CLUSTAL format seed alignment for MF_02095

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B3ECK7_CHLL2          -------------------------------------------MFPSPE-----TGIAVQ
A0A060RDB2_9BACT      -------------------------------------------MCLAREQTDFLLTRAFN
I4AFX0_BERLS          -----------------------------------------------------MIEIAII
C0QSU4_PERMH          --------------------------------------------------MKDLINELIK
C6C145_DESAD          --------------------------------------------------MEEIIKNLSC
L7VL63_THES1          ---------------------------------------------MNLEDLTGVLEYVKK
CYSQ_HAEIN            ----------------------------------------------MLTLNEHLLNQVLL
CYSQ_AGGAC            ----------------------------------------------MPILTTHLLQDVIE
Q9CKQ8_PASMU          ----------------------------------------------MLALSPSLLEKTLE
A0A248ZWW1_MANHA      ----------------------------------------------MQTLTQPLLENIIN
Q9KNL0_VIBCH          ------------------MKRAASQPCCWLCVFFRRESHAFGVTMSTPQDLSHLLPDVIN
A0A0K2DU52_PISSA      ------------------------------------------------MEKQALLDGVIA
A0A0H4VE81_9COXI      ----------------------------------------------MANDWHHQVDSLIL
A0A0P0UT70_9GAMM      -------------------------------------------------MFDQILPSLIK
Q2JP57_SYNJB          ---------------------------------------MQAQDLAA------LLPEVCR
B8GP85_THISH          ---------------------------------------MKPDDLPEGLTLEHLRNNACL
C5BID9_TERTT          -------------------------------------------MENEITALGELVAKVNE
Q0A624_ALKEH          --------------------------------------------------MNNLLTTLHT
F6CYW1_MARPP          ---------------------------------------------MQDVNQHPVFQALQK
A0A0C5VES5_9GAMM      -----------------------------------------------MENLTELVPELVE
B3PHB5_CELJU          ---------------------------------------------MSPVIDAALVRHLLA
H7C7D8_COXBU          -----------------------------------------MIKMEAFIYSEKMLTSVIE
CYSQ_ECOLI            -----------------------------------------------------MLDQVCQ
CYSQ_SHIFL            -----------------------------------------------------MLDQVCQ
CYSQ_SALTY            -----------------------------------------------------MLEQVCQ
CYSQ_BUCAI            -------------------------------------MQKINFFDTINNIWRKMLDKICQ
A0A090AL43_9ENTR      -----------------------------------------------------MLKKICK
Q7VQN6_BLOFL          ----------------------------------------------------MIVDQIIY
G8TYZ6_SULAD          ------------------------------------------------MNPTDWANRLEP
N9F3G7_ACIHA          ------------------------------------------MFVKTLAPQDNFILQLVP
Q11K40_CHESB          --------MLTSALP-------------------------------SMAGETALLALFEE
A0A3D3Z4W7_9RHOB      --------MQHHDSS-------------------------------VPSVPDSLVVALEA
Q92VH5_RHIME          --------------------------------------------------MTPLCEMLER
F8J7G7_HYPSM          -----------------------------------------------------MLDTLER
A4YN86_BRASO          -----MATGPTPGTI-------------------------------GVEAAAALMTPLTE
A0A246K7L7_BREDI      ---MTVSVSAYADLE-------------------------------TDLASGRLAEVIAD
A0A0D6JJU9_9RHIZ      MSLVRGNSLRKVGLSHYVYRHYLFVSQSKRPRIGPPRATNFKEQLIMSESFVGLAEALLP
F8J9G0_HYPSM          --MIRVEVLKRAMVP------------------------------IDVKDYDALIAALLP
A0A0A8K633_9RHIZ      MSAPRHTTAAHAEPA-------------------------------TVFDLPTAAQVLTD
E3I2B6_RHOVT          -------------------------------------------MSFDASDIRELGLWGLP
K7ZCX0_9PROT          ---------------------------------------MPLFATVNPADKVALLNSVAV
G2KPZ3_MICAA          -----------------------------------------MNKLFDPAYYGALCNMVRR
G7QAA3_9DELT          -------------------------------------------------MTPLDLNALQG
B8DML4_DESVM          ----------------------------MIDPAGKAEGSPAATSVARSSAASFPLRDLLP
I3TN37_TISMK          ------------------------------------MPTDLPADRTDAGIALPPLDALVD
A0A075MNA8_9PROT      -----------------------------------------------MLLKQNQIEKLII
A0A077FMD1_9RICK      ---------------------------------------------MIDFLNHAVIQKIIN
H8K4T0_RICAG          -------------------------------------------------MNDNLINALKD
Q5NPK2_ZYMMO          ------------------------------------------MLLSSLSPQAALLEGLVQ
B2HS89_MYCMM          -------------------------------------MGGIVYEAVSTTLADKHLERVTA
D5V7G3_ARCNC          -----------------------------------------------------MIDKVIK
G2KLW5_MICAA          -------------------------------------------------------MSAAL
C8PI72_9PROT          ------------------------------------------------MDLNELLALATD
                                                                                  

B3ECK7_CHLL2          TALEAGELILECYGS----------KEIQTEYKPDNSPLTTADRNSNEIILQKLLET--G
A0A060RDB2_9BACT      AAVSAGAKIYEIYTSY---------DDFGVSLKADSTPITIADRQAHSIIAKRLAQT--R
I4AFX0_BERLS          AAVKAGERIKEIYDKFDDENNTNYTTDNIVSYKSDNSPLTLADKEANKIIEKNLIPL--G
C0QSU4_PERMH          ISKEAGKEILDVYSSY-----------ISVEYKEDKSPLTEADKRSHQVITDSLEKI-SS
C6C145_DESAD          IAREAGAAIMAVRNKG-----------FDVKNKNDKSPVTEADIASNEVISKRLKELYPE
L7VL63_THES1          ITKEAGRIILDVYKKD-----------FQVDFKDDLTPVTEADRKSNDFIVSSLKNRYPE
CYSQ_HAEIN            IAYQSGKHLQQFY-----------QKQVHVELKEDNTPVTEADLFVSQFLTEKLTALFPN
CYSQ_AGGAC            IAQQAGEHLRCFY-----------QRSVTVRMKEDNTPVTEADLFVSQFLTEKLTALTPQ
Q9CKQ8_PASMU          IADQAGDFLTRFYTDS-------GQNALAIQTKQDNTPVTAVDLFLSQFLIEKLTSLTPE
A0A248ZWW1_MANHA      IAKAAGEQLKQLY-----------ARSVAIKIKADCTPVTEADLIISQFLTERLKQLTPD
Q9KNL0_VIBCH          IARAAGQLILDIYQ----------NKSYEAFTKSDSTPVTSADLAAHKFLCEQLRELTPD
A0A0K2DU52_PISSA      LSKKAGCRVLDVYKN---------LDSVEIAIKADATPVISADLESHEILMKGLSELAPR
A0A0H4VE81_9COXI      LVKHAGAGILKFARFP--------KEAMRIQGKHDNTLLTEADLCAHGILYEGLQSLTPN
A0A0P0UT70_9GAMM      LTTKVGDEILSHY-----------KNDIKVEFKTDETPLTIADKNAHRAIAEALSKLTPN
Q2JP57_SYNJB          LAEAAGQAILPFYR----------QKSLPIQLKADASPLTEADLAAHHLILQGLQELTPG
B8GP85_THISH          IARQAGESILAIYE----------Q-GFEVLEKDDRSPLTEADMAAHRLIVSALKELTPG
C5BID9_TERTT          IVVAAGDAIMDIYQ---------QPD-FNVEIKDDNSPLTRADKAAHNILAAALEALDCG
Q0A624_ALKEH          AMDEAAHRVMAIYA---------DPDRFDTRRKADDSPVTAADLAAHDCLVAHLRAVAPD
F6CYW1_MARPP          IIHDAATAIMEIYQ---------SAD-LGIQQKSDDSPVTAADLAAHRIILSGLQALTPD
A0A0C5VES5_9GAMM      ICQRASDAILAIYD---------CPENYNIQSKSDESPVTAADLVANDIILEGLTRLTPE
B3PHB5_CELJU          IGRDAGAAIMAIYR---------DKDSHGVVHKADDSPLTAADLAAQAVIASRLAQLL-D
H7C7D8_COXBU          IIKFAAKKILSIYS---------EPTSLVVTKKGDGSPLTKADQLAHDFISAQLTNLTPK
CYSQ_ECOLI            LARNAGDAIMQVYDG---------TKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPD
CYSQ_SHIFL            LARNAGDAIMQVYDG---------TKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLAPD
CYSQ_SALTY            LARNAGDAIMQVYDG---------AKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPD
CYSQ_BUCAI            LARSAGHCIMKLYNS---------QKFINVSYKPDNTPITDVDYAANNIIKKGLSLISPQ
A0A090AL43_9ENTR      LVYKAGKNIMTIYK----------QKNIEVFKKDDSSPVTIADLLSNKIIIKGLQKMTPY
Q7VQN6_BLOFL          IARIAGMEIMRIYTGF-------GHRKIYVQQKMDQSPVTNADLIAHQVIVYLLRNLTPN
G8TYZ6_SULAD          ALAAAERLILAVYER----------AEIPRRLKADQSPVTEADHGSSQILVEALRRLTPE
N9F3G7_ACIHA          VMAQASQILLEEYQNYC------AGGEFNIQEKIDDSPVTQADLKVNRFIIKKLAELTPD
Q11K40_CHESB          LALAAGRQVMAHYE-----------AGVQIEHKSDASPVTEADRAAERVILAGLRATVAG
A0A3D3Z4W7_9RHOB      LARRAGSAILEVKR-----------VGIQAEAKSDGSPVTDADLAANEVILEGLSTLLPG
Q92VH5_RHIME          IALDAGAAILEVYD-----------AGPQVCYKDDHSPVTEADERAEAIILERLAAAFPQ
F8J7G7_HYPSM          IAIEAGTLIAKIRQ-----------GGANVMTKSDGSPVTDADQAAEDLIVRALQRVAPD
A4YN86_BRASO          LVVEAAHAILAVNR-----------RAMAVTDKSDGSPVTEADLAADRVIADGLARLAPD
A0A246K7L7_BREDI      IAEEAARLILPYWR-----------ADTAVETKADASPVTEADRAAETLILSRLAEHWPQ
A0A0D6JJU9_9RHIZ      SVLAAGAKTMHYFR-----------TGVETETKADGSPVTLADQAAEEILLEGLSRAAPG
F8J9G0_HYPSM          AVREAGRLEMAHFN-----------NGVSFEQKADRTPVTVADKEAEAIILAALARIAPD
A0A0A8K633_9RHIZ      AAAKAGAAIMTHYG-----------ATEGIDCKEDNSPVTQADRDANDILEAALRDFAPS
E3I2B6_RHOVT          LAQRAGAVIMDIYT-----------TSPEVRYKADRSPVTDADVACEHIILKALSRLAAD
K7ZCX0_9PROT          IARAAGEIELFYYRT---------DTV--TFTKMDGSIVTSADQAADNYIVQNLNLLTPN
G2KPZ3_MICAA          AAIAAGDETLNYFDE---------SGVPETMIKADGSPVTLADHAAEEIIIKALADIDES
G7QAA3_9DELT          LVRLAGHAVLDLYR----------NGFS-VEEKSDHTPVTTADRRSSEILLEGLARLFPD
B8DML4_DESVM          LVMEAGRAILHWCG----------GAAPRIRRKADDSPVTEADEASQAVLAHGLARLRPD
I3TN37_TISMK          LARRAGEAIMALYG----------PGVE-RWTKADESPVTAADLAAHEVLTRGLAALTPD
A0A075MNA8_9PROT      LVKEAGEQARRYYDF----------SNINVQYKPDKSPVTIADQELSDLITAQLKQMFPH
A0A077FMD1_9RICK      TALKAGDLIMDFYS-----------QPLSVQIKSDNSPVTIADIEANNFIVQALNHITPD
H8K4T0_RICAG          LIINTGKIALDIKK-----------AGILTDIKSDGSVVTNADKEISKIIYQTLQTLTSQ
Q5NPK2_ZYMMO          IALQAGKRALEIYH-----------GDFTVMKKDDDSPVTQADREAEAIILQGLKKLQPG
B2HS89_MYCMM          IAVEAGKLTLKYRQN--------PEVTEKGDHGDDTSPVTEADLAANSYITNHLAALDPD
D5V7G3_ARCNC          IAEKASIEILKIYEDN----------NFKITIKDDDSPVTRADLASNKLIIEGLNQI-SD
G2KLW5_MICAA          SATKAGGEKTMQYYKS----------GLDVTIKNDGSPVTQADQESHKVICKILNE--TG
C8PI72_9PROT          AAKKANAAIMQNYDK------------FDIFVKADRSPLTNADLAANDAIMRALEP--SG
                                                        * : :  .*      :   *      

B3ECK7_CHLL2          LPVLSEEGVPIPYEERKE-WPAFWMVDPLDGTREFLAGNGEFTVNIALIRD----GHPVL
A0A060RDB2_9BACT      IPILSEEGRDILYEERQN-WDLFWLVDPLDGTRQFIERTGEFTINIALIAD----NKPLL
I4AFX0_BERLS          LPILSEEGKITPYSERKD-WDKFWLVDPLDGTREFVKRNGNFTVNIALMEN----NIPVV
C0QSU4_PERMH          YPVLSEEGKDIPYNERKN-WEYFWMIDPLDGTKEFIKRNGEFTVNIALIHK----NRPVL
C6C145_DESAD          IPILSEEGTKIPYEERKQ-WDIFFLIDPLDGTKEFIKDNGEFCVCIALMRK----KRPIL
L7VL63_THES1          CAVLAEESENDP--ERLK-NDWCFIVDPLDGTKEFIQKNGEFTVNIALSYK----GKPVL
CYSQ_HAEIN            VPVLSEENCHISFEERKN-WKEYWLIDPLDGTQQFINRTDQFSVLITLVRK----NKPVL
CYSQ_AGGAC            IPILSEENCHIPLTERQT-WRSYWLIDPLDGTQQFINRTGQFSVLVSLVKD----HQPVL
Q9CKQ8_PASMU          VPILSEESCKIPLQDRAH-WAEYWLIDPLDGTQQFINRTDQFSILITLVQH----NQPVL
A0A248ZWW1_MANHA      IPVLSEEFCDIPFAERQQ-WQEYWIIDPIDGTQQFINRTGQFSVVIALVQKREGRNQPVL
Q9KNL0_VIBCH          IPILSEEEANIDLATRET-WQRYWLVDPLDGTQEFIARSGDFATIIALVEN----NHPVM
A0A0K2DU52_PISSA      YPILSEERVNVPFSEREH-WSCYWLVDPLDGTREFIRGNDEFTINVALIEN----GQPIL
A0A0H4VE81_9COXI      IPILSEEGEIPSYEARSR-WQRYWLLDPLDGTRGFVERLDEFTVNIALIEK----HQPIF
A0A0P0UT70_9GAMM      TPVLSEESTVVDFKERSK-WTEYWLIDPLDGTKDFIERTGEFCICIAYIKN----HRAIF
Q2JP57_SYNJB          IPLLSEESSDIPYAQRQV-WRHFWLVDPLDGTREFIEGSGQFTVNIALVEV----GIPIL
B8GP85_THISH          LPVLSEESEQIPYAVRAG-WRTYWLVDPLDGTREFVKRNGEFTVNIALIHE----HEPVL
C5BID9_TERTT          -PVLSEEDANIPWGERQQ-WQQYWLVDPLDGTKEFIKRNGEFTVNVALIKD----GVPIL
Q0A624_ALKEH          IPVVSEEARPAPWSERRH-WSRCWIIDPLDGTKEFLKRNDEFTINVGLVEG----GQPVL
F6CYW1_MARPP          IPVLSEEG-TVKFEERVH-WPSLWIVDPLDGTKEFIKRNGEFSINIALVQD----GRPIV
A0A0C5VES5_9GAMM      VPIMSEES-IIDWEERKS-WQQYWLVDPLDGTKDFIARNGEFCIAIALMDQ----DEPLL
B3PHB5_CELJU          LPIVSEEAQIPAFAERSR-WESYWLVDPLDGTREFVAGNGEFTVNIALVHA----GRPIL
H7C7D8_COXBU          IPIISEELDFEIYSNTLL-NSYFWLVDPLDGTKDFIKRNGEFTVNIALIKD----AKVVL
CYSQ_ECOLI            VPVLSEEDPPG--WEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDH----GKPIL
CYSQ_SHIFL            IPVLSEEDPPG--WEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDH----GKPIL
CYSQ_SALTY            IPVLSEEDPPA--WEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQ----GKPVL
CYSQ_BUCAI            IPIISEEESYN--FEICRNWNSYWLVDPLDGTKEFLKKNGEFTVNISLIEY----GVPIL
A0A090AL43_9ENTR      IPILSEENLEK--WEKRKKWTKYWLIDPLDGTKEFIHHNNEFTINIALIEH----GKPIL
Q7VQN6_BLOFL          IPIISEECIPE--WRDCRHWNNFWLIDPLDGTKEFLSRNGEFTVNIAFIQN----GEPTI
G8TYZ6_SULAD          IPVISEEA----EWSG-ESVPRFWVIDPLDGTKEFIAHRGEFTMNLALIDG----GKPVW
N9F3G7_ACIHA          LPVLSEES----DYSARKDWERCWMLDPLDGTKEFIHERDEFTINLSLIEN----HETTF
Q11K40_CHESB          TPCVSEEEASGGVLPACG-DEGFFLVDPLDGTREFIGRRPDFTVNIAYVKD----GAPVV
A0A3D3Z4W7_9RHOB      IPLITEEGDEGFRVLASP-DDDFLLIDPLDGTREFLSGDPDYTVNIAYVRG----RRPVV
Q92VH5_RHIME          IPVVAEESVSSGRVPDIS-GGTFFLVDPLDGTKEFINRRNDFTVNIALIEG----NVPVA
F8J7G7_HYPSM          IPIIAEESAASCVADHST-SRALFFVDPLDGTKEFIRGRPDYTVNICLVEN----RKPKL
A4YN86_BRASO          IPALSEERVSACAAP--F-KGSFFLIDPLDGTKEFLAGRGEFTVNLALVRD----ASPLL
A0A246K7L7_BREDI      VEAVAEEAVAADGAPPSV-GAWFWLIDPLDGTKGFVQGRESYSVNIALIRD----DAPVA
A0A0D6JJU9_9RHIZ      VPVVAEESMSAGKVPN-L-EDTFFLVDPLDGTREFINRRNEFTINIGLIRD----KRPIF
F8J9G0_HYPSM          VPVVAEEEIAAGKVCH-Y-ARRFFLVDALDGTRLFIRRKPEFSINVGYVED----GRTKF
A0A0A8K633_9RHIZ      IPVVSEETATDRKAP--L-GRLFFLVDPLDGTKEFIKKRSDFTVNVGLIED----GFPCF
E3I2B6_RHOVT          IPVVAEEALSCGAAPK-I-EDRFFLVDPVDGTKEFIRANGEFTVNIALVEN----HAPVF
K7ZCX0_9PROT          IPVVAEESFEAGNIPDIS-CGRFWLVDSLDGTKEFVNNSIDFTVNIGLIWD----GIPIL
G2KPZ3_MICAA          VPVVAEESVAAGRIPDLAGVTRFWLVDPLDGTKGFISGSGEYCVNIALIEN----GVPAL
G7QAA3_9DELT          IPVICEET-ESAPYAVRRRYKRCFVVDPLDGTKEFIRHCDEFCVLLALVEN----GSPAF
B8DML4_DESVM          LPVLSEEG-RIPPHAERAGWPRFLLVDPLDGTRGFLNGEGDFAVCLALVEH----GFPTA
I3TN37_TISMK          LPVISEEAVTEAELAAGAPAAAFWLVDPLDGTREFLSRNGEFTVNAALVVD----GRPIA
A0A075MNA8_9PROT      IPIISEEADQEHNMDILKENDTYWLIDPIDGTKSFIRKKGDFTINIALIKN----KTSEF
A0A077FMD1_9RICK      ILVISEEDE----TPIHINEKIFWLVDPIDGTKSFINKTGQFTVNIALVHN----KYPIF
H8K4T0_RICAG          IAIVCEEQP-----LPIFSSDTFWLIDPIDGTWGYVNGKSTYTVNIGLIAN----GFPTV
Q5NPK2_ZYMMO          VAVIAEEEYAK--TKKGYNTDSFFLVDPIDGTQEFVNKRDEFTVNIALIKK----AYPIL
B2HS89_MYCMM          IPIISEETKSADYETRQH-WQRFWLVDPLDGTKEFIKGSDEFTVNIALIEN----QEPIL
D5V7G3_ARCNC          YPIITEETPIS--YEIRKNWRKFWLVDPLDGTKDFISKNGEFTINIALIEN----NKPIL
G2KLW5_MICAA          VPIISEEGKVW--ADVPP---QYWLVDPLDGTKDFIAANDEFTINIALVKE----GHPVL
C8PI72_9PROT          IAICSEERVLD--SKRRMSEERFWLVDPLDGTKEFIARNGEFCVCIALIEH----GRPIL
                           **                 .:*.:***  ::     :                  

B3ECK7_CHLL2          GVIYAPAKEQLYFASKDEGAFFIDGARGMTASP---DRLAEAARRLPFSSNPD--SFRIV
A0A060RDB2_9BACT      GVIYHPCSDTVYLSDPDRGAFSKVGVRVSQTTEYTVNEIFRDARKLPLHNEQGGRSARLL
I4AFX0_BERLS          GIIYVPVTGVLYVGELGKGTYKQELNQKNTIET--AEKIIVKVSKR--KNEEG---IIAF
C0QSU4_PERMH          GVVYAPAIDTLYYGGKDIGAYKINN-----------NETADLNSIKP--SEEYPKRITVV
C6C145_DESAD          GVVYAPTQDALYTGSIETGAQVSKN-----------GEPPVAISTRP--PAEN-EGLIVV
L7VL63_THES1          GVIGIPVTGELYYAVKGKGAFYEKD-----------------GHAEQIHVSTRTDDIRLV
CYSQ_HAEIN            SVIHAPILSTTYYAMCD----FGTFK-KQLDQV----KKLTKN-----TTNF-DRPLRIA
CYSQ_AGGAC            GVIHAPMLGSTYYAMQG----FGAYK-HHDGQH----LKLAFH-----DIQA-DNALRIA
Q9CKQ8_PASMU          SITHAPILQTTYYAMQG----FGAYR-RQGNQQ----EKLNNQ-----ARPE-QRKIKIA
A0A248ZWW1_MANHA      GVIHAPILGKTYFSMEG----SGSFL-QENGEI----RPLVKP-----KRAE-NALLIVT
Q9KNL0_VIBCH          GVVYGPVSGVTYYAYAG----KGAWKIPDMAQS----LKIQTH-----KHELPSSSIAIA
A0A0K2DU52_PISSA      GVVYVPVTGQCYFACAG----NGAFVQQGDQPA----VRICSQ-----PYQQ-GEKIRLV
A0A0H4VE81_9COXI      GVVYAPVQKECYFAHQK----HGAFKQIEDNVP----QQIHTR-----KMNW--QAFSVY
A0A0P0UT70_9GAMM      GLVYAPITRVHYYGFE------GVAYKYHQNI-----QTIINA-----CMKK--QPLRIV
Q2JP57_SYNJB          GVVHAPALGLTYAAAQK----LGACK--RERTP----SCVHEQPIR--TCPYAQEPLQVV
B8GP85_THISH          GVVHAPVLGVCYRAARG----LGAQRIAAEGEP----EALHISRRR--TRPV------VA
C5BID9_TERTT          GSVYAPDKGWLYYG----AKGVGAFKVDDAKAA----TAAESISPA--VVPGSDDVWRIV
Q0A624_ALKEH          GMVDAPALGERYYA----IRGEGAWRQSAGAEP----RSIRVVEPP--RAG--DRPWRVV
F6CYW1_MARPP          GMVYLPTTLEGYFGVTEAWQDLPVGAIKWHDDV----EHEATYESI--NVRVPREPIIVM
A0A0C5VES5_9GAMM      GFIFQPVTGDYY------WGSRVLGSFHGRQRL----NGFRTDDN---EFRVVGS----R
B3PHB5_CELJU          GLVHVPVTDITYLGILAEAQPAGAWKYQGDGTP----QAIRTSDIN--QRLSQGLPLRVL
H7C7D8_COXBU          GVVFVPVTNTCYYA----NKVVGAFKQVGEQPP----QQLQLTPQN--KARDLNQPIKVA
CYSQ_ECOLI            GVVYAPVMNVMYSAAEGKAWKE-ECGVRKQIQV----RDA--------------RPPLVV
CYSQ_SHIFL            GVVYAPVMNVMYSAAEGKAWKE-ECGVRKLIQV----RDA--------------RPPLVV
CYSQ_SALTY            GVVYAPVLKVMYYAAEGKAWKE-ECGVRKQIQV----RDA--------------RPPLVV
CYSQ_BUCAI            GVIYAPFFDVLYSAFYDNAWKEEKFGSKKKINV----AQA--------------EAPLLV
A0A090AL43_9ENTR      GVIFAPALSTIYYATKKESWKE-KNGKKKQIFS----KKK--------------NNPLII
Q7VQN6_BLOFL          GVVYVPVYDVLYVANYGQAWKINSIGKQELLNI----TDYTYMS--------RYKNPLVV
G8TYZ6_SULAD          GLIAVPLSGRRYVAWDRQ---AYRVEPDGSWHR----LNPLMPP---------HNGLRVA
N9F3G7_ACIHA          AIIAVPCEQVMYIGYRSQLPYKYSFSRQEWFQY----QVESHSL---------TTPVQIG
Q11K40_CHESB          GVVYAPARGLLYSGRP-GAAFEAECHNGAITS-----RRGINTR-------PRRNPPAIV
A0A3D3Z4W7_9RHOB      GIVHMPETGLSWVGDS-RSAPHVAWQVDQTDD-----WQMIQTR-------GAGDALAVL
Q92VH5_RHIME          GIVYAPAQPCAYVADG-GRAEKLLLDPAWALEH----RQAIRVR-------VRGAELTAV
F8J7G7_HYPSM          GVVFAPARGELFSSDG-LASYRSAILQDASIGE----RSQIRAS-------CGDGRLTAV
A4YN86_BRASO          GIVCAPAIGLIWRGLV-GRGAERLSFSEAGLSA----PAPIRTR----PMPKPGEPWVAA
A0A246K7L7_BREDI      GVVTAPALGISWRSAAPGQGALRRAFGEPW--------RPIRVR----ERP---ADAVAL
A0A0D6JJU9_9RHIZ      GIIFAPALSQLYLTLADDHAISAPLDPDAETCS----LQGLNADRMRTSALNAESGMTIV
F8J9G0_HYPSM          GLIYLPPSERLFVTRPD--GAYEAHMPIAGDVP----FAALRFKRLTTRKPDP-NALVAF
A0A0A8K633_9RHIZ      GLVYAPARGLLAVTVADGVAIEASMPPSAAGAD----LSVLTQKRLHARAADP-EAVTAL
E3I2B6_RHOVT          GLVYAPAFSDCYVTLGTDRAVRVKLVPDHHPEP----RPDYAFEPISGERPGS-RDFTAI
K7ZCX0_9PROT          GALHTPENGIVWGGILGEGAWEESKDG-TRKII----TVRKSHP---------DKLTIVA
G2KPZ3_MICAA          GVIYAPVVGELFAGYGAETALRYMVDDDQEKDI----ACRRAPR---------NGLTVMT
G7QAA3_9DELT          GAIHVPATDTLYCGGPGLPATRRVANGPAEPLR----AAAPAPG----------QPLVIL
B8DML4_DESVM          GILHFPALGVTWFGGRGCGAWRLEHDAPPEPVH----AARTFP-----------QRATVM
I3TN37_TISMK          GVVGVPATGRIYAGCP-DGAVVVEADGSRRPIR----V-RAVPA----------DGPVAL
A0A075MNA8_9PROT      GIIYQPLKQALYYTSADKKAYKEYNGITTQIKV----NQN----------IKNDKALNIV
A0A077FMD1_9RICK      GVIYAPLSQTLYF-NKHNIAYKQHNNSTIPISV----NNN----------WDE---VVAI
H8K4T0_RICAG          GLIYHPETAKLYYTDVNGRLKIEQNSKEIFVNH----EPK----------HEE---LNAV
Q5NPK2_ZYMMO          GVIYAPAINRLYVGDVLAKTAWAADTTEDFQIE----NRNSIQI------REAGEKWDVM
B2HS89_MYCMM          GAIYVPAKQLLYYAAKGHGSWRVKDNGTPVQIF----SSVPDLS----------NGLTIV
D5V7G3_ARCNC          GVVYIPITNDVYYAKKGGGAYKN----NSRIFN---------------------NSKRKD
G2KLW5_MICAA          GVIYAPALGEIYYASKSQSAWMEIGTEKTQLTE---------------------RSAPKS
C8PI72_9PROT          AVIGIPISGDIYSSN-GGRVYKN-----GALLA---------------------RPNSAP
                      .    *                                                      

B3ECK7_CHLL2          ASRS----HMDEKTLSYLERLRQNNPD------------------------------LDV
A0A060RDB2_9BACT      LSRV----RESNVAHDFIENVRTDHPD------------------------------LQV
I4AFX0_BERLS          KSQS----HSGAKDNNYLSQFNVK----------------------------------EI
C0QSU4_PERMH          ASKS----HLNEETKEFIKMLENFYEN------------------------------VET
C6C145_DESAD          GSRS----HPAPELADYLETLNV----------------------------------EKM
L7VL63_THES1          MSRS----HKSQRLLELVEKNGIK----------------------------------NI
CYSQ_HAEIN            VGATTSQEKVRSILPKDF----PC---------------------------------EFV
CYSQ_AGGAC            VGSAAAAEKVRSILNKNL----AY---------------------------------EFH
Q9CKQ8_PASMU          VGVGGVERKIQPLLNPAY----QY---------------------------------EFL
A0A248ZWW1_MANHA      VGSDLHAEQAKNAISAP-----QI---------------------------------ECV
Q9KNL0_VIBCH          ISRRQDINKITRRLSSAW----NY---------------------------------DLV
A0A0K2DU52_PISSA      AGHWHDLERLAKFTRQFP----QY---------------------------------SIE
A0A0H4VE81_9COXI      LGEFL-HSPRLPRLFETI----PA---------------------------------AKV
A0A0P0UT70_9GAMM      TGHHSSNNSKLKAHFATL----GE---------------------------------YEL
Q2JP57_SYNJB          ASRSHSNPETEQFLERLRQ-RCGS---------------------------------LEV
B8GP85_THISH          GSRSHGTERMADFLAGL-----GE---------------------------------HEY
C5BID9_TERTT          GSRSHQSDD----FKEFVKSFNG----------------------------------TDI
Q0A624_ALKEH          GSRSHASAE----TQAFIEQLPE----------------------------------VEL
F6CYW1_MARPP          TSRSHGPALPIDLKDTLKANYEQ----------------------------------VRE
A0A0C5VES5_9GAMM      RLKHRGPWF-----DWLQQTDFN----------------------------------IQR
B3PHB5_CELJU          LSHRHGTSATLGLVEQLARAWPGG---------------------------------IVR
H7C7D8_COXBU          ISRHHGLDG----IQKFIDKIGP----------------------------------CEC
CYSQ_ECOLI            ISRS----HADAELKEYLQQLGEH----------------------------------QT
CYSQ_SHIFL            ISRS----HADAELKEYLQQLGEH----------------------------------QT
CYSQ_SALTY            ISRS----HTDDELTEYLQQLGEH----------------------------------QT
CYSQ_BUCAI            ISRS----HPNETLKNYLEKIKCC----------------------------------KI
A0A090AL43_9ENTR      ISRY----HQDFELKNYLKNFNHD----------------------------------QI
Q7VQN6_BLOFL          MSRTCISEYDQKLLNDYLMQIKNY----------------------------------KI
G8TYZ6_SULAD          ASHS----HPELVRAWCREQAVPIREL---------------------------------
N9F3G7_ACIHA          LSHN----SKNPKYKNFIEPILLHREVT-------------------------------R
Q11K40_CHESB          ASRS----HSTPETEAFIARYPGA----------------------------------ET
A0A3D3Z4W7_9RHOB      ASRS----HQDPATEAFLKTVPVS----------------------------------EL
Q92VH5_RHIME          ASRS----HNSSETEAFLTGHGVM----------------------------------NY
F8J7G7_HYPSM          ASAS----HGNVETEDFLQKLPVD----------------------------------RK
A4YN86_BRASO          VSRS----HGDARSEAFIAARPGA----------------------------------DR
A0A246K7L7_BREDI      VSHS----ISEDDARRLAARNGCI----------------------------------QW
A0A0D6JJU9_9RHIZ      ASRS----HGSEALENWLADVDVA----------------------------------GR
F8J9G0_HYPSM          NSRG----AGA-ASSGLLALLKVH----------------------------------DA
A0A0A8K633_9RHIZ      VSLS----HLDAKTEEFLEGFSVA----------------------------------DR
E3I2B6_RHOVT          VSRS----NQTPEAERFIRRIGGP----------------------------------PC
K7ZCX0_9PROT          SRNH----YSLE-LDGYIRNMHVK----------------------------------KI
G2KPZ3_MICAA          TRHH----GDVDRLNGYLESLKVE----------------------------------KL
G7QAA3_9DELT          ASRS----HPDPGLTAYLGR--------FPG--------------------------CRL
B8DML4_DESVM          QGRV----RRTPRLDAFLAAHADICSAAFPGRPGAPAPVPLPSDTAAQDRLRAGLFPHRR
I3TN37_TISMK          ISRS----HLDPRTRDWLAAHEVE----------------------------------RS
A0A075MNA8_9PROT      VPTR----HLGEDALNFIASLNVTS----------------------------------S
A0A077FMD1_9RICK      ISAH----HRNRQINSYLNTLKLKS----------------------------------V
H8K4T0_RICAG          IGFY----NLNKATKEFLSKYSFGQ----------------------------------I
Q5NPK2_ZYMMO          TSFS----HNNPATEAYLKQLPIEN----------------------------------R
B2HS89_MYCMM          ESRS----HPSAALENYLKDFPIR----------------------------------KR
D5V7G3_ARCNC          LIGSDSNFHSTEETKEFFIKHNIT----------------------------------QI
G2KLW5_MICAA          LTMFSSRFHESEKSTLFAERYNVN----------------------------------CV
C8PI72_9PROT          QTFMHGHHGKSVKYAQFAQRFKMQ----------------------------------LV
                                                                                  

B3ECK7_CHLL2          LRCGSSLKFCMVASGEVHSYPRFSPTMEWDTAAGHAILNASGRTLIDTLTGRE-------
A0A060RDB2_9BACT      LEYGSSLKLCLLAEGSADYYIRTTQTMEWDTAAGEAIMRGAGVRICD-LHGND-------
I4AFX0_BERLS          RRKGSSVKFCLVAEGVADLYYRNGTTMEWDTAAGEAILKAAGGIMLNADTDTD-------
C0QSU4_PERMH          TSIGSSLKICLLAEKKADIYPRIAPTMEWDTAAAHAVLNAAGGRIIRYEKIQNLQDLKDL
C6C145_DESAD          TPAGSAIKFCLVAEGKAHLYPRFNPTMEWDTGAGQAIVEAAGGSMLGLDG----------
L7VL63_THES1          RNVGSAIKGCLVAKGEAEVYYRFGVTMEWDTAAMQCIVEEAGGIFRQLDDTEM-------
CYSQ_HAEIN            VVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLGETHGAIFDSHFE---------
CYSQ_AGGAC            ICGSSGLKSTLVADGVCDCYIRLGCTGEWDTAASEILLAEMGGIIFDLNYQ---------
Q9CKQ8_PASMU          VYGSSGLKGGLVADGTCDCYIRVGKTGEWDTGAAEILLREMGGAVFDFAFQ---------
A0A248ZWW1_MANHA      KYGSGSLKAGLVAEGKADCYIRFGDTGEWDTAVAEVLLSEMGGKIFDFNFS---------
Q9KNL0_VIBCH          PLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQLS---------
A0A0K2DU52_PISSA      KMGSA-LKLCLIAEGRADLCLRLVPSSEWDMAAAHIILSEAGGDITDFQFK---------
A0A0H4VE81_9COXI      VRLNSSLKFCRIAEGEGDLYPRFGNTSEWDTAAAQCVLRAAGGRIVDLSGK---------
A0A0P0UT70_9GAMM      NNLGSALKFCEIAQGHYDYYPRFGPCSEWDTAAGGCILQNAGGLVVDENGK---------
Q2JP57_SYNJB          KSVGSALKLCLVAEGSAHLYPRFGPTMEWDTAAAQCIVEQAGGRVTDLVGD---------
B8GP85_THISH          LSMGSSLKFCLVAEGRADIYPRLGPTSEWDTAAAQCIVTEAGGQVLDLQGH---------
C5BID9_TERTT          VAMGSSLKICLVAEGAADLYPRLGLTSEWDTAAAQAVVEAAGGVLLNWETK---------
Q0A624_ALKEH          VPMGSSMKVCLVAEGRADLYARLGPTGEWDTAAAQCVLEEAGGCLLSAETG---------
F6CYW1_MARPP          LPKGSSIKGCRIAEGIADLHLRRGPTSEWDTAAQQAIIEAAGGMLVTPEG----------
A0A0C5VES5_9GAMM      IQQGSALKFCRLAEGQADLYPRIGPTCEWDTAAGQAILEGAGGLLVDSDG----------
B3PHB5_CELJU          CNAGSSLKFCVIAEGGADFYPRLAPTSEWDTAAAQAVLEAAGGAVVEAMGSDAAL-----
H7C7D8_COXBU          VSMGSSLKICSLAEGEVDIYPRLGPTKEWDTAAAQCVLEQAGGKILIETG----------
CYSQ_ECOLI            TSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGK---------
CYSQ_SHIFL            TSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGK---------
CYSQ_SALTY            TSIGSSLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGK---------
CYSQ_BUCAI            KKMGSSLKFCLIAEGTAQIYPRFGDTHIWDTAAGHAIVIAAGGKVQTWTGG---------
A0A090AL43_9ENTR      TSVGSSLKFCLIAEGKAQIYPRFSPSNIWDTAAGHIIAISAGAKINSLNCS---------
Q7VQN6_BLOFL          VNIGSSFKFCLVAEGIAHFYPRFSSTKIWDTAAGHAIAKAAGALVNDWNGY---------
G8TYZ6_SULAD          REAGSALKFVWMAEGEIDIYPRLKPTMAWDTAAGQVLVESLGGHVLRWPLG---------
N9F3G7_ACIHA          REAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQAFLESIGGGLMTLEGK---------
Q11K40_CHESB          VSVGSSLKFCMIACGQADLYPRYGRTMQWDTAAGDAVLRAAGGSTLTLQGK---------
A0A3D3Z4W7_9RHOB      VRRGSSLKFCLIAAGQGDLYPRFGPTMEWDTAAGDGVLTAAGGAMLDLNGQ---------
Q92VH5_RHIME          ASVGSSLKFCLLAEGKADVYPRFGRTMEWDTAAGDAVLKAAGGSVVRLDGS---------
F8J7G7_HYPSM          VSVGSSLKFCLVAMADAHIYPRFGRTMQWDTAAGDAVLRGAGGCTLTSDGR---------
A4YN86_BRASO          LALGSAVKFGRLAEGLADIYPRLGPTSEWDVAAGHAVVVAAGGTVTSEAGV---------
A0A246K7L7_BREDI      QGMDSSLKFCLIAEGRFDAYPRTGPTSEWDTAAGQAVLEAAGGRVLAEDGR---------
A0A0D6JJU9_9RHIZ      ANIGSSLKFCLVAAGKADVYPRFGPTMEWDTAAGHAIATAAGGVVTQTDGS---------
F8J9G0_HYPSM          KPIGSSMKFCLIAAGEGDLYARFGETCEWDTAAGQAILEAAGGSVTTLDGA---------
A0A0A8K633_9RHIZ      SGAGSSVKFLEIARGNADLYPRLAPTMEWDTAAGQAVLEAAGGHVVDTSGA---------
E3I2B6_RHOVT          MRMGSSLKFGVLARGDADVYPRFAPTSEWDIAAGQALVNAAGGCVLTEAGA---------
K7ZCX0_9PROT          LLRGSALKFALLARGDADIYLRTSPTMEWDTAAGHALLLAAGGTMTKFDGS---------
G2KPZ3_MICAA          LKRSSALKFCAIAFGKADLYIRAGETSEWDSAAGHAILLAAGGNVVDQSGH---------
G7QAA3_9DELT          VHRGSALKFCALADGTAHLYPRLGPLREWDIAAGHAVLVGAGGAMTALDGS---------
B8DML4_DESVM          MQAGGPLKFCLVAEGAAHVFPCMHPTWEWDTAPGQALLEGAGGMVTLLDGR---------
I3TN37_TISMK          RQAGSSLKLCLIAEGEADLYPRLGRTMEWDIAAGHAVLLAAGGHVDTLAGP---------
A0A075MNA8_9PROT      EQVSSSFKFCLVAEGIYDMYSNFSRINTWDIAAGHAILTCAGGLIFDRKGN---------
A0A077FMD1_9RICK      MTASSSIKFCLIAEGKADIYPNFGKTMEWDTAAGHAILNAAGGSVKTHDNK---------
H8K4T0_RICAG          NAIGSSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQ---------
Q5NPK2_ZYMMO          IKAGSSLKLCLLAEGKADIYPRLSPTHEWDTAAGHAILLAAGGNVIDETGE---------
B2HS89_MYCMM          ISAGSSLKFCVVAEGIADIYPRLNPTMEWDVAAGDCIYRNSTHSGQR--TS---------
D5V7G3_ARCNC          NKYGSSIKICKLAEGLIDIYPRFNGTKEWDIAASHIIANEANCKIIDLNTK---------
G2KLW5_MICAA          VPMGSALKYARLAAGQANIYPRFVGTSEWDTAAGQAILECCGGGIIDLTTG---------
C8PI72_9PROT          RK-GSAIKFCILAEGGASAYARFSDCSLWDIAAGDFLLHQNGGAVVDLKTM---------
                         ..  *   :                ** .    .                       

B3ECK7_CHLL2          --LLYNKEDL---------QNP-GFIAQ------------------------
A0A060RDB2_9BACT      --LQYNKEKL---------ENP-PFLCKCSR---------------------
I4AFX0_BERLS          --LKYNKENL---------ENP-PFCAMNAAIFETFEKL-------------
C0QSU4_PERMH          PEIEYNKENL---------LNP-HFVAIRSDVF-------------------
C6C145_DESAD          KEFPYNKENL---------RNA-GFIVKA-----------------------
L7VL63_THES1          ---TYNRENS---------RNEKGFYAINHPANKLMF---------------
CYSQ_HAEIN            -PLTYNQRET---------LINPHFVMVGDQ----SFDWRSIFQFN------
CYSQ_AGGAC            -PLTYNKRES---------FVNPNFVMGITQ----DFPWDKIFHSN------
Q9CKQ8_PASMU          -PLSYNQRES---------FINPNFVMVANT----EFDWQKIFQFHSH----
A0A248ZWW1_MANHA      -PLTYNQRES---------LINPYFVMVADG----SIDWDKIFLFK------
Q9KNL0_VIBCH          -PLSYNERET---------LENPNFIVLGDA----DLPWNEILKIKD-----
A0A0K2DU52_PISSA      -TLKYNQKED---------LHNPYLIAMGDV----SHNWHQYF---------
A0A0H4VE81_9COXI      -ALQYNAKPS---------LTNPPFIAVGDP----TQKSEIIALLETKRGEK
A0A0P0UT70_9GAMM      -PLRYNTQDS---------LLSPPFFASGKP----KG---------------
Q2JP57_SYNJB          -PLRYNKPD----------LHNPPFVAAAEGM---AQLWQNLIP--------
B8GP85_THISH          -PLSCNTGES---------LLNPEFIVVGDER---WLERLGIVRGEV-----
C5BID9_TERTT          QPLRYNTKES---------LLNPFFIVCAQTS----PVWLNV----------
Q0A624_ALKEH          EPLRYNERES---------LINPWFIACARPD----PAWQLPHVPLAEAR--
F6CYW1_MARPP          KPFRYNQRET---------LLNGHFFVSGNEIAPHIMRWYENKDSEID----
A0A0C5VES5_9GAMM      HRFRYN-KPK---------LLNPHFYALRD------PRWLSSL-LEL-----
B3PHB5_CELJU          QPLRYNQRDE---------LLNPYFYGLADGT----FAWQSLLMEGRL----
H7C7D8_COXBU          KSLFYN-KLD---------FLNPKFLALGSRGN---PAWVTYL---------
CYSQ_ECOLI            -P--LDYTP-------RESFLNPGFRVSIY----------------------
CYSQ_SHIFL            -P--LDYTP-------RESFLNPGFRVSIY----------------------
CYSQ_SALTY            -T--LDYTP-------RESFLNPGFRVTIY----------------------
CYSQ_BUCAI            -NLNYSLSS-------RVSFINSGFYASAL----------------------
A0A090AL43_9ENTR      -Q-DIDYFP-------RQTFINPGFIVHV-----------------------
Q7VQN6_BLOFL          -P--LNYSSI------NKYFLNPGFQVSLCS---------------------
G8TYZ6_SULAD          -TSLTYYSD---------QMVNPSFVASTPGVPVKFVGN-------------
N9F3G7_ACIHA          -PFQYNQRE---------TVLNNGFIAFRDQDYKTIAYDALRLSGILD----
Q11K40_CHESB          -PLTYGPKEGE----GLEAFANPFFIAEGRAAQD------------------
A0A3D3Z4W7_9RHOB      -AFLYGKIQEECRNCGFMAMGDPRLAATIF----------------------
Q92VH5_RHIME          -RLLYGKTVQE----EDSPFANPHFIAWADMSLLHLSGAEGLQPAYALS---
F8J7G7_HYPSM          -ELEYGVPCAA----DGS-YDNPHFISYGGDAETLRTLLQNCSGVIDA----
A4YN86_BRASO          -ALRYGERSDS--------FIVPSFIAWGDPR----AVTAV-----------
A0A246K7L7_BREDI      -PLAYGK--PS--------FLNGPFSAIGA----------------------
A0A0D6JJU9_9RHIZ      -PFLYGKLEKG--------FLNPSFIVWNSEG--NPLLSRVRDGKR------
F8J9G0_HYPSM          -PLTYGHYDRA--------FRNPHFVAWARQPLWRGAVAELPSVGA------
A0A0A8K633_9RHIZ      -RFAYGKSDAG--------LKNGSFVAWGRTV----LTPR------------
E3I2B6_RHOVT          -PLAYGKVDRH--------FANPSFIAWRRRD---EAEAMLRAE--------
K7ZCX0_9PROT          -QLDYGKPK----------FLNDHFIARGR----------------------
G2KPZ3_MICAA          -PLTYGHADRG--------FRNPDFAAASDDVLPMLDGLFFTRAA-------
G7QAA3_9DELT          -PLRYNTAE----------LVSGPFLARSFSDGVVPSNLLFMEAP-------
B8DML4_DESVM          -PLAYNKPD----------LRNECILA--VGPAVCAPNTCAADT--------
I3TN37_TISMK          -PLTYGKPG----------LDNPHFLARGPWTTGEAADV-------------
A0A075MNA8_9PROT      -ILTYNKNS----------LRCPNFVAFSSHIGEDYIRQKLAELL-------
A0A077FMD1_9RICK      -PLMYGKEK----------FVNDLFIAYGKNI--------------------
H8K4T0_RICAG          -EITYGKES----------FANPNFFACSKYWLEREARLHRY----------
Q5NPK2_ZYMMO          -NLTYGKPG----------YRNPGFIAYGSEQPPLPVEK-------------
B2HS89_MYCMM          -SLTYNKPTLK----------NDSFVIGLK----------------------
D5V7G3_ARCNC          EELVYNKRNIK----------NNFFIATRNNLILY-----------------
G2KLW5_MICAA          QRMLYGKKNWR----------NNNFIAFGAESDPGDFMGEIA----------
C8PI72_9PROT          KAPLYNGKSLI----------NNHYLAVGASAMKNLSEMLEFAKNF------