CLUSTAL format seed alignment for MF_02102

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PTC_STRMU       --MMKKTDYITTEDFSKEELLKLVDLSLKIKACIKNGYYPPLLEHKSLGMIFQQTSTRTR
PTC_STRRT       --MMKKTDYITTEDFSKEELLKLVDLSLKIKACIKNGYYPPLLEHKSLGMIFQQTSTRTR
PTC_ENTFA       ----MKRDYVTTETYTKEEMHYLVDLSLKIKEAIKNGYYPQLLKNKSLGMIFQQSSTRTR
PTC_LACLA       MVTTNKRDFITTEDYTKEEILDIVTLGLKIKAAIKNGYYPPLLKNKSLGMIFQQTSTRTR
PTC_LISMF       --MNKKRDFIDTKDFSKEEILFMIEIGRKMKESIKNGHYPQLLKHKTLGMIFEQSSTRTR
PTC_LISMO       --MNKKRDFIDTKDFSKEEILFMIEIGRKMKESIKNGHYPQLLKHKTLGMIFEQSSTRTR
PTC_LACBA       ---MTKRDFIDTNTYTKEEIQYMIDLGIKIKESIKNGYYPPLLKNKTLGMIFEQSSTRTR
PTC_LACBR       -MNMTKRDFIDTNTYTKEEIQYMIDLGIKIKESIKNGYYPPLLKNKTLGMIFEQSSTRTR
PTC_PEDPA       --MNTKRDFIDTNTYTQEEITYMINLGLKIKESIKNGYYPPLLKNKTLGMIFEQSSTRTR
PTC_LACSS       ----MKRDFIDTKDYTQAEIQYLIDLGLQIKKDIKAGDYPQLLSNRTLGMLFEESSTRTR
PTC_MYCCT       --MNKVRHFIDTQDLSKKEIFEIFRLMKMLKEARYCGAVPELLKNKTLAMIFEEPSTRTR
PTC_MYCMS       --MNKVRHFIDTQDLSKKEIFEIFRLMKMLKEARYCGAVPELLKNKTLAMIFEEPSTRTR
                       .:: *:  :: *:  :. :   :*     *  * **.:::*.*:*::.*****

PTC_STRMU       VSFETAMSQLGGHAQYLAPGQIQLGGHET--IEDTSTVLSRLDDILMARVERHQSVVDLA
PTC_STRRT       VSFETAMSQLGGHAQYLAPGQIQLGGHET--IEDTSTVLSRLDDILMARVERHQSVVDLA
PTC_ENTFA       VSFETAMEQLGGHGEYLAPGQIQLGGHET--IEDTSRVLSRLVDILMARVERHHSIVDLA
PTC_LACLA       VSFETAMTQLGGHAEYLAPGQIQLGGHET--IEDTSTVLSRLLDIIMARVDRHESVNNLA
PTC_LISMF       VSFETAMTQLGGHAQYLAPGQIQLGGHES--VGDTAKVLSRLVDILMARVERHQTVVELA
PTC_LISMO       VSFETAMTQLGGHAQYLAPGQIQLGGHES--VGDTAKVLSRLVDILMARVERHQTVVELA
PTC_LACBA       TSAEAAMTELGGHAQYLAPGQIQLGGHET--IEDTSQVLGRILDIIGARVERHHTVAEVG
PTC_LACBR       TSAEAAMTELGGHAQYLAPGQIQLGGHET--IEDTSQVLGRILDIIGARVERHHTVAEVG
PTC_PEDPA       TSAEAAMTELGGHAQYLAPGQIQLGGHET--IEDTSQVLGRILDIIGARVDRHKTVAEVG
PTC_LACSS       VSFETAMTQLGGHAQYLAPGQIHLGSAESESLGDTAIVLSRLVDILMARVATHDTIETIA
PTC_MYCCT       VSFEAAMTLLGGHAQYLKPGELHLGVRES--LYDTTKVLSHMCDGIMCRALKHETVLNLA
PTC_MYCMS       VSFEAAMTLLGGHAQYLKPGELHLGVRES--LYDTTKVLSHMCDGIMCRALKNETVLNLA
                .* *:**  ****.:** **:::**  *:  : **: **.:: * : .*.  :.::  :.

PTC_STRMU       RCASIPVINGMSDYNHPTQELGDLCTMIEHLPAGK-------KLEDCKVVFVGDATQVCF
PTC_STRRT       RCASIPVINGMSDYNHPTQELGDLCTMIEHLPAGK-------KLEDCKVVFVGDATQVCF
PTC_ENTFA       NCATIPVINGMSDYNHPTQELGDLCTMVEHLPEGK-------KLEDCKVVFVGDATQVCF
PTC_LACLA       KHTTIPVLNGMSDYNHPTQEVGDLTTMIEHLPAGK-------KLEDCKVVFVGDATQVCF
PTC_LISMF       NTAAIPVINGMSDYNHPTQELGDAITMFEHLPKGK-------KIEDCKIVFVGDATQVCA
PTC_LISMO       NTAAIPVINGMSDYNHPTQELGDAITMFEHLPKGK-------KIEDCKIVFVGDATQVCA
PTC_LACBA       KFAKVPVVNFMSDYNHPTQELGDIITMTEHLPKGK-------KLSDCKIVFVGDATQVCV
PTC_LACBR       KFAKVPVVNFMSDYNHPTQELGDIITMTEHLPKGK-------KLSDCKIVFVGDATQVCV
PTC_PEDPA       KYAKVPVVNFMSDYNHPTQELGDITTMVEHLPAGK-------KLSDCKIVFVGDATQVCV
PTC_LACSS       NAATVPVLNGMTDYNHPTQEIGDIITMAEHLPAGK-------KLSDCKVVFVGDATQVCV
PTC_MYCCT       KYADVPVLNGLTDYNHPTQAICDVFTMLEYMPATKNLEYEDIKFEDIKVVFIGDRTNVCS
PTC_MYCMS       KYADVPVLNGLTDYNHPTQAICDVFTMLEYMPATKNLEYEDIKFEDIKVVFIGDRTNVCS
                . : :**:* ::******* : *  ** *::*  *       *:.* *:**:** *:** 

PTC_STRMU       SLALITTKMGMEFVHFGPKGFQLNDMHKEKLDKICERS-GGKYTVTDNED-AIEGADFLY
PTC_STRRT       SLALITTKMGMEFVHFGPKGFQLNDMHKEELDKICELS-GGKYTVTDNED-AIEGANFLY
PTC_ENTFA       SLGLITTKMGMNFVHFGPEGFQLNEEHQAKLAKNCEVS-GGSFLVTDDAS-SVEGADFLY
PTC_LACLA       SLGLIATKMGMHFVHFGPKGYQLNEEHQAKLAANCEVS-GGTYEVTDDEE-SIVGADFLY
PTC_LISMF       STMFMATKLGMDFVQFGPKGFQLREEHLKIAEENCKVS-GGSYLITEDVDIALKDADFIY
PTC_LISMO       STMFMATKLGMDFVQFGPKGFQLREEHLKVAEENCEVS-GGSYLITEDVDIALKDADFIY
PTC_LACBA       STMFMATKMGMDFVQFGPKGFQIKPETLKIGQQNAKVS-GGSVTITEDADEAFKDADFIY
PTC_LACBR       STMFMATKMGMDFVQFGPKGFQIKPETLKIGQQNAKVS-GGSVTITEDADEAFKDADFIY
PTC_PEDPA       STMFMTTKMGMDFVQFGPKGFQMKDDVVEIGKENAKKY-GGSVTITEDADEAMKDADFVY
PTC_LACSS       SLMFVATKMGMQFVQYGPKGYQIKPETLAIGQKNAEVS-GGSVLITEDTDQAMRDADFVY
PTC_MYCCT       STMHITTKLGMNFVHISPKRYQSPQEWVDIANENIKQANSGSVLVTDDLE-QVKDADIVY
PTC_MYCMS       STMHITTKLGMNFVHISPKRYQSPQEWIDIANENIKQANSGSVLVTDDLE-QVRGADIVY
                *   ::**:**.**: .*: :*             :   .*.  :*:: .  . .*:::*

PTC_STRMU       TDVWYGLYEAELSEEERMQIFFPKYQVDSQMMAKAGADCKFMHCLPATRGEEITDEVMDG
PTC_STRRT       TDVWYGLYEAELSEEERMQIFFPKYQVDSQMMAKAGADCKFMHCLPATRGEEITDEVMDG
PTC_ENTFA       TDVWYGLYEAELSEEERMKVFYPKYQVNQEMMDRAGANCKFMHCLPATRGEEVTDEVIDG
PTC_LACLA       TDVWYGLYDAELSEEERLAIFFPKYQVTPEMMAKAGAHTKFMHCLPASRGEEVVDAVIDG
PTC_LISMF       TDVWYGLYEAELSEEERMKTFYPKYQVNKELISKAAPHVKFMHCLPATRGEEVTDEVLDA
PTC_LISMO       TDVWYGLYEAELSEEERMKTFYPKYQVNKELISKAAPHVKFMHCLPATRGEEVTDEVLDA
PTC_LACBA       TDVWYGLYEAELSEEDRMKIFYPKYQVNAELVAKASDHVKFMHCLPATRGEEVTDEVIDS
PTC_LACBR       TDVWYGLYEAELSEEDRMKIFYPKYQVNAELVAKASDHVKFMHCLPATRGEEVTDEVIDS
PTC_PEDPA       TDVWYGLYDDEMPKEERMNIFYPKYQVNAELMAKASDHVKFMHCLPATRGEEVTDEVLDS
PTC_LACSS       TDVWYGLYESPLSYDERMAIFYPKYQVNDELMAKAAKHAKFMHCLPANRGEEVTDSVLDS
PTC_MYCCT       TDLWWWVDQEDE-AEERVKAFKPTYQVTPELMKKAGQQALFMHCLPASRNVEVYDEVIDS
PTC_MYCMS       TDLWWWVDQEDE-AEERVKAFKPTYQVTPELMEKAGKQALFMHCLPASRNVEVYDEVIDS
                **:*: : :     ::*:  * *.***  ::: :*. .  *******.*. *: * *:*.

PTC_STRMU       PHSICFDEAENRLTSIRGLLVYLLRDYREKNPYDLVKQEKAKEELETFLKPE--------
PTC_STRRT       PHSICFDEAENRLTSIRGLLVYLLRDYREKNPYDLVKQEKAKEELETFLKPE--------
PTC_ENTFA       KNSICFDEAENRLTSIRGLLVYLMNDYEAKNPYDLIKQAEAKKELEVFLDTQSI------
PTC_LACLA       PNSICFDEAENRLTSIRALLVWLMSDYAEKNPYDLKAQAKAKAELEAYLAK---------
PTC_LISMF       PYSVVIDEAENRLTAMRALLVYFMNPYVR--EAGFAVAEKYDAELELLLRNGAGL-----
PTC_LISMO       PYSVVIDEAENRLTAMRALLVYFMNPYVK--EAGFAVAEKYDAELELLLRNGAGL-----
PTC_LACBA       DYSIVWDEAENRKTAMRAIFVYLLNPELRKAQASQAVADKYDAEFSLMLRNAVDDQRNAD
PTC_LACBR       DYSIVWDEAENRKTAMRAIFVYLLNPELRKAQASQAVADKYDAEFSLMLRNAVDDQRNAD
PTC_PEDPA       DYSIVWDEAENRKTAMRAIFVYLLNPSLN--YASKAVAEKYDAEFELMLKNAVDSRNN--
PTC_LACSS       DASVAWDEAENRLTAMRALLVYLMAPIID--YSDDTLNNLKDPALKDLLNNRIDSTK---
PTC_MYCCT       DQSIAFEQAENRLTAQMGLLVYYLYPQID--KSSNAVKDYYRGKVEAFMEHQDRSWKQRY
PTC_MYCMS       DQSIAFEQAENRLTAQMGLLVYYLYPQID--KSSNAVKDYYRGKVEAFMEHQDRSWKQRY
                  *:  ::**** *:  .::*: :         .          ..  :           

PTC_STRMU       -------------
PTC_STRRT       -------------
PTC_ENTFA       -------------
PTC_LACLA       -------------
PTC_LISMF       -------------
PTC_LISMO       -------------
PTC_LACBA       -------------
PTC_LACBR       -------------
PTC_PEDPA       -------------
PTC_LACSS       -------------
PTC_MYCCT       TYNNDYAETKNKK
PTC_MYCMS       TYNNDYAETKNKK