGPKVSQR--
NADE_XYLFA        ---------------QSREDIIAA-GYAAGVVDYVLNLVKINEWKRHQAAPGPKVSQR--
Q5H2H2_XANOR      ---------------QSRDDIVAA-GYAAETVEHVLRLVRLNEWKRHQSAPGPKVSRR--
NADE_RHOCA        ---------------QSVDQIVAA-GFDRATVKRIEHLLYISEWKRFQSAPGPRLTTR--
Q3J3Z6_RHOS4      ---------------EGVAELVAR-GFERETVARIERLILGSEWKRFQSAPGTRLTRR--
A9CIT1_AGRFC      ---------------MSVEEILAR-GHDVATVHRVEHLLYLAEYKRRQSAPGVKITKK--
Q63W64_BURPS      ---------------RPLAEIVAA-GYAEADVKRVTRLIKINEYKRRQAPVGIRVTHR--
Q6MGT5_BDEBA      ---------------GPAKSATEK---------WLLPVLMRTEFKRWQAPPILKVSQH--
Q18H53_HALWD      ---------------YPLTQIVEETNATKEQVKTVVENITQSEFKRKQTPPALRVTTK--
D8IX05_HERSS      ---------DEAQAAARTVEQLSGTDTGAALVERICRMVARNEYKRRQSPPVIRLRSR--
C9LUR9_SELS3      ---------IGCEKGLVKKYFQTPKDFVADLERWWNLFSGLAVAKRIQAPPILAVSRR--
A4J4I7_DESRM      ---------LGCAPGLVKKIFPSAKEFISDLERWWKQFTGIGVAKRIQAPPILAVSRR--
NADE_YEAST        ---------------QWSP--KLTPRQISEKVKRFFFFYAINRHKQTVLTPSYHAEQYSP
D5G3Y4_TUBMM      ---------------EWGD--RMSPRAIATKTRNFFYYYAINRHKMTVLTPAYHAEQYSP
NADE_SCHPO        ---------------QWGD--RLSPSQVAEKVKRFFHYYGINRHKMTTLTPSYHAETYGV
NADE_DICDI        ---------------DWA---HLEPSVVAEKVKRFFYYYAINRHKLTTLTPSYHAEGYSP
NADE_MOUSE        ---------------MWRD--SYTPTQVAEKVKLFFSKYSMNRHKMTTLTPAYHAENYSP
NADE_RAT          ---------------MWKD--SCTPRQVAEKVKRFFSKYSINRHKMTTLTPAYHAENYSP
NADE_MACFA        ---------------MWRH--VCTPRQVADKVKWFFTKHSMNRHKMTTLTPAYHAENYSP
NADE_HUMAN        ---------------MWRH--ICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSP
NADE_BOVIN        ---------------MWRD--TCSPRQVADKVKCFFSKYSMNRHKMTTLTPAYHAESYSP
NADE_CHICK        ---------------LWKE--ICTPREVASKVKHFFRMYSVNRHKMTTLTPSYHAENYSP
NADE_DROME        ---------------TWKS--DLSPKEVAEKVKHFFLCYAINRHKMTVLTPSVHAESYSP
NADE_ORYSI        ---------------RWCG--TLSPSEVADKVKHFFKYYAINRHKMTVLTPSYHAESYSP
NADE_ORYSJ        ---------------RWCG--TLSPSEVADKVKHFFKYYAINRHKMTVLTPSYHAESYSP
M0S5G6_MUSAM      ---------------KWCG--KLTPSEVAEKVKHFFKYYSINRHKMTVLTPSYHAESYSP
NADE_ARATH        ---------------KWGT--KLSPAEVAEKVKYFFKYYSINRHKMTVLTPSYHAESYSP
A8IGM5_CHLRE      ---------------LWRG--RLAPQAIAAKVKDFFRFYSMNRHKATVLTPAYHMESYSP
C7YLC3_NECH7      ---------------DWSHRPGYGPRQIAEKVFRFFRFYSINRHKSTIITPSVHLCPYNP
C4LAL2_TOLAT      ---------------GEYAQ-MYSKEQLVAWIKRYFGLYCRNQWKRERIAASFHIEADSA
Q8F1Y8_LEPIN      ---------------DSEIQ-NLPPKFLEESVKKYISLFHKNQWKRERLPPSFHLDDYGL
I3RAN1_HALMT      SE-------RYRDRQGRSVYDRYTIEAFEETVYDTYNRLTRSTFKRVQAPPIIAVSSR--
E7FYA0_ERYRH      ---------------YLASYGLDKGEAFVEDIQWVLKTMNTAVYKRVQMPPIVMVSNCAF
S4XKD4_SORCE      ---------------LPSLFPDKDPAALGAWAEKFATLFSRSIFKWVQSPIAIHLGSLDL
                                                              *    .          

NADE_MYCBO        LSPRGDWRAPSDMSARIWLDQIDREVPKG-------------------------------
NADE_MYCTO        LSPRGDWRAPSDMSARIWLDQIDREVPKG-------------------------------
NADE_MYCTU        LSPRGDWRAPSDMSARIWLDQIDREVPKG-------------------------------
NADE_MYCLE        LSPRGDWRAPSDMSARIWLDEIEREVPEE-------------------------------
A0R143_MYCS2      LSPRGDWRAPSDMSARIWLDEIEREIPES-------------------------------
Q89LJ7_BRADU      LSPRGDWRAPSDSSAAAWLEDLDRNVPN--------------------------------
Q9A2E6_CAUVC      LSPRGDWRMPSDATADAWLAELRTNAPI--------------------------------
A9W9W6_CHLAA      LSPRGDWRAPSDARATVWLAELDRVVAEVGDTLEKKHWDVRNA-----------------
Q8ABA5_BACTN      ISPRGDWRMPSDASSTIWLKEIEDL-----------------------------------
Q97K69_CLOAB      LSPRGDLRMPSDASYNGWK-----------------------------------------
Q97I71_CLOAB      LSPRGDLRMPSDASYGLWMDEL--------------------------------------
Q7URG9_RHOBA      LSPRGDWRMPADASSAAFRD----------------------------------------
NADE_SYNY3        -AFGSGWRMPIAQAFHPQGS----------------------------------------
Q8DJP2_THEEB      -AFGSGWRMPIAAQW---------------------------------------------
Q7VA68_PROMA      -AFGSGWRIPIAST----------------------------------------------
Q7NHF0_GLOVI      -AFGIGWRMPIAHA----------------------------------------------
Q2S5I3_SALRD      -AFGIGRRIPIVMEWDREAMEALAAEEPVSNL----------------------------
Q1INM5_KORVE      -AFGVGRRFPIAARSDLA------------------------------------------
NADE_AQUAE        -AFGKDWRMPVTNKFFK-------------------------------------------
NADE2_THEMA       -AFGKDWRMPITNRFKEPL-----------------------------------------
B5YJ78_THEYD      -SLGKDWRFPITNRFGE-------------------------------------------
NADE_XYLFT        -AFGRERRYPISNAYRG-------------------------------------------
NADE_XYLFA        -AFGRERRYPISNAYRG-------------------------------------------
Q5H2H2_XANOR      -AFGRERRYPITNGYRGQ------------------------------------------
NADE_RHOCA        -AFWLDRRYPMVNRWRDQS-----------------------------------------
Q3J3Z6_RHOS4      -AFWLDRRYPMVNRWRDAGGA---------------------------------------
A9CIT1_AGRFC      -NFGRDRRYPITNRFRDR------------------------------------------
Q63W64_BURPS      -AFGRDWRYPITSRFIESID----------------------------------------
Q6MGT5_BDEBA      -SFGRGRRYPVAHRAREI------------------------------------------
Q18H53_HALWD      -AFDSGWRYPIAASYDEIFTDN--------------------------------------
D8IX05_HERSS      -AFGSGRQIPIAVRY---------------------------------------------
C9LUR9_SELS3      -SYGFDHREAQNGAYYTRAYRNLKEALLK-------------------------------
A4J4I7_DESRM      -AFGFDHREAQNGVYFTRKYKQLKEQLLS-------------------------------
NADE_YEAST        EDNRFDLRPFLINPRFPWASRKIDEVVEQCEAHKGSTLDIMSID----------------
D5G3Y4_TUBMM      DDNRFDLRPFL-YPPFSWPFRKIEETVAAINAREKMD-----------------------
NADE_SCHPO        DDNRYDLRQFL-YPSWTWQNKKIDALASKFEQHQRK------------------------
NADE_DICDI        DDNRYDHRQFLYNSKWDVQFETIDKIVLRLSQRPQLKNTVNCPNQASLTQQ---------
NADE_MOUSE        DDNRFDLRPFLYNTRWPWQFLCIDNQVLQLERKASQTREEQVLEHFKEPSPIWKQLLPKD
NADE_RAT          DDNRFDLRPFLYNTRWPWQFLCIDNQVVQLERKTSQTLEEQIQEHFKEPSPIWKQLLPKD
NADE_MACFA        EDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAAPQSLDGVD------------------
NADE_HUMAN        EDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD------------------
NADE_BOVIN        DDNRFDLRPFLYNTRWPWQFRCIENQVLQLEGRQRQELDGVD------------------
NADE_CHICK        DDNRFDLRPFLYNTTWSWQFRCIDNQVSHLEKKEGISVAEDTD-----------------
NADE_DROME        DDNRFDHRPFLYRPNWSWQFKAIDDEAEKLQPIYTPSSAQLRPSSEDLLISTQRSSHLDD
NADE_ORYSI        EDNRFDLRQFLYNARWPYQFRKIDELVQDMDKDGKWVNSTEGELRRRKGVRSAEGGGMGV
NADE_ORYSJ        EDNRFDLRQFLYNARWPYQFRKIDELVQDMDKDGKWVNSTEGELRRRKGVRSAEGGGMGV
M0S5G6_MUSAM      EDNRFDLRQFLYNSRWPYQFRKIDELINKA-ADQRAANLPEQRPED-SDIKSGCGSGTGV
NADE_ARATH        EDNRFDLRQFLYNSKWPYQFKKIDEIVDSLNGDSVAFPEEE----------ANSNKEIGV
A8IGM5_CHLRE      DDNRFDHRQFLYNIR---------------------------------------------
C7YLC3_NECH7      DDNRHDLRPFLYVVDWPWQFGKIRAHVEKLEANLAEKKDVD-------------------
C4LAL2_TOLAT      DPK--------TYRRFPILANQLKRELAEMEAFARQL-----------------------
Q8F1Y8_LEPIN      DPK--------SSFRFPILSEDIEL-----------------------------------
I3RAN1_HALMT      -AFGTDFREPIINKWDGRPLDWDEVG----------------------------------
E7FYA0_ERYRH      GTVYRESQLRLHLTQTEQNLMNQIKNL---------------------------------
S4XKD4_SORCE      DRERALQLPVVQRTEWKGG-----------------------------------------
                                                                              

NADE_MYCBO        ------------------------------------------------------------
NADE_MYCTO        ------------------------------------------------------------
NADE_MYCTU        ------------------------------------------------------------
NADE_MYCLE        ------------------------------------------------------------
A0R143_MYCS2      ------------------------------------------------------------
Q89LJ7_BRADU      ------------------------------------------------------------
Q9A2E6_CAUVC      ------------------------------------------------------------
A9W9W6_CHLAA      ------------------------------------------------------------
Q8ABA5_BACTN      ------------------------------------------------------------
Q97K69_CLOAB      ------------------------------------------------------------
Q97I71_CLOAB      ------------------------------------------------------------
Q7URG9_RHOBA      ------------------------------------------------------------
NADE_SYNY3        ------------------------------------------------------------
Q8DJP2_THEEB      ------------------------------------------------------------
Q7VA68_PROMA      ------------------------------------------------------------
Q7NHF0_GLOVI      ------------------------------------------------------------
Q2S5I3_SALRD      ------------------------------------------------------------
Q1INM5_KORVE      ------------------------------------------------------------
NADE_AQUAE        ------------------------------------------------------------
NADE2_THEMA       ------------------------------------------------------------
B5YJ78_THEYD      ------------------------------------------------------------
NADE_XYLFT        ------------------------------------------------------------
NADE_XYLFA        ------------------------------------------------------------
Q5H2H2_XANOR      ------------------------------------------------------------
NADE_RHOCA        ------------------------------------------------------------
Q3J3Z6_RHOS4      ------------------------------------------------------------
A9CIT1_AGRFC      ------------------------------------------------------------
Q63W64_BURPS      ------------------------------------------------------------
Q6MGT5_BDEBA      ------------------------------------------------------------
Q18H53_HALWD      ------------------------------------------------------------
D8IX05_HERSS      ------------------------------------------------------------
C9LUR9_SELS3      ------------------------------------------------------------
A4J4I7_DESRM      ------------------------------------------------------------
NADE_YEAST        ------------------------------------------------------------
D5G3Y4_TUBMM      ------------------------------------------------------------
NADE_SCHPO        ------------------------------------------------------------
NADE_DICDI        ------------------------------------------------------------
NADE_MOUSE        P-----------------------------------------------------------
NADE_RAT          P-----------------------------------------------------------
NADE_MACFA        ------------------------------------------------------------
NADE_HUMAN        ------------------------------------------------------------
NADE_BOVIN        ------------------------------------------------------------
NADE_CHICK        ------------------------------------------------------------
NADE_DROME        SKHSSPLSSASASASIDVGISTAAVPLPGAAAPGGLSKKPSGYSKVHVNVLGKIKDRTGI
NADE_ORYSI        VAVGSANPSAGS------------------------------------------------
NADE_ORYSJ        VAVGSANPSAGS------------------------------------------------
M0S5G6_MUSAM      VAVGSSNTNAGL------------------------------------------------
NADE_ARATH        VAANSGDPSAGL------------------------------------------------
A8IGM5_CHLRE      ------------------------------------------------------------
C7YLC3_NECH7      ------------------------------------------------------------
C4LAL2_TOLAT      ------------------------------------------------------------
Q8F1Y8_LEPIN      ------------------------------------------------------------
I3RAN1_HALMT      ------------------------------------------------------------
E7FYA0_ERYRH      ------------------------------------------------------------
S4XKD4_SORCE      ------------------------------------------------------------
                                                                              

NADE_MYCBO        --
NADE_MYCTO        --
NADE_MYCTU        --
NADE_MYCLE        --
A0R143_MYCS2      --
Q89LJ7_BRADU      --
Q9A2E6_CAUVC      --
A9W9W6_CHLAA      --
Q8ABA5_BACTN      --
Q97K69_CLOAB      --
Q97I71_CLOAB      --
Q7URG9_RHOBA      --
NADE_SYNY3        --
Q8DJP2_THEEB      --
Q7VA68_PROMA      --
Q7NHF0_GLOVI      --
Q2S5I3_SALRD      --
Q1INM5_KORVE      --
NADE_AQUAE        --
NADE2_THEMA       --
B5YJ78_THEYD      --
NADE_XYLFT        --
NADE_XYLFA        --
Q5H2H2_XANOR      --
NADE_RHOCA        --
Q3J3Z6_RHOS4      --
A9CIT1_AGRFC      --
Q63W64_BURPS      --
Q6MGT5_BDEBA      --
Q18H53_HALWD      --
D8IX05_HERSS      --
C9LUR9_SELS3      --
A4J4I7_DESRM      --
NADE_YEAST        --
D5G3Y4_TUBMM      --
NADE_SCHPO        --
NADE_DICDI        --
NADE_MOUSE        --
NADE_RAT          --
NADE_MACFA        --
NADE_HUMAN        --
NADE_BOVIN        --
NADE_CHICK        --
NADE_DROME        PV
NADE_ORYSI        --
NADE_ORYSJ        --
M0S5G6_MUSAM      --
NADE_ARATH        --
A8IGM5_CHLRE      --
C7YLC3_NECH7      --
C4LAL2_TOLAT      --
Q8F1Y8_LEPIN      --
I3RAN1_HALMT      --
E7FYA0_ERYRH      --
S4XKD4_SORCE      --