CLUSTAL format seed alignment for MF_02091

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D5QHT3_KOMHA          ---------------MDTSTTDDNAPRLLMRLTVALFLGYMAVALSLPVIAVYVTQWPGY
A0A4Y3TMP0_9PROT      ---------------------MKTTPTFLPRLTLALFLSYLSVALSLTAVPVFVLSWPGF
A0A060QKI6_9PROT      ---------MTANDASAQSLRSEASARHLPFLTIALLFSYMAVAMPLAVIPPFVTSWPGY
A0A023D7A1_ACIMT      ---------------MPDVEQADRAYRRVLVLTAALFLSYLTVAMSLPAVPVHVVHGLGL
A5G0M5_ACICJ          ---------------MPIAASPAAAQRRVIVLTGILFVSYLTVAMALPTVPIEVHDRLGL
V2IR34_9BURK          ---------MKEWRSMSNVLQ-DSSLRRLVWMTVALFLTYLAVAMAMPAVALHVVQALGM
Q7NWW8_CHRVO          ---------------MSEVLSFSQAYRRLLAKTAALFLSYLAVAMTLPVTSIYVIDQLHY
M1WJT7_PSEP2          -------------------MPHLSLGRSLLRMGAAVFISYLSVALALPVISVYVRSEFGF
I8RA14_9FIRM          -------------------MSKISLKQSLSKLGIAIFLTYLSVAMALPVVSVFVKEVLNL
B8J4I4_DESDA          ---------------------MQKDTRCLLWNTAALLFSYMAVAMPLPVISVFVTRHLGL
A0A023D7A3_ACIMT      ---------------------------MLRRIGVLLFLSYLAVGMSLPTTSLFVREQLHM
A0A270BDL9_9PROT      -------------MPSIPTAQQDKAPQWLAWLAVALFLSYLAVAMSMPTTSVYVATSLHM
A0A158MA61_9BORD      ---------------MFPFFRSVPHGARLLWLTAVLFVCYLCIGMSFPVVPVYVADTLGL
W0I3W5_9GAMM          ---------------MTKLSRRDAGQVRLWIVSAVLFVSYLCVAIPLPVVPVFTTRQLGL
YFCJ_ECOLI            ------------MTAVSQTETRSSANFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHELGY
D8MUZ3_ERWBE          -------------MSTTLSERSAKPTTSLASISFAVFLTYLTAGLALPVIPLFVHQELGL
A0A097R2N9_HAFAL      -------------MSQSHFISTPKANHALFPLTSAVFLTYLTVGLPLPVIPLYVHNQLGM
C3X8M5_OXAFO          -------------MSVDKSIRVSEENRHLGSLTFAIFLTYLTVGLPLPVIPLFVYNELNL
W0HKU8_9GAMM          ------------MYAEPTTLGTIPANKTLFSLCSAVFLCYLTVALPLPVIPLYVHDELGL
A0A0J8YTB6_9GAMM      -------------MTEDKCRPEERSVKPVAVTSFAVFLTYLTAGIALPVIPLFVHDGLGM
Q6F9M3_ACIAD          --------MTQPKPSLTNTALDVRYSNTLYPLVIALFLSYLTISAPLAVIPLYVHDHLQL
I0QRC9_9GAMM          ---------------MSILIQEQHPQRLLLRISIAMFIAYLAIGLPLGILPLYVHQQLGL
Y4428_SALTY           ---------------MPALTQHSTSITLF-RISAAMFLNYLTIGIPLVMLPLYVQQQLHL
D4GCW6_PANAM          ----------MPMRLSTAVFNDRQSTLHVLRISFAMFFAYMTIGLSLTVVPLYVHNILGY
S7VDN3_9DELT          MPHAPGQTAPQPPTPGRLPDGEGAATGRLLLLCLAVFVCYLTVGVPLPVIPLFVRHSLGF
H8L4S5_FRAAD          ------MNLKSVSRPAIAAPVEQGLERWLCLLSVTVFLAYLTVGLPLPVISLFVHQQLGL
A0A0B4XL39_9GAMM      ------MRTTFPPAPERL----------LAVLCFSTFLGFLTVGLPLPVISLYVHEQLGF
C5AK99_BURGB          ----------MSTDLQDLATPHAAAARTARLICFGVFLGALTFGLLLPVVPLYVHDTLGF
A0A0J1CIL2_9BURK      ------------------------MGRSLFCLSAAVFICGITFGALLPVVSIFVGRLLGF
A0A1A9HL04_9BURK      -----MSAATSTPGSTATATATATLNLPAPGVIAALFCGYLAVGLPLPVLPLFIHEQLGF
A0A1E3ZBZ6_9BORD      ---------MNNATPSVSSPSSHESALRLLPLVAIVFSGFLAVGLPLPALPLYVNGVLDF
J2WBC4_9BURK          -----------MSTSTDTPPMSSPGARPLLPLVGIIFCEFLSIGIPLPALPLHVNGGLGY
G9ZUP1_9PROT          ------------------MTLPQTTRAALSPLVGIVFLGFLSVGLPLAALALQLHDEMGF
J1ERY9_9BURK          -------------------------------MVLAVFLGFLSISIPLGALALEVRDHLGF
A8IDF7_AZOC5          ---------MHAPPKPRASSALFAVVPILFPLTLSAFLAVLSIGIPLPVLSIRVHDGLGF
Q5NLD0_ZYMMO          -----------MNRQAIAPLSRREATCCLLPFATIVLLGYLTVGLPLAILPVYVHDYLGF
A0A0D6MQH6_9PROT      -------------MTPAAPLSNAAATKLLLGFASVVFLGYLAVGVPFGVLPGFVHATLGF
A0A171KR32_9BURK      ------------MLPATGGRQADNVFLVLLPITFAVFISFFNMGMQLAVLPLHLHDRLGM
A0A1A9HIG8_9BURK      -----MNRTLDASRGAPTGPSGARIFLQLLPLTLTVFIGFLTIGLQLPVLPLHVHRTLGM
A0A0S4KA94_9BURK      ----------MQSPSNAAASAPRSLFLELLPITLTVFVGFLTLGLALPVLPLHLQSALSM
F5Y2A5_RAMTT          -------------------------------------MGFLAMGMALPVLPRHVNGALGQ
A0A0B1YKP8_9BURK      ----------MTTPSSTIPNQR--TVSALAPLMAVVLVAFLIIGIALPVLPLHVHDDLKL
N6UHQ6_9RHIZ          ----------MTAAVSTLAVSKPSVIAALTPIMAVVLVAFLVIGLGLPVLPLHVHQTLGF
A4JLV8_BURVG          -----------MYKSPPAEAARQPVLATLLPVMTAVLAGFSIIGVALPVLPLYVNNDLGF
X6DCT0_9RHIZ          ----------------------------MVPIMAAVFAGFLLIGLALPVLPLHLHQQLGF
A0A0Q4YES1_9BURK      --------------------------------MVIVLLGFAVIGMALPVLPLHVRERLGM
W0RHM1_9BACT          ------------------------MIGALAPIMAVVLVAYLIIGLAMPVLPLYVHQQLGL
A0A0Q5VSH3_9RHIZ      ----------MSAPASSTSGSDFAVFKSLAPKMAVVFVGFLIAGMALPVIPLHVHNDLDF
                                                                 .  :   .         

D5QHT3_KOMHA          GNMLAGLAVGIAFAST-IISRNHAGQLADGRGGRACMRLGLAGYILGGVICAGAGLPILP
A0A4Y3TMP0_9PROT      NNVLAGLAVGIPFLST-IFTRNYAGQIADATGGHRCMRRGLVLYALACGLCLFSTLPALP
A0A060QKI6_9PROT      GNALAGIAVGCAFVST-ILTRTIAGAFADQRGGRTAMRLGLCLYVLASAICFASSLSFLT
A0A023D7A1_ACIMT      DNAYGGLAVGIAFLST-ILTRGRAGTYVDQLGGKHCMQRGLLIYAAASLICLLASWPILP
A5G0M5_ACICJ          DNALGGLAVGLPFLTT-LLTRAQAGRLADERGGRRCMLRGLGVYTVASAICMAAAVPAAP
V2IR34_9BURK          GNVGSGLAVGIAFLST-ILSRGWAGRLADERGGKAAMFRGLFLYALAALLCWWSSLPSLG
Q7NWW8_CHRVO          GNALGGLAVGITFFST-ILTRGHAGRLCDQQGGKACMRRGLCLYALAGVVCLASSFLANQ
M1WJT7_PSEP2          DNWLGGVAVGVAFIST-ILSRNHAGFFADVISPKKCTMGGLFCYMIAAAICLFST-SPWL
I8RA14_9FIRM          PNWLGGVAVGVSFVAT-ILSRKYAGDFADTKSSKKCFMIGFFFYMVAALVCMAAS-ITGL
B8J4I4_DESDA          SNGLSGLAVGIAFLTT-ILSRGFSGRFADRNGGKACMMRGLLLYAAASAICLVAG-ATG-
A0A023D7A3_ACIMT      SNGFAGLAVGIAFLST-IFSRTPAGKLADRFGGKRAVIIGMLLYVVAAGIC-ATAAFLPV
A0A270BDL9_9PROT      GNALAGLAVGVAFAST-IVTRGFAGRCADHQGGKRCMLYGLALYTVSGLLT-AVVTWM-T
A0A158MA61_9BORD      DNFWAGLAAGSAFLAT-IFTRTYAGGLADRVGVKPVTVRGLLIYMLGIGLSWTASLSS--
W0I3W5_9GAMM          SNSWAGLAVGVAFFST-LLTRGRAGALSDAAGSKSATRRGLLFYGAGAFISALAGVTTLP
YFCJ_ECOLI            GNTMVGIAVGIQFLAT-VLTRGYAGRLADQYGAKRSALQGMLACGLAGGALLLAAILPV-
D8MUZ3_ERWBE          NNVMVGVAVGIQFFAT-LLTRGYAGRLADQRGAKRSVLQGMLACTLVGLAYVLAAVLPL-
A0A097R2N9_HAFAL      SNTMVGIAVGMQFLAT-VLTRGYAGRLADQQGAKRSTLQGMLACSLAGVAYLLAALLPV-
C3X8M5_OXAFO          SNTLVGVAVGCQFFAT-VLSRAYAGRQADSVGAKRTTLKGMLICSMAGLAYLLSALLPV-
W0HKU8_9GAMM          SNTLVGVAVGVQFLAT-VLNRSYAGRLADQCGAKRSALQGMAACGLAGVFYLLSALLPL-
A0A0J8YTB6_9GAMM      NNVMVGIAVGIQFFAT-LANRGFAGKKADQQGAKQTTRLGMGVIALVGVAYLLSVFASH-
Q6F9M3_ACIAD          NNFWVGIAVGTQFVAT-VLTRPYAGRLSDRVSAKRATLQGMVALFFAGLMYLLVFFLPV-
I0QRC9_9GAMM          NDVLVGIAIGAQFITT-LVTRSTAGRLADSHGARRTALSGMACCAASGVATLAAALMPSE
Y4428_SALTY           SDLLIGIAVGSQFIAT-LLTRGAAGRKADTSGGRRTVITGQFYCAASGLLMLVS-LIAHP
D4GCW6_PANAM          SDTLVGLVMGCQFVAT-LLTRGIAGRNADERGAKQVMHMGLAVSTLSGLMLLVADRVAH-
S7VDN3_9DELT          GDILVGVAVGCQFFAT-VGTRKYAGAVSDRAGPHVALRKGLLFCAAAGAFYLAAALAPV-
H8L4S5_FRAAD          SDLWVGTAVGIQFLAT-VLTRRHAGSVADRQGPQQALRRGVTALLVSGLIYAVAAWLPA-
A0A0B4XL39_9GAMM      GSVLVGTAVGIQFLST-LLTRGYAGRIADTQGPRPAMIKGLWLCALSGLLYIATDWLPL-
C5AK99_BURGB          GTLVVGAAVGAQFLAT-VLTRSIAGRRADHHGAKPTMCAGLVSCAIAGGVYVASAAAPA-
A0A0J1CIL2_9BURK      SNVVAGTAVSAHFLAT-LLTRGYAGRQADHLGARRSMLRGLLSCSAAGVAFAGATLFTG-
A0A1A9HL04_9BURK      DTLTVGLVIGLQFLAT-VLTRGYAGRLVDGQGGRRSALQGALGCAAAGLLYLVAALGSSH
A0A1E3ZBZ6_9BORD      SPLVVGWIIGLQPLTT-ILTRKFAGTYVDRHGPRQSVMMGLPMAAMAGLLYVASAL--IP
J2WBC4_9BURK          SALVVGWVVGIQSFST-ILSRQFSGSYCDRHGPRRAVCVGLPLAAAAGLLYLASTW--IA
G9ZUP1_9PROT          DPFWVGIVIGAQSVVT-VLTRHLAGTVCDRRGPKRSVLTGLPLAALAGVLMLLATTSLPA
J1ERY9_9BURK          GAATVGWAIGLQSLAT-LLTRHQAGTLCDQRGPRFAVLLGLPLTACSGLAYVLASV-LPM
A8IDF7_AZOC5          GAVLVGVVVGSQSVVT-LLSRGMAGTTVDSHGAKWAVVAGLPLAACAGGLYLASLA--LP
Q5NLD0_ZYMMO          GPMIVGWVMASQSIAT-LLTRQFSGFVADTRGSRLAVFNGMLLCSLSALLYAVSLWNHGL
A0A0D6MQH6_9PROT      GPFVVGLTIGLQSLST-LSIRGLAGHTADHRGGRFATLIGALGCAGSALAYLAASRCIGA
A0A171KR32_9BURK      GPLVIGIVVGAQFVGA-LLSRPWAGNHADVQGTGRAVTLGFLVASASGVAYLLSML--CI
A0A1A9HIG8_9BURK      DELVVGFVVGSQFVAA-LLSRAWAGNFADLRGTRRAVRLGLILASASGIVYLLSTV--FP
A0A0S4KA94_9BURK      SPLVIGTVIASQFVAA-LLTRAWAGSMVDTRGAKRAVVIGLGLGACAGLAYSASLG--AP
F5Y2A5_RAMTT          GTLIVGVVMGAQYLSACLLGRAWAGEVADARGPRRAMLAGLLGACVVGAVYLASLAVEAP
A0A0B1YKP8_9BURK      GTFFVGLVTGSQFAAS-LFSRVWAGHFADKSGAKLAVIVGMVSASVAGLIYLSSLA--VA
N6UHQ6_9RHIZ          GTILVGCVTGSQFAAS-LFSRFWSGHTSDFHGPKVAVIVGLAGSSVAGVIYLLSLY--AV
A4JLV8_BURVG          GPFMIGLVAGAQFAAA-LVSRIWAGSFSDRRGAKRGVLAGLVAAAAAGLLYLLSLA--FQ
X6DCT0_9RHIZ          GPFAVGLVTGSQFIAS-MLSRIGAGNYADGRGGKRAVIVGLIAAALAGFIYLGSLA--LL
A0A0Q4YES1_9BURK      GPLVVGLISGSQFASS-LLCRPWAGAFADRRGGKLAVTIGLVAATAAGLLYLASLH--YV
W0RHM1_9BACT          STFMVGIAAGVQFAAA-LLSRFWAGTYADTRGAKRAMVVGLSMGAASGLLYLLSLR--VA
A0A0Q5VSH3_9RHIZ      GNLVVGLVAGTQFGAS-FLTRLWSGNFADRRGAKRAVVLGLGTAFVAGLFYLTSTY--FA
                           *   .     : .  *  :*   *  .       *                    

D5QHT3_KOMHA          -----Y-LTRYLILMVGRLVLGVGESLTVVGMLGWGIGLMGHARAGKVMAWTGMAMYGAF
A0A4Y3TMP0_9PROT      -----S-AGHYGVLIAGRLLLGLGESLCIVGMMGWSIALAGQPKAGKVMAWTGAAMYGAF
A0A060QKI6_9PROT      -----R-PLAFALLIIGRLLLGVGESYTLVGMHGWGIGLTGAKGAGKVLTWTGAAMYGAF
A0A023D7A1_ACIMT      -----V-SASYTVLIIGRLLLGIGESVANVGMISWSIGLMGQARTGRVMSLVGIGMYGAY
A5G0M5_ACICJ          -------HLRFAVLLAGRALLGVGESQVAVGMIGWGIGLMGHARSGKVIALVGAGMYGAL
V2IR34_9BURK          -----HGTAAYAVLLAGRLLLGLGESAALVGMLAWGMATMGPARSGLVMALVGTGMYGAF
Q7NWW8_CHRVO          -----P-ALALGALLAGRLLLGLGESLAIVGMSAWSIGLMGPVHSGKVMSLVGMGMYGAF
M1WJT7_PSEP2          -----AKPVAYAVLIAGRLVLGLGESMTLVGLTSWHLSLIGPQRSGKILSILGMAMYGAF
I8RA14_9FIRM          -----SASVSFTILIVGRLLLGIGESMTTVGIPSWHFLYLGPVHSGKILAVLGMAMYGAF
B8J4I4_DESDA          -----DPAWAFALLIVGRLVLGLGESMAIVGMLSWNIALLGPQRSGTVFSLVGASLYGAF
A0A023D7A3_ACIMT      -----THFISFALLLSGRIVLGLGESFTVVGVLSWGFGLMGGHRAGRVLTVVGMAMYGAL
A0A270BDL9_9PROT      -----TPVAAFCMLLIARLTLGLGESLAVVGMLAWGIGLMGHNRSGRVLSVVGMGMYGSL
A0A158MA61_9BORD      ------HWAAFAVLLAGRVLLGLGESLVAVGVVTWGIALVGAASSGRVLALIGAAMYGAL
W0I3W5_9GAMM          ------PLAAYFILVAGRLLVGWGESLVGVGIITWGIGLAGPAQAGKVLAIVGAAIYGAL
YFCJ_ECOLI            -----SAPFKFALLVVGRLILGFGESQLLTGALTWGLGIVGPKHSGKVMSWNGMAIYGAL
D8MUZ3_ERWBE          -----PVMGKFALLVVGRLLLGFGESQLLTGNLTWGMGLVGPKRSGQVMSWNGMAIYGAL
A0A097R2N9_HAFAL      -----DAMTKFVILLVGRLVLGFGESQLLTGNLTWGLGLLGPSRSGKVMSWTGMAIYGAL
C3X8M5_OXAFO          -----PDMVRYGILIVGRLFLGLGESLLISGNFAWALGLIGTTKSGKIMSWNGMAIYGSL
W0HKU8_9GAMM          -----PVYPRYGLLLIGRVMLGFGESQLLTGTLSWGFGLLGQVRAGKVMSWNGAAIYGSL
A0A0J8YTB6_9GAMM      -----SVWLQFSLLLLGRILLGLGESFLLTGNLTWGLGLIGQPRSGIVMSWNGMAIYGSL
Q6F9M3_ACIAD          -----SLLFKYCLLLIGRLIHGYAESLLISGHLTWGLGLVGQPRAGKLLSFTGMAMFGAL
I0QRC9_9GAMM          -----SVYLAFSLLIIGRILLGVGESLLLTGNLTWGMGLAGEGLAGKVMSWNGMATYGAM
Y4428_SALTY           -----VPLLAWAILIVGRVLLGIGESFILTGNLTWGMWLAGSTHAGQVISWNGMATYGAL
D4GCW6_PANAM          -----FPFLTLFFLFAARILLGISESQILTGNLAWGLGLSGDKKGGRVMSWNGIATYGAL
S7VDN3_9DELT          -----HPVAKLGVLLLGRLCLGVGESLVLTGMVTWGLGLCAPQSAGRVFAWAGVAVYGAL
H8L4S5_FRAAD          -----PAGLRYLVLITGRLLVGFGESLMMTGVLTWGVGLAGPRRSGKVMSWVGMAMYGSL
A0A0B4XL39_9GAMM      -----SSEGRLGIMIIGRLILGYGQSLLVAGMLGWGIGTVGGARSGQVMAWTGMAIYGAM
C5AK99_BURGB          -----GPGTRLALLVAARLLSGFGESQLATGALAWGIGTLGANRAGRVLSWTGMALYGAI
A0A0J1CIL2_9BURK      -----APVFQLACVMVSRVFSGLGESQLITGALTWGIGLAGAQRSGKVMAWNGMALYGAI
A0A1A9HL04_9BURK      GASAMSPAAVLAIVVAGRLVAGFGESQFVTGCVSWSIASVGPQRAGLSMSWTGIAMFGAL
A0A1E3ZBZ6_9BORD      -----HPSAALAVLVAGRLLMGPAESLFLTGTMTWGIGRVGPQRTGIVMSWQGIAMFAAL
J2WBC4_9BURK          -----DPGASLAVLILGRLLMGPAESLYLTGAMTWGIGRLGVAGTGRVMAWQGMAMFAAL
G9ZUP1_9PROT          -----GHGLILPAMLVARAFLGAGESFFLTGTMSWGIGRLGPARTGKVMAWQGIAMYAAL
J1ERY9_9BURK          -----APAASLAVLILGRLVAGLGESLFLTGLMSWGIARVGPARTGSVMSWVGIAIYAAL
A8IDF7_AZOC5          -----DPSFSLAVLIAGRMIHGIAESLFITGFLAWGIGRVGVAKAGLVMGWNGIAVSAAL
Q5NLD0_ZYMMO          ------PKIALLLLFAGRAVLGFGESLLITGVLSWSIGQVGMLYAGRAMVWVGISMFSAI
A0A0D6MQH6_9PROT      ------PGLALACVLAGRIASGIGEGFLITGALGWCLARVGPSHAGRAMVWVGIAMFGAV
A0A171KR32_9BURK      ----DAPVASTLLILVGRVMLAVGESLIVTGALGWGIALVGAGSAGKVMAWTGMAMFAAY
A0A1A9HIG8_9BURK      ----TRPTTAVWLIVAGRLLLALGESLLVTGAMGWGIGLAGPQNAGKVMAWIGTAIYGAY
A0A0S4KA94_9BURK      ----PG-YGAVAILIGARLLLGCAESLVVTGALGWGVGLAGPQNAGKVMAWVGIAMYGAY
F5Y2A5_RAMTT          ----GRPGASLAVLVGARLVTGVAESFIITGALSWGIARVGPAHAGKVIGWVGMALFGAY
A0A0B1YKP8_9BURK      ----SMPLVSVTILIVGRAVLGAAESFIITGALSWGLARVHAGVSGKVIAWIGMAMYAAF
N6UHQ6_9RHIZ          ----PNPTISVIMLLVGRGVLGAAESFIITGATVWGLARVGATNAGKVIAWMGTAMFAAF
A4JLV8_BURVG          ----RLPALSVAILLAGRAILGGAESFIITGGVAWGLGLVDRQHAGKVIAWVGTAMFAAM
X6DCT0_9RHIZ          ----DRPVASASALFAGRAVLGASESFIITGGVAWGLSLAGGQNSGKIIARVGMAMFAAL
A0A0Q4YES1_9BURK      ----HLPLVSAAVLLVGRGVLGGAESFIITGAMGWGLGMASAEYTGRVIAWVGTAMFAAF
W0RHM1_9BACT          ----HTPSTSILVLLIGRVFLGGAESFVITGALSHGLALGGPRNAGKVIAWVGTALWAAY
A0A0Q5VSH3_9RHIZ      ----EQRNLSAVILLIGRALLGGAESLLLTGSVAWGLATAGPGNAGKVIAWVGTAMFGAL
                                   :  .*   . .:.    *     .        *  :   * .  .. 

D5QHT3_KOMHA          AVGAPLGLALFHMVG----FGGVMMGCAILPAIGLIISKGI-TAPPVHA--GRREPFWRI
A0A4Y3TMP0_9PROT      AVGGPVGLIMYQHFG----FAALMLLSAALPLAGLLLISTV-PGAPLHI--GHREPFWSI
A0A060QKI6_9PROT      AFGGPIGLELYHLSG----FTALMALCTILPCLGLAIVQRI-PPTPVLT--GERDSFWPV
A0A023D7A1_ACIMT      AAGGPLGLALLNGLG----FAWLMGACAILPLIGLIAIYWL-PAVAPHV--GQREFFWRI
A5G0M5_ACICJ          AVGGPLGLALFRALG----FAGLMATCTLLSVLGAAIAFRF-PDAPPTP--GQRQPLWRV
V2IR34_9BURK          AAGGPVGLWLLERCG----FAGLMLVCVAMPVLGALMLWRTKPAAPPKT--GPRPPFVQV
Q7NWW8_CHRVO          AAGGPLGLLLFQQTG----FRPLMLVCALLPLAGLLLIRSF-PGIRPHA--GQRESFLRI
M1WJT7_PSEP2          AVGGPIGLSVYGKYG----FAALMCISFLLPLAGGMLLIRT-KDILPQKNIPQQRAFFGI
I8RA14_9FIRM          ALGGPVGLTLYRYFG----FDSVMLASSIVPIIGVIMFVTS-PEVAPHKALEAKKSFFKL
B8J4I4_DESDA          ALGGPLGLLCFGQFG----FTGLMLLCSPLPLLGWLMVCRM-PAVVPASARPGV-SFLRV
A0A023D7A3_ACIMT      AVGSLLGLDVMHRAG----YAGMSAACAILPLIGLALALPV-AAAVPHH--GLREPMHRL
A0A270BDL9_9PROT      AVGSPVGLTLYDHGG----YVLVALGCIATPLVGFTMAAPV-VAVPPHG--GERLPVGRI
A0A158MA61_9BORD      ALGGPVGLALFAHLG----FGGVMLAASVLPLIALVGTLSLPG-SPLQAA-GARRGFLPI
W0I3W5_9GAMM          AVGGPLGLVLLNHVG----FLGVMAVSVVLPCVGILAIAPLAEIAPAAAP-PRRAALYPV
YFCJ_ECOLI            AVGAPLGLLIHSHYG----FAALAITTMVLPVLAWACNGTVRKVPALAG---ERPSLWSV
D8MUZ3_ERWBE          AAGAPLGLMLHDKWG----FMAMGIATMILPVVALLFNVWVKPVPTHGG---ERPSLWTV
A0A097R2N9_HAFAL      AAGAPLGLLLNQHWG----FAALGISTLILPLVAILINFKVKPVAPHAG---QRIPMWRM
C3X8M5_OXAFO          AAGAPLGLLMNHHFG----FVALGVSTLVLPLLAFLLDWRIRPIETTGG---SKVSLLSV
W0HKU8_9GAMM          AVGAPVGLLLYHRSGG---FITLGLTTLLLPLLALACNARIASIRPHPG---NRPSLKAV
A0A0J8YTB6_9GAMM      AAGAPIGLYLYHHFD----FLGVSLACIACPIVALLCNAKIPAVPVSGG---VRPGFTTV
Q6F9M3_ACIAD          AAGAPLGLWLYETFG----FYSVALLIIVLPVLSLLIDRGIQATQPHQG---EYPPLKQV
I0QRC9_9GAMM          AVGAPLGLALYRSQG----MATTAGLMLLLPLIALLVDRGVPAVEAHAG---KRQPLSTI
Y4428_SALTY           AIGAPLGLSLYARAG----LALPALLVVLLPIIASGVIYGIPGNIPTAR---PRVPVLRV
D4GCW6_PANAM          AAGAPFGLYLFHYYG----FWAIGLCTVMLPVIAFTLNAAVPAVIPSHG---VRLPLWSV
S7VDN3_9DELT          AAGAPVGMALFRSLG----FAGTALAITALPLASLLLCRSIPPVAPVAG---RRWPFLRI
H8L4S5_FRAAD          AAGAPLGQALYGRTG----FGAVSLGVILAPLLAGLLSLTVPPVQARGG--SRTLGFMKV
A0A0B4XL39_9GAMM      ALGAPLGLWLYQQVD----LASVGLLVGLLPALGVVLVRNVPTVPVTAG---ERRSFISV
C5AK99_BURGB          AIGAPCGMALARAGG----LTVVAAATIALPCLALAVVATLPGVATQQ--G-RRVPLARV
A0A0J1CIL2_9BURK      AVGAPCGMALVHIGG----FALVGVAMIGLPLIACVAVLGLSAVAASG--G-HRSGFREV
A0A1A9HL04_9BURK      SIGAPMGMWLYRFHEGAYGLAAVMVACIAAPLAAWAIALATPTWRMAGG---PRLPFRRV
A0A1E3ZBZ6_9BORD      GLGAPLGVWVMQNVD----FLAVGLATVAFPLVGLAIASRVPPVPVA-AGARKQVPFLRV
J2WBC4_9BURK          GLGGLVGVGLQERFG----FAGVAGVTIALPLLGWAVAAALEPLAVV-RGHGDGLPFAAV
G9ZUP1_9PROT          GIGAPLGLWLMRHAG----FGAVVGLAAICPVLACGIALALRGTPAT-GGQ--RVPFYRV
J1ERY9_9BURK          GLGAPLGLAVQPVFG----FAGVGALVLLTPLLAWAIALRLPAVPAS-GGQA-RVPFHRV
A8IDF7_AZOC5          AVGAPLGVAAQESFG----FAAVALLALTAPLLALAIVVCVAAVPRSEAPAAPRLPFVRV
Q5NLD0_ZYMMO          GGGAPLGSILLKQSG----FGTVALVTAILPLLACVLMRKIEPIPPHNG---RKIGFFKV
A0A0D6MQH6_9PROT      GIGAPIGTWLSGQGG----LSAVSVLLFAAPLLGAVLAAMLPGVPVAGG---TRLSFFRV
A0A171KR32_9BURK      ALGAPAGGWVYARQG----FTGIGVATILLPLLALACIARMRQVPP-SAT--RRASFYKV
A0A1A9HIG8_9BURK      AVGAPLGVALNASRG----FVGICAAVLVIPMIAFAVIARAPALPP-SAQ--RRAPFHTV
A0A0S4KA94_9BURK      AAGAPLGVFVYGRFG----FGGIALATVLIPVLALAIVARVAAPAP-SHK--VRVPFYKV
F5Y2A5_RAMTT          AAGAPLGAALWQRFG----FAGIAVATLVVPLLAAGIVARIPGIAP-GTQ--RRPPFWRV
A0A0B1YKP8_9BURK      ALGAPLGTVLYAKYG----FSAIAFATVLMPLATLTLVLPMNAIAP-LSR--SGPSMTKV
N6UHQ6_9RHIZ          AGGAPIGVAIYGRYG----FAGTAAATALAPLVTLALVALLQGVTP-ERR--EHHGMLSV
A4JLV8_BURVG          ALGGPVGSLLYTSLG----FSAVALITVVLPMMVLAYLVRMPAVTPHIHG--EHATFATV
X6DCT0_9RHIZ          ALGAPIGSALYAASG----FAAIALATVGLPLATLLAILPMRGTSLAASA--ARQSWASV
A0A0Q4YES1_9BURK      AVGAPAGSTLYESFG----FSAVAVGTVVVPLLTLLVVAPIRSSPP-VAV--ERTSSRAV
W0RHM1_9BACT          GAGAPVGTLLYDRFG----FVSTALATTALPLVALLVVAPLRSLPP-SAR--ERPSIRRV
A0A0Q5VSH3_9RHIZ      AAGAPVGMALYAAMG----FSGIALATIILPVLTALIIAPLPPVPG-RPS--TSGSRWRV
                      . *.  *                       .                            :

D5QHT3_KOMHA          LGRIWQPGCALGLQGVGFAALGTFISVYFIHRHWPYAGLGLSCFGLAFVAMRLLCGHLPD
A0A4Y3TMP0_9PROT      LNKIRGPGLAVALQGVGFASLGAFLSLRFLQAGWPYAGWGLTCFGAAFVGMRMLCGHLPD
A0A060QKI6_9PROT      LGIIRPYGSVVALQGVGFAVLGAFLSVYFLHEHWRFGSLGLTCFGLAFVAGRLLCGHLPD
A0A023D7A1_ACIMT      IGRIWRPGATLGLQGVGFASLGSFFSLYFLSRGWPYAGLGLTFFGGGFVVVRLFCGHLPD
A5G0M5_ACICJ          VRRIALPGAAVGLQGIGFAALGAFMSLDFLSKGWPGAGLGLTCFGIGFVLMRLAFGDLPD
V2IR34_9BURK          LGRIWQPGVVVGLQGIGFAALGAFFPLYFLANGWHGAGYGLTCFGLGFVAIRLLCGTLPD
Q7NWW8_CHRVO          LGRIGKPGAAVFLQGVGFAGLGAFFALYFSSRGWAWGSLGLTGFGVGFVLVRVLCGHLPD
M1WJT7_PSEP2          IQTIWKQGAVVCLQGVGFAVLGAFISLYFKSKGWPFAGLGLTCFGTGFVLSRILFGSLPD
I8RA14_9FIRM          LRSIWKQGMTVTLQGIGFAVLGAFISLYFKDQGWPYAGIGLSLFGIGFVISRILFGTLPD
B8J4I4_DESDA          LGSIWRQGAIVGFQGVGFAAIGAFISLYFTSRGWQHAGLALTCFGIGFVLVRLFFGHLPD
A0A023D7A3_ACIMT      LGRIWDLGMVVFLQGIGFAVIGAFMPLLFLVRHWPHVALGLTAFGAAFVLVRVFCGHLPD
A0A270BDL9_9PROT      LHKISDLGLVVFFQGIGFAAIGAFMPLMFLHRHWPHAALGLTFFGAAFVLVRILCSHLPD
A0A158MA61_9BORD      LGRIWPYGTVVCLQGIGFAAIGAFFALHFLQRHWEYAGLGLTAFGAGFVLVRLVCGHLPD
W0I3W5_9GAMM          LGRIWRHGLIVCLQGVGFAILGAFFSLLFLHREWAHAGFGITAFGAGFVLVRLCLGHLPD
YFCJ_ECOLI            VGLIWKPGLGLALQGVGFAVIGTFVSLYFASKGWAMAGFTLTAFGGAFVVMRVMFGWMPD
D8MUZ3_ERWBE          VGQILSPGFGLALQGMGFAVIGTFTSLYFASQQWGNAGFALTAFGLSFVLVRILFGWMPD
A0A097R2N9_HAFAL      LGKIWQPGVALALQGVGFAVIGTFISLLFSSHGWAHAGLALTSFGLSFVLMRVLFGQLPD
C3X8M5_OXAFO          AKLVWQPGLALALQGAGFAVIGTFMSLLFASYGWAHAGLTLSCFGAAFVGVRVLFGHLPD
W0HKU8_9GAMM          LRLIWLPGMALALQGVGFAAIGTFVSLYFNLRHWDHAGFAFSAFGIAFVALRFWGSHWPD
A0A0J8YTB6_9GAMM      LKQILTPGAVLALQGVGFAVIGAFISLYFAAEHWGNAGYTLTIFGLAYVLIRVFFGGIPD
Q6F9M3_ACIAD          IHYVWRFGMILALQGVGFACIGTFVALYFKQQHWNFAGYALTMFGLAFVMVRVFCGHLTD
I0QRC9_9GAMM          WVRIWRPGLGLMLQGIGFSVLSVFITLYFNQFGWSYAGFALTAFGAAFIAVRLMLGNLPD
Y4428_SALTY           VGLVWRPGTGLVLQGIGFATLSAFTALWFNERHWDNTGFAMTLFGIAFIAVRFFCAKFPD
D4GCW6_PANAM          VGKIWRPGLALALQGIGFAVLGTFVSLHFNQQHWANAGLALTAFGAMFIAVRLIFSHFPD
S7VDN3_9DELT          VGFIWRPGVALGLQGVGFAGIGAFVSLYFGSMGWARAGLALTAFGLSFVCARLLFGHLPD
H8L4S5_FRAAD          VGLIWRPGVTLALQGVGFASIGAFVSLYFHHEQWPHAGWALSAFGLAFVLARVFFGRLPD
A0A0B4XL39_9GAMM      LGSIWQPGMGLALQGVGFAAIGAFISLHFVHEGWVGAGLALTCFGLSFALVRVLFGHLPD
C5AK99_BURGB          LRLIAPPGCSLALQGVGFAAIGAFVTLLFQARRWDGAGLALSCFGGAFVLVRVLFGHLPD
A0A0J1CIL2_9BURK      LGVVWRPGITLALQGFGFAAISSFVSLYFVARGWANAGLALSSFGFAFVLVRLLLGSLPD
A0A1A9HL04_9BURK      VRQIWRQGLGLTLQGVGLAGLTAFASLYFAARGWSHAGVVMTCFGVGFIAVRLLLGHLPD
A0A1E3ZBZ6_9BORD      IGMIWRQGGALSLASAPFAVLTAFVVLYFASRGWEGAGLALTGFAAGYILVRLFFGRLPD
J2WBC4_9BURK          LRLIGRFGMAAALSTMPFAILTSFLVLLYRHHDWSGAGQAIFGFSAGFIAVRLLFAHLPE
G9ZUP1_9PROT          IGLIWRPGTVLALSSLSFTALTAFLALHYQVRGWAGAGTAMMVFVAGYVLVRLFFAHWPD
J1ERY9_9BURK          LGLIWRPGLVLALATVPYAAMAAFLTLAYAAHGWPHAGTALLGFSAAYVLVRLVGSGLPD
A8IDF7_AZOC5          LGLVWRFGLVLALSTAPFALLGSFVVLTFTERGWAHAGLALSLYGIGFVLVRFAFGHMPD
Q5NLD0_ZYMMO          VGLIWPYGVSLALNTIGFGALFAFLGLDYAAHHWTGASFGLTAFGAAYVIARLTFGGLPD
A0A0D6MQH6_9PROT      VGLVWRLGGSLSLCTMGFGTLSAFVGLYFAQGHWHGASFALSVFAVGFVLSRLFFGHLPD
A0A171KR32_9BURK      LGTVWLPGLGLALCSIGFGVITAFIALLFASKGWDNAPLAFTAFGVAFIVARIFFGHLPD
A0A1A9HIG8_9BURK      LSAVSGPGLGLALCSAGFGVITAFISLLFVSKRWGDASLAFTAFGAAFIGARLLFSHLPD
A0A0S4KA94_9BURK      LRAVWLPGLGLALSSMGFCAITAFVALLFSAKGWGDAALAFTSFGAAFIGARLLFGHLPD
F5Y2A5_RAMTT          LGAIRLPGLGLTLCSVGYAVINAFVALLFVQRGWGGAALAFTALGGGFILARVVAGHLPD
A0A0B1YKP8_9BURK      IRAVTAPGIGLAMSSIGFGSIMAFVSLLFVEQGWQPAWLSFTVFAISFIAARVVFGHLPD
N6UHQ6_9RHIZ          VGKIWMPGLGAAFSSIGFGVILSFATLLFTTHGWTPIWLAFTSYAGALIVARLVFGHLPD
A4JLV8_BURVG          LKAVWLPGLGAALSSIGYCAILAFSSLYFTDMHWQPAWMAFTAFGVALIAARTIAGHLPD
X6DCT0_9RHIZ          AQVVWLPGVGAAFSSLGYGAILSFGALLFAERGWQPVWLPFTAYAASLIAARLCFGHLPD
A0A0Q4YES1_9BURK      LSAVWLPGLGLALSCTGFGAIIGFGSLLFVDRGWSPVWPVFSSYAVAFILARVVLGHLAD
W0RHM1_9BACT          LGAVAVPGLGMALTAVGFGAISTFASLLFAERGWDAAWVAFTVLSATFILGRVVFGHLPD
A0A0Q5VSH3_9RHIZ      VGAVWLPGLGAGLSSVGYAAIVTFSVLLFASRKWPDPWLAVTCFAAALVAARILLGHLPD
                         :   *    :       :  *  : :    *      .          *   .  .:

D5QHT3_KOMHA          RIGGVRVALVSLGVEAVGQYLLWCAPSPV-----MALTGAVLTGAGCSMVYPALGVEVVR
A0A4Y3TMP0_9PROT      RIGGLKVALPSLLLEACGLALIWSAHTPE-----IALVGAFLTGAGCSMVYPSLGVEVVH
A0A060QKI6_9PROT      RLGGLRVATISLAIEAIGQGCIALAPSPY-----LALAGAVLTGAGCSLIYPSMGVEVVK
A0A023D7A1_ACIMT      RIGGTPVAIVSLVVEACGQYLLWLAPGPD-----SALAGALLTGFGCSMVFPAMGAEVGK
A5G0M5_ACICJ          RVGGTAVAAGSLLVEATGQYLIWLAPEAW-----VALLGALLTGLGCSMVFPSMGKEAIR
V2IR34_9BURK          RFGAVPVALVSLLVEAAGQAMLWLAPGPG-----VAMIGALLTGIGCSMVFPSMGLEAVR
Q7NWW8_CHRVO          RIGGAKVALISLGVEVVGQWLIWSSAAPA-----AALLGALLTGIGCSMVFPSMGVEVVK
M1WJT7_PSEP2          KMGGTRLAMYSLMCELTGQILLWAAPNVY-----TALTGAFLTGLGCSMIFPAMGVEVIK
I8RA14_9FIRM          KIGGVKVALVSLVVETVGQGLLWLAPHYS-----LALLGALLTGLGCSMIYPAMGVEVIK
B8J4I4_DESDA          RLGGMRVAAVSLGVAAGGQLALWLAPSAE-----IALAGAFLTGTGCSLVYPSMGVEVIR
A0A023D7A3_ACIMT      RIGGARVAAVSLAVETTGQALILFAATPG-----FALIGAFLTGAGCSMMFPAMGVEVIR
A0A270BDL9_9PROT      QLGGARVAWISMVVETCGQMLLWQATSAN-----MALAGAFLTGCGCSMIFPAMGVEVVR
A0A158MA61_9BORD      RVGGLPVVMASLAVEAAGQLMIGLADSPG-----MALAGAFLTGLGCSMVFPSMGREVVM
W0I3W5_9GAMM          TRGALPVATVSLAVEAVGQLLLWGAGTPE-----VALVGALMTGIGCSLIFPAMGREVVQ
YFCJ_ECOLI            RFGGVKVAIVSLLVETVGLLLLWQAPGAW-----VALAGAALTGAGCSLIFPALGVEVVK
D8MUZ3_ERWBE          RLGGLKVALISLTVEAVGLMVLGLSTSAW-----MALLGAALTGSGCSLVFPSLGVEVVK
A0A097R2N9_HAFAL      RMGGMRVAIASLVVETIGLVLIYLASTSI-----LALIGAALTGAGCSLMFPALGVEVVK
C3X8M5_OXAFO          KIGGIRVAMVSLLVESVGLMIIWAATGPW-----MALAGAMVAGCGCSLMFPALGVEVVK
W0HKU8_9GAMM          RLGGVRLTLISLAVEALGLALLWLATDPG-----LALLGTGLTGAGCSLIFPAMGVEVVK
A0A0J8YTB6_9GAMM      KMGGIKVTIISLGVEMAGLLLLCFSQQAW-----HALVGAALTGAGCSLVFPAMGVEIMK
Q6F9M3_ACIAD          KISGFTLVKYSLAIEAIGLFCIYIAPRVE-----LALLGAVITGAGCSLIYPALGVELIK
I0QRC9_9GAMM          KFGGIKVAQYSLLVECAGLLLICLAVNPL-----MALAGAALTGCGCSLIFPSLGVEVVR
Y4428_SALTY           RYGGATVATFSLLVEGTGLAVMWAAPSAG-----AALIGAAITGCGCSLMFPSLGVEVVR
D4GCW6_PANAM          RFGGKTVAIFSLLTESLGLLTLGTASTQM-----LALIGAGMTGAGCSLIFPSLGVIALR
S7VDN3_9DELT          RLGGPRVALASFVVECAGQFLLFAAPGEP-----VALLGAALTGFGCSLVYPSLGLEAVR
H8L4S5_FRAAD          RLGGPEIARAFLLIEWCGLLMLGLAPGLP-----VALLGAGVTGFGCSLVFPALGVEVVG
A0A0B4XL39_9GAMM      KLGGPRVAVVALMVEAAGLFILYLAPSAP-----WALAGAAITGLGSSLIFPSLGLVVVS
C5AK99_BURGB          RFGGYPVALAALLVEAIGQLLLWAAPVSG-----LALVGAAVSGLGSSLVFPALGVATLR
A0A0J1CIL2_9BURK      RLGGYRVALGSMCVEAVGQLIMCLASSAA-----IAVLGAAVTGAGCSLMFPALGSMTVK
A0A1A9HL04_9BURK      RIGGRRVALWSLGVEAIGQALVWGAPHEA-----VALAGAFVTGLGCALIYPALGVEALK
A0A1E3ZBZ6_9BORD      QLGGRKVAAVSLVIEALGQFLLWMAPSPG-----FALAGATLTGVGFSLVFPAMGVEAMR
J2WBC4_9BURK          RLGAHRVAVASVAIELCGQLLLWSAPHPT-----LALVGTVVTGIGFSLVFPSMGLQAMA
G9ZUP1_9PROT          TKGGAKVAMASLAVQLAGQLLLWLAPGPA-----VALVGALLSGLGFSLIFPAMGVEATR
J1ERY9_9BURK          RFGATAVAVGSLAFEAVGQVLVWQAGSPA-----MAVLGATLTGLGFSLVFPAMGVLATR
A8IDF7_AZOC5          RLGGATVSLISLAVEGVGQALLFAGGYGGFDHVWVGLAGAALTGAGFSLVLPAMGVEAVR
Q5NLD0_ZYMMO          RLGGQRVARVTIPLQIAGLVILWLAPLQW-----VAFAGCAILGAGYSLTFPALGVETIR
A0A0D6MQH6_9PROT      RIGGRRVALVTIPTQALGTLLLGLAPGPL-----VAFAGAALVGFGYSMTFPALGVEVVR
A0A171KR32_9BURK      RIGGAWVALVCVIVEMVGQIMIWMADSAG-----MAYFGAALSGFGYSLAFPGFGVEAVR
A0A1A9HIG8_9BURK      KIGGAKVALVCVLIEAAGLLVIWQADSAQ-----VAYLGIALTAFGYSLAFPGFGVEAVR
A0A0S4KA94_9BURK      TLGGARVALVCVLIEAAGQLLMWSAPTAV-----LACVGAAITGFGYSLAFPGFGVEAVR
F5Y2A5_RAMTT          QLGGARVAAVCVAIEAVGQGLIWLAPGPV-----WACAGAALTGAGYALAFQGFGVEAVR
A0A0B1YKP8_9BURK      KLGGAKVALIFVLVEAAGQALIWAATGSA-----PALLGAAMTGIGYSLVYPALGVEAVH
N6UHQ6_9RHIZ          KIGGARVALACALIEVVGLACMGLASSVV-----LAAIGAALTGLGYALVFPALGADAVR
A4JLV8_BURVG          RFGGAKVAAIFVIVQTTGLLLIWLARTTL-----LASAGAALAGFGYSLVYPGLGAEAVS
X6DCT0_9RHIZ          KLGGARVAVIFVAVEAAGLMLIWLAPGPF-----LAAIGTGLTGLGYSLVYPGFGAEAVS
A0A0Q4YES1_9BURK      RFGGARVALVFLVVEAVGLALLGLATTQA-----LALVGAALTGFGFSLVFPAFGVEAVK
W0RHM1_9BACT          RVGGARIALVCALIEAAGLALIWLAPTAA-----VVFVGAAVTGVGYSLVYPGFGLEAVS
A0A0Q5VSH3_9RHIZ      RLGGGLTALVFVLVEVAGLIVLWLAPLPI-----FGMIGTAMVGIGYSLVFPSFGIAVVG
                        .              *   :  .             *  : . * ::   .:*     

D5QHT3_KOMHA          IMPPHLRGTALGGFAAFQDLAYGATGPLTGLLADRTGYASVFLVGGLCATMAFIMTLHM-
A0A4Y3TMP0_9PROT      RVPAPMRSTALGGYSAFQDLAYATTGPLAGFLADRTGYAEVFLLGSLCAMLGAGVVCLL-
A0A060QKI6_9PROT      RVSGPMRATALGGFAAFQDLSYAISGPVAGIVSDCLGYGAIFIMGMICALAGLALVFRL-
A0A023D7A1_ACIMT      LVPPHMRGTAFGGFAAFQDLAYAVTGPVVGLLADRSGYASVFLIGGLAATLALAIAV---
A5G0M5_ACICJ          RVEPHLRGTAIGGFAAFQDLAYGATGPVVGLLADRTGYASVFLIGGIAATLGFGAAL---
V2IR34_9BURK          RVPAHLRGTAIGGFAAFQDLAYGATGPLAGWVADQFGHAQVFMVGTLAAALAVLMTLRLR
Q7NWW8_CHRVO          RVPAHLRGTALGGFAAFQDLAYGLTGPIAGLFADSFGYGAVFLIGAASAALGMAMVGLM-
M1WJT7_PSEP2          RVPKELRGTAFGGFAAFQDLAYAFSAPLAGFLADVSGYSSVFFAGAMAAAIGGIITVSM-
I8RA14_9FIRM          RISPEQRGAAFGGFAMFQDVAYAFSAPIGGVIADKFSYSSTFLFGFIAAVGGIIIVRSM-
B8J4I4_DESDA          KVQPELRGTAVGGFAIFQDVAYGATAPIAGLFADHFGYAVVFMIGLAAALVGLLIAIVT-
A0A023D7A3_ACIMT      RIPAHLRGTAMGVFSAFQDLAYGATGPLTGLLADRYGYGSVFLVGTIAAALGLAGACNL-
A0A270BDL9_9PROT      RVAPQMRGTAMGGFAAFQDLAYGATGPFAGLLAEWAGDESVFLVGSLAGVSGLVMSARL-
A0A158MA61_9BORD      RVEPAQRATALGAFSAFQDLAYGLTGPLAGLLADRSGYGHVFLIGALAAAAGLMLAMGLR
W0I3W5_9GAMM          QVPADLRGTAMGGFSAFQDLAYGLSGPVAGVLADRAGYDSVFLLGATAAGVALAIAAGLW
YFCJ_ECOLI            RVPSQVRGTALGGYAAFQDIALGVSGPLAGMLATTFGYSSVFLAGAISAVLGIIVTILSF
D8MUZ3_ERWBE          RVAPQVRGTALGGFSAFQDIAYGASGPLTGLLATSMGYGSVYLAGAVCAVLGIAVTLNFA
A0A097R2N9_HAFAL      RVPVHVRGTAMGGYAAFQDVSYAIAGPLTGILATTLGYSSVFAVGAACSALGIIVILLFL
C3X8M5_OXAFO          RVPIQVRGTAVGGYAAFQDVAYAATGPVTGFLATALGYPSVFATGAFCALFGIAVVLLFA
W0HKU8_9GAMM          RVPAQTRATAVGGYSAFQDVAYALTGPLTGMLATAFGYALVFGAAMLCALVGVAVTLLFA
A0A0J8YTB6_9GAMM      RVDAQVRGTALGCFSAFQDVAYGATGPLAGFLANSAGYGAVYLAGACCTLIGVVVSLTML
Q6F9M3_ACIAD          GAPAQIRGTAMGVFSACQDIAYAIYAPVFGLVALAWGYPSVFFAAALCAVVGFGLNFYTR
I0QRC9_9GAMM          RVPPEARGTALGGYSAFQDLAYGVTGPLAGILSSFAGYRSVFLLAAGCAFVGMLLVKIGL
Y4428_SALTY           RVPPEIRGTALGVWSAFQDLAYGFTGPIAGLLTPFIGYQQVFLLAAACALLGAAVVHLLL
D4GCW6_PANAM          HSPPQTRGTALGGYAAFQDIAYGLSGPLAGLIAVAAGYPMVFLLAGGCSIAGVIFVALFI
S7VDN3_9DELT          LTPPEARGTAMGAFAAFQDVAYGVTGPVTGAIAEVMGYGSVFLTGALCAVAGFLMVLPML
H8L4S5_FRAAD          QVPAESRGTALGAYAAFQDIAYGVTGPLTGLLAMWLGYRSVFLAAAACAALGIGLAMHIL
A0A0B4XL39_9GAMM      RVEPQMRATALGGYAAFQDVAYGLTGPLAGLMVGAYGYASAFLIGAVAALLALVIALQLS
C5AK99_BURGB          HVPAQARGTALGGFTAFQDVAYACTGPLAGWVVARTDYPSAFAIGAGAAFAGVLLTAWLM
A0A0J1CIL2_9BURK      RMPSHSRAIALGTFTAFQDIAYFVTGPLAGLIASGLGYEAIFGAGVVTSCAGVAVTVWSK
A0A1A9HL04_9BURK      RVPPASRGSAIGAFAAFLDIAYGLAGPTAGLVAGRFGFAAVYALGAIAALLGVVLIVTGP
A0A1E3ZBZ6_9BORD      RVPPESRGVAVGGFLAFVDITSGVTGPLAGLLIGVYGYRAAFLAGLAACVLSFVVIVFGM
J2WBC4_9BURK          RVPAHSRGLAIAGFMACVDVAAGLTGPVVGMVIGWAGYPSAFFSGALACVAALMVMTR--
G9ZUP1_9PROT          RVPPSQRGQAVGNFVAFFDIALGLGGPLLGLVVAMGGSGAPFLAGALAILLSMLMVRRLP
J1ERY9_9BURK          SVPPEQRGRAVGNFIAFADIALGVTGPVVGMATHWFGIGTAFLVGAGATCLALALLASVR
A8IDF7_AZOC5          RVPRESQGAAIGSFMAFLDIALGVTGPLAGLLAGVAGFGSVFGAGALACLVAIGLVLAMG
Q5NLD0_ZYMMO          HVPPQNRGAAMGAYVAFVDIGLGLAGPLSGMVVSQFGYPSAFLLGACASIVAFAFVLRLP
A0A0D6MQH6_9PROT      RVPPQNRGAAMGAYVAFVDIGLGLTGPVQGVVAGLFGYAAPFLVATLGAGVAWLSVRAMA
A0A171KR32_9BURK      RAPPQSRSLAMGAYVACLDISMGITSPLAGLVARNWGMSAVYLASSVLVGASVLVAFALL
A0A1A9HIG8_9BURK      RAPPQARSLAMGAYVAFLDISLGIISPAAGALARAYTVDAVYLAGAVVVALSSLVALALL
A0A0S4KA94_9BURK      RAPPESRASAMGAYVAFLDMSLAVSGPLAGLVAMRWDVGSVYLAGALAVASSACVALRLR
F5Y2A5_RAMTT          RAPPQSRGAAMGGYVVFQDIAMGLSAPLGGALAIQAGLGAVYLAGAVAALGSAVLAVGML
A0A0B1YKP8_9BURK      RVPPQNRGLAMGAYTAFLDLALGIASPALGLLAHWAGLRMVFLVAAVIACCSAGVSVALM
N6UHQ6_9RHIZ          RAPPQSRGMAMGAYTACLDLALGASGPLLGLVANHTGFSDAFLVSSFCVLCVIPIALRLK
A4JLV8_BURVG          GIAPRNRGMAMGIFTAFLDVAMAVGSPALGFVGAHGGLRVVFLASAIIVACAAGVATRLI
X6DCT0_9RHIZ          RLPPRSRGLAMGLYTVFLDVALGFGSPALGLVAASAGLQFVFFAVAAATLPALGIALLLG
A0A0Q4YES1_9BURK      RVPASNRALAMGVYTAFLDLSLGLASPLMGWAGESAGLPTIFVGAAVAVLLATVIAIHLA
W0RHM1_9BACT          LAPPEAKGLAMGAFTAFLDLSLGIASPALGLIAGRAGLGSVFLVSSVVTLGAVPVARRLQ
A0A0Q5VSH3_9RHIZ      AAPPENRGMAMGLYSACLDLTLATSGPLLGLVGNAAGLPAIFLVSALVVVCASPIALLTL
                            :. :.. :    *:     .*  *           :                  

D5QHT3_KOMHA          ---AARRQQETILE----------------
A0A4Y3TMP0_9PROT      ---LALKPHNA-------------------
A0A060QKI6_9PROT      ---GNATRTSNSNQTPFST-----------
A0A023D7A1_ACIMT      ---SAHQRTGTAVA----------------
A5G0M5_ACICJ          ---LAHRGARGAAG----------------
V2IR34_9BURK          GRSCAHPQADSSAAP---------------
Q7NWW8_CHRVO          ---LADRAPAPEPIQK--------------
M1WJT7_PSEP2          ---NTPKQSR--------------------
I8RA14_9FIRM          ---MIKNLPINNTDSTL-------------
B8J4I4_DESDA          ---AVQKTAVTH------------------
A0A023D7A3_ACIMT      ---IRLDRRESDVSSG--------------
A0A270BDL9_9PROT      ---AWRERAGALVD----------------
A0A158MA61_9BORD      -----RRQSAAR------------------
W0I3W5_9GAMM          -----RADARSSQR----------------
YFCJ_ECOLI            R--RG-------------------------
D8MUZ3_ERWBE          R--NQ-------------------------
A0A097R2N9_HAFAL      R--PVASQTGES------------------
C3X8M5_OXAFO          R--SGSPVPIE-------------------
W0HKU8_9GAMM          R--QRRLDSGDSGL----------------
A0A0J8YTB6_9GAMM      R--TGAPRSTA-------------------
Q6F9M3_ACIAD          Y--YVLKHRQTS------------------
I0QRC9_9GAMM          P--RGKNPSNYATCHQRHKKTAK-------
Y4428_SALTY           R--QH-------------------------
D4GCW6_PANAM          K--NE-------------------------
S7VDN3_9DELT          R--RARA-----------------------
H8L4S5_FRAAD          H--RDRARSAARG-----------------
A0A0B4XL39_9GAMM      W--VCRKRVAAC------------------
C5AK99_BURGB          H--ADRSPR---------------------
A0A0J1CIL2_9BURK      R--AT-------------------------
A0A1A9HL04_9BURK      TGAAVPPRPVSE------------------
A0A1E3ZBZ6_9BORD      GKEPERGA----------------------
J2WBC4_9BURK          ---PRRG-----------------------
G9ZUP1_9PROT          PALPQR------------------------
J1ERY9_9BURK          LGGRA-------------------------
A8IDF7_AZOC5          RRTAS-------------------------
Q5NLD0_ZYMMO          CIIAGDIYFMRKLGCIERLENDCSGQVEHI
A0A0D6MQH6_9PROT      RNLASASDL---------------------
A0A171KR32_9BURK      GTRPAAQQP---------------------
A0A1A9HIG8_9BURK      IAKPQGAARG--------------------
A0A0S4KA94_9BURK      ASGPA-------------------------
F5Y2A5_RAMTT          RRPHPSAGEAPAGKG---------------
A0A0B1YKP8_9BURK      RAAGRR------------------------
N6UHQ6_9RHIZ          ------------------------------
A4JLV8_BURVG          RKPGVAI-----------------------
X6DCT0_9RHIZ          RHNRPL------------------------
A0A0Q4YES1_9BURK      ARRLP-------------------------
W0RHM1_9BACT          RGPAHAAHPMRPSPS---------------
A0A0Q5VSH3_9RHIZ      RREGAKAACQAES-----------------