CLUSTAL format seed alignment for MF_02104

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LUTC_ALKHC       -----MIQRRETFLNNVAEKLGR-GRRTAGVKRPDYTVKPQFEVMKEHSSDQLVNVLSEQ
LUTC_BACSK       -----MIKNRDSFLDHVANQLGR-PRQTEGVLRPNYRVSPQFEVLKDASKDELVTVLKEQ
LUTC1_BACMK      ---MMAIQNREEFLLQLSEKLGR--KRPEAVEKPKWSFSPQWNVFDGLAQDELVLQLMEH
LUTC_OCEIH       ----MAIHNRDKFLSNLAANLGR-PRKTEGVERPEYSVQPQYEVLKGASQDELIDVLEKH
LUTC_BACSU       -MTKGTIQNQESFLNRIASSLGR-ERRTGGVAVPEWAHQPQYKTLEGYSADDLVTVLKNH
LUTC_BACVZ       MMMKGTVTHQESFLNRIAESLGR-ERRKSGVSLPEWKYQPQYQTHAGCTEDDLVTMLKDH
LUTC_BACLD       -MTNGTIHNKDGFLNRIAERLGR-NRRSAGVTVPDYIHQPQHRVYQGYTQDELVGVLKDH
LUTC_GEOKA       -MTRGAIHNRDAFLEHIAHRLGR-APRLSGVSRPQWSNQPQWKVLAGYSQDDLLNVLQKQ
LUTC_GEOTN       -MTRGTIQNRDAFLQNIAKRLGR-SPRLSGVSQPQWDYAPQWTVFAGYSQDDLLSALREQ
LUTC_GEOSW       MMQTGTIHNRDKFLQTVANRLGR-HQRTSGVSRPHWRHQPQWTVFQGYSQDELLEALKAQ
LUTC_ANOFW       ---------MEAFLQRIASRLGR-DVRTS-VERPQWKHAPQQTVFQGYSQNELLDVLKQQ
LUTC_BACC0       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACC3       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACAN       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACAH       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACAC       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACAA       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACCZ       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACHK       --MTGLIQNRDSFLDNIAKELGR-TRKTDGVERPVWKNNVNKETLKDYSQEELLEVFKNQ
LUTC_BACC7       --MTGLIQNRESFLENIAKELGR-ARKTDGVKRPVWKNNVNKETLKNYSQEELLEVFKNQ
LUTC_BACCQ       --MTGLIQNRESFLENIAKELGR-ARKTDGVKRPVWKNNVNKETLKNYSQEELLEVFKNQ
LUTC_BACC1       --MTGLIQNRESFLDNIAKELGR-ARKTDGVKRPVWKNNVNKETLKNYSQEELLEVFKNQ
LUTC2_BACMK      --MTGLIQNRESFLDNIAKELGR-ARKTEGVERPAWKSNVNVETLKDYSQEELLEVFKKQ
LUTC_BACC4       --MTGLIQNRDAFLDNIAKELGR-ARKTEGVERPVWKSNVNIETLKDYSQEELLEVFKKQ
LUTC_BACCR       --MTGLIQNRDAFLDNIAKELGR-ARKTEGVERPVWKSNVNIETLKDYSQEELLEVFKKQ
LUTC_BACC2       --MTGLIQNRDAFLDNIAKELGR-ARKTEGVERPVWKSNVNIETLKDYSQEELLEVFKNQ
LUTC_BACCN       --MAGTIQNRDSFLDNIAKELGR-ARKTEGVQRPVWKNNVNLETLKDCSEEELLEVFKKQ
LUTC_BACP2       --MKGTISHRESFLTHIRQQLGKDSSSSASIQRPAWKHQVQWETNGLLSKEELVEQLKMQ
LUTC_MACCJ       -MERGTIHNKGSFLSNISKNLQR--EMPQHVERPEWQYRPQDKTLTGLTQDELLEVLRQQ
LUTC_EXISA       -MNPGTITNREDFLQRIAKQLGR--EVKLTPPKREYTHRPQDEVLKGASEEELLETFRMV
                             **  :   * :            :    :  .    : ::*:  :   

LUTC_ALKHC       CTKIHTDVKQTKVDRLEQAIDNVLEEYSARNVITWNDPRFDQFGLTSFLQR------EQV
LUTC_BACSK       CVAIHTDFKQVESGQLETALDETIDMYGAKSVIAWDDRRFHEFGLGSFLTR------PSV
LUTC1_BACMK      CEVIHTEVKRTTKENLVETLGSLIKEWNIKSAMYSNDERFNEYGLTSCFNN---EGTTHF
LUTC_OCEIH       CEVIHTDFVRTSKQELPHVVRQTIERYEAKSIIASNDKRNAEYGMDQAYNQF--AEELDM
LUTC_BACSU       CVKIHTELIETDSTGLYDALREQVSRFSGGPVIIPKDPRFEEYGLKSLLTKDWPSEGTPV
LUTC_BACVZ       CVNIHTELIETDAAGLYDALRTQVNRFEGGPVIIPKDSRFETYGLQTLMTEEWPDEGIPV
LUTC_BACLD       CRKIHTELIETDVIGLHDALYEQAARFGGGPVMIPKDDRFKEYGLSGLLTDKWPNEGTKV
LUTC_GEOKA       CGLIHTDYIETTSAELAGALRRQVAAYGGGPVIVPDDPRFAEYGLSALLRDEWPAEQTTV
LUTC_GEOTN       CKLIHTDYIETTSSELAGALKQQVAAYGGGPVIVPDDPRFAEYGLSALLHDEWPAEQTAV
LUTC_GEOSW       CPRIHTQCVETTAVELKETLKEVVAKHGGGPIVTWDDPRFDEYGLTRLLRNEWPNENVDV
LUTC_ANOFW       CTRIHTTFVETNSAELRDTLQQVIAAHGGGPIVVANDERYEQFGLSSFLQRE------DV
LUTC_BACC0       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACC3       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACAN       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACAH       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACAC       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACAA       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACCZ       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACHK       CTNIHTTVVETTNDRLREDIQKVIVEYGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACC7       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACCQ       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACC1       CTNIHTTVVETTNDRLREDIQKVIVENGGGPIMLSADERFDSYGLTSLFKEELPKQNVEV
LUTC2_BACMK      CTNIHTTVVETTNDRLREDIQKVIVENGGGPIILSADERFDSYGLTSLFKEELPKQNVEV
LUTC_BACC4       CTNIHTTVVETTNDCLGEDLQKVIMENGGGPILLSADDRFDAYGLTSLFKEELPKRDVEV
LUTC_BACCR       CTNIHTTVVETTNDRLGEDLQKVIMENGGGPILLSADDRFDAYGLTSLFKEELPKRDVEV
LUTC_BACC2       CTNIHTTVVETTNERLREDLQQVIMENGGGPILLSADERFDAYGLTSLFKEELPKRDVEV
LUTC_BACCN       CENIHTTVIETTKDELKDAIQQMIAENGGGPILVSDDERFEKYGLTSFFREELPSQNVEV
LUTC_BACP2       CQRIHTRVVETTPEEAPSALRSLMTEYGEGSVMTSGDHRFEQYGFYPMF-DSLQHEGFAV
LUTC_MACCJ       CNFIHTDLVETTTDNINETLSQVIEKYGNGEVIAWNDKRFADFGIDLEAHD--------A
LUTC_EXISA       ATRIHTDLVECESAKLDDTLRLLIERYHGARILAENDERISAWAPTTSE---------TF
                 .  ***   .         :            :   * *   :.                

LUTC_ALKHC       EVWDHTE-GERLVEKAEQADIGITFADYTLAESGTVVLLSGNGKGRSVSLLPTYYIAIIP
LUTC_BACSK       SLWDNRD-SKRSIEQAEIADVGITFSDITLAESGTVTLFSSNGKGRSVSLLPRYYIAIIP
LUTC1_BACMK      RAWGLGD-KEEDIKFAKAADLGITFSDMTLAESGTVVLFNDGLKGRHVSLLPESYIAIVP
LUTC_OCEIH       HIWDASI-GKENQVIAEKADVGISFSDITLAESGTVTLKNDKDNGRSISLMPKSYIAIIP
LUTC_BACSU       WEWDADK-GEENIKKAEQANVGITFSEITLAESGTVVLFSSKDIGRSVSLLPTTYIAIVP
LUTC_BACVZ       WEWDAEQ-GAKNIEKAEQANVGITFSEITLAESATVVLYASEHAGRSVSLLPTTYIAIIP
LUTC_BACLD       WEWDAAA-GDENIQRAEQANIGVTFSEITLAESGTVVLFSSKDKGRSVSLLPTTYIAIVP
LUTC_GEOKA       HIWNPAL-GRQNIDAAEQANVGIAFSDITLAESGTVVLFSRNEQGRAIHFLPKTYIAIVP
LUTC_GEOTN       HVWNSSL-GRQNIDAAEQANVGIAFSEITLAESGTVVLFSRNEQGRTIHFLPKTYIAIVP
LUTC_GEOSW       HIWDASA-GRKNIDYAEQANVGITFSDITLAESGTVVLFSGNGKGRTVSFLPKTYIAIIA
LUTC_ANOFW       YVWDATR-GRDNIEAAERANIGMTWSDITLAESGTVVLLNNRDQGRTISFLPTTYVALIP
LUTC_BACC0       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACC3       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACAN       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACAH       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACAC       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACAA       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACCZ       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACHK       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACC7       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYLAIIP
LUTC_BACCQ       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYLAIIP
LUTC_BACC1       NVWDPEK-KEENMRIAERANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC2_BACMK      NVWDPEK-KEENMRIAEKANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACC4       NVWDPER-KDENMRLAEKANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACCR       NVWDPER-KDENMRLAEKANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIP
LUTC_BACC2       NVWDPER-KDGNMRLAEKANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYLAIIP
LUTC_BACCN       NIWDPEE-KDENIRFAEKANIGIAFSDYTLAESGTIVVQSRKGQGRSLHFLPTVYFSIIP
LUTC_BACP2       TSWNAEASREENIRLAEQAAYSVVFSDYTLAESGTIVLSSHQGQGRALHFLPMMYIVCIE
LUTC_MACCJ       FIWDEAK-GAENLQVAERANVGITFSDVTLAESGTVVLYADKGKGRSVSLLPATYIAIVP
LUTC_EXISA       DWWDSSQ-PEASRELAIRADIGITIADAAFAESATIVQYAMPGRSRTISLLPQDHIAIIP
                   *.           *  *  .:  :: ::***.*:.       .* : ::*  :.  : 

LUTC_ALKHC       KSTLVPRMSQVTRELHLKAASGERLPSCINFISGPSNSADIEMNLVVGVHGPIRACYIVV
LUTC_BACSK       KSTLVARMTQAARHIRQLTGEG-RLPSCINFISGPSNSADIEMSLVVGVHGPLKACYIVV
LUTC1_BACMK      KSTIVPRLTQATKLIHNQSKAGENLPACVNFVSGPSNSADIEMNLVVGVHGPIRTAYIIV
LUTC_OCEIH       KETLVPRMTQAAKQIHDDHMNGIQTPSSVCFVTGPSNSADIEMNLIVGVHGPVNVTYIVV
LUTC_BACSU       KSSIVPRMTQASDIIRQNIANGVTVPSCINYITGPSNSADIEMDLVVGVHGPVKAAYILV
LUTC_BACVZ       KSSIVPRMTQASDILKQQIRDGVTVPSCINYITGPSNSADIEMDLVVGVHGPVKAAYILV
LUTC_BACLD       KSTIVPRMTQASAIIKQKIADGDVIPSCINYVTGPSNSADIEMDLVVGVHGPVKAAYIVV
LUTC_GEOKA       KSTVVPRMTQAAAVIHEQIEKGGLVPSCINFITGPSNSADIEMNLVVGVHGPMKAAYIVV
LUTC_GEOTN       KSSVVPRMTQAAAYIHEQIEKGAVVPSCINFITGPSNSADIEMNLVVGVHGPMKAAYIVV
LUTC_GEOSW       KSTIVPRMTQAAAYIHEQIEKGHLIPSCINFITGPSNSADIEMNLVVGVHGPMKATYIVV
LUTC_ANOFW       KSTIVPRMTQAAHIIREKH-----VPSCINFITGPSNSADIEMNLVVGVHGPVKATYIVI
LUTC_BACC0       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACC3       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACAN       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACAH       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACAC       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACAA       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACCZ       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACHK       RETLVPRITQAVQDMNTRVENGEEVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACC7       RETLVPRITQAVEDMNKRVENGETVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACCQ       RETLVPRITQAVEDMNKRVENGETVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACC1       RETLVPRITQAVEDMNKRVENGETVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC2_BACMK      RETLVPRITQAVQDMNSRVEKGEAVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACC4       RETLVPRITQAVQDMNSRVENGETAASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACCR       RETLVPRITQAVQDMNSHVENGETAASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV
LUTC_BACC2       RETLVPRITQAVQDMNSRVEDGETAASCINFITGPSNSADIEMNLVVGVHGPLKAIYFIV
LUTC_BACCN       RETIVPRITQAVRDMNARVEKGEAVASCINFITGPSNSADIEMNLVVGVHGPLKAYYFVV
LUTC_BACP2       KSTVVPRMIQAVSTLNRLVEEGEQAKGAIHFISGPSNSADIEMNLVVGVHGPVRAVYLLI
LUTC_MACCJ       KSTIVPRFTQAAQQMNAMMEDQENFPTCINLITGPSNSADIEMKLVVGVHGPIKATYIVV
LUTC_EXISA       KSVLVPRMTQTAQQLATLDRDGLHSPNGVNFISGPSNSADIEMNLIVGVHGPVRVSYVLV
                 :. :*.*: *.   :             :  ::**********.*:******:.. *.::

LUTC_ALKHC       EDR
LUTC_BACSK       DDK
LUTC1_BACMK      DDQ
LUTC_OCEIH       D--
LUTC_BACSU       SDR
LUTC_BACVZ       NDR
LUTC_BACLD       EDR
LUTC_GEOKA       TDR
LUTC_GEOTN       TDR
LUTC_GEOSW       TDR
LUTC_ANOFW       TDR
LUTC_BACC0       ---
LUTC_BACC3       ---
LUTC_BACAN       ---
LUTC_BACAH       ---
LUTC_BACAC       ---
LUTC_BACAA       ---
LUTC_BACCZ       ---
LUTC_BACHK       ---
LUTC_BACC7       ---
LUTC_BACCQ       ---
LUTC_BACC1       ---
LUTC2_BACMK      ---
LUTC_BACC4       ---
LUTC_BACCR       ---
LUTC_BACC2       ---
LUTC_BACCN       ---
LUTC_BACP2       DDE
LUTC_MACCJ       DDK
LUTC_EXISA       HDL