CLUSTAL format seed alignment for MF_02113_A

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSB_HALVD       MRTPTHDEFSGRLDSLNGDRSNVFGPELGEFSNADRRADEL-GDKETKTGTTTVGIKTEE
PSB_HALWD       MRTPMNNDISGRPDSLNGDRSDVFSPELGEFPNADDRANDI-GDMETKTGTTTVGLKTQD
PSB_HALLT       MRTPTGDLSDGPAEELGRDQP-VFGPEIGEFEHSERRAAQADGEGEMKTGTTTVGIKTAD
PSB2_HALMA      ------------MHDPENRLTDAYEPEVGNLP-NEDSGRDE--ENVVKTGTTTVGLSTED
PSB_HALUD       ------MNPDLNMNPHDSGRTDPYAPELGEIA-TDEG--DG--ENVTKTGTTTVGLATEE
PSB1_HALMA      MRDMTPGPDLSGPQAADEFQSDPYAPEVGELP--EQSAQDS--EKVNKTGTTTIGISTSD
PSB_NATPD       MRQ----PDSSLPRTGQDHTLSPYEPELGEVPSNDLSMADL--DNVNKTGTTTIGISTAE
PSB1_HALTV      MRAPQHNSDFSRTVDQLADDPNPYEPEIGSMPQNDLTRADL--DNVNKTGTTTIGISTAD
PSB_NATMM       MRAPQHNSDFSRTVNQLADDPNPYEPEVGSMPKNEFSRADL--DNVNKTGTTTIGITTED
PSB2_HALTV      ------MNNWSQGSTPQGSDPSPYAPELGSLPDGSQSDDHG--DTVNKTGTTTIGITTDE
PSB_HALMD       ------MSKFPDLPGMKNLDANPYEPELASFDDMDADAGDG--DAVAKTGTTTIGITTDG
PSB_HALS3       MFNPNNGSEFARNRARLDDTPNPYEPEVGSLPEGDRSQAGS--DTVNKTGTTIVGLTTQD
PSB_HALSA       MFNPNNGSEFARNRARLDDTPNPYEPEVGSLPEGDRSQAGS--DTVNKTGTTIVGLTTQD
PSB_METRM       -----------------------------------------MSNKNTFEGTTTVGITCKD
PSB_METS3       -----------------------------------------MDDK-ILEGTTTVGITCKD
PSB_METTH       -----------------------------------------MNDKNTLKGTTTVGITCKD
PSB_METST       -----------------------------------------MNQTENMEGTTTVGFVCTD
PSB_THEAC       ------------------------------------------MNQTLETGTTTVGITLKD
PSB_THEVO       ------------------------------------------MNQTLETGTTTVGITLTD
PSB_PICTO       -------------------------------------------MEVLKTGTTTVGITAGD
PSB_ACIB4       -------------------------------------------MENAKTGTTTVGIVTKD
PSB_ARCFU       ---------------------------------------MSMIEEKIYKGTTTVGLVCKD
PSB_FERPA       -----------------------------------------MIHDKVFKGTTTVGLVCKD
PSB_ARCPA       --------------------------------------MLGEIQDKVYKGTTTVGLVCKD
PSB_METAC       -----------------------------------------MDDDKYLKGTTTVGVVCTD
PSB_METMA       -----------------------------------------MDNDKYLKGTTTVGVVCTD
PSB_METTE       -----------------------------------------MDNDKYLKGTTTVGVVCTD
PSB_METBF       -----------------------------------------MDNDKYLKGTTTVGVVCTD
PSB_METBU       -----------------------------------------MDNDKHLKGTTTVGIVCTD
PSB_METMS       -----------------------------------------MDNDKHLKGTTTVGIVCSD
PSB_METTP       -------------------------------------------MVEAFKGTTTVGIVCDG
PSB_METPS       ------------------------------------------MDDKQYKGTTTVGIICNN
PSB_METAR       -----------------------------------------MMEDKQYKGTTTIGIICDQ
PSB_METB6       ---------------------------------------MPEQYQESMTGTTTVGLVFAG
PSB_METPE       ---------------------------------------MSEA--ETLKGTTTIGIVFKD
PSB_METMJ       ---------------------------------------MLDTSQEIMKGTTTVGLIFDG
PSB_METLZ       ---------------------------------------MSQEHQDVKTGTTTVGIVFDG
PSB_METHJ       ---------------------------------------MVEQS-DTMKGTTTVGIVFET
PSB_METJA       --------------------------------------------MDVMKGTTTVGLICDD
PSB_METSF       --------------------------------------------MDVMKGTTTVGLICDD
PSB_METFA       --------------------------------------------MDVMKGTTTVGLICDD
PSB_METVM       --------------------------------------------MDTMKGTTTVGLICDD
PSB_METM6       ------------------------------------MISNSEYHKEYMKGTTTVGLLCKD
PSB_METM7       ------------------------------------MISNSEYHKEYMKGTTTVGLLCKD
PSB_METM5       ------------------------------------MISNSEYHKEYMKGTTTVGLLCKD
PSB_METMP       ------------------------------------MISNSEYHKEYMKGTTTVGLLCND
PSB_METVS       ------------------------------------MISGSEYHKEYMKGTTTVGLICED
PSB_META3       ------------------------------------MIANNDQYKEYMKGTTTVGIVCND
PSB2_HYPBU      -----------------------------------MLHHPGTGQLRALKGTTTVGIVFRD
PSB2_IGNH4      -------------------------------------MSVDEKVARALKGTTTVGIRSEK
PSB2_AERPE      -------------------------MAEWIAGGLEGPAGRGLDERVVRSGTTTVGLIASD
PSB2_DESA1      -------------------------------------------MREAVSKTTTVGLVTGD
PSB2_STAMF      -----------------------------------------MSGKKIVSKTTTVGIVVGD
PSB2_PYRIL      -------------------------------------------------MTTTVGIAVKE
PSB1_PYRNV      -------------------------------------------------MTTTVGIAVRE
PSB1_PYRAE      -------------------------------------------------MTTTVGIAVKD
PSB1_PYRCJ      -------------------------------------------------MTTTVGIVAKD
PSB1_PYRAR      -------------------------------------------------MTTTVGIVVKD
PSB1_CALMQ      ------------------------------------MSRIHNDPKVLLTGTTTVGVVTKE
PSB1_THEPD      --------------------------------------MSADLRDKVLKGTTTVGLVGKD
PSB2_CENSY      --------------------------------------MSNNVEEKILHGTTTVGIKATD
PSB2_NITMS      --------------------------------------MSNNVEEKILHGTTTVGIKAKD
PSB_METKA       ----------------------------------------MKELDQLTKGTTTVGILADK
PSB2_PYRAB      ----------------------------------------MLQLTEKFKGTTTVGIVCSD
PSB2_PYRHO      ----------------------------------------MLQLTEKFKGTTTVGIVCKD
PSB2_PYRFU      ----------------------------------------MLHLKEKLKGTTTVGLVCKE
PSB1_THEKO      -------------------------------------------MTEKLKGTTTVGIVCKD
PSB1_THEON      -------------------------------------------MAEKLKGTTTVGIVCKD
PSB1_THESM      -----------------------------------------MWALDKIKGTTTVGIVCKD
PSB1_THEGJ      ----------------------------------------MNGSPSAMKGTTTVGVVCRD
PSB2_SACS2      -----------------------------------MGNELQLENKILK-GTTTVGIRVND
PSB2_SACS9      --------------------------------MVIMGNELQLENKILK-GTTTVGIRVND
PSB1_SULIL      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB1_SULIY      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB1_SULIM      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB1_SULIA      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB1_SULID      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB1_SULIK      --------------------------------MVIMGNELQLENKILK-GTTTVGIKVND
PSB2_SULIN      --------------------------------MVIMGNKLQLENKILK-GTTTVGIKVND
PSB2_SULAC      ---------------------------------------MNLQNKILK-GTTTVGIKVKD
PSB2_SULTO      -------------------------------------METNNKLKILKTGTTTVGIKVKD
PSB1_METS5      ----------------------------MEGFGEFESRPSKDKIKILK-GTTTVGLVVKD
PSB1_PYRAB      --------------------------------------------MNRKTGTTTVGIRVKD
PSB1_PYRHO      --------------------------------------------MNRKTGTTTVGIKVKD
PSB1_PYRFU      --------------------------------------------MEKKTGTTTVGIKVKD
PSB2_THEKO      --------------------------------------------MEKKTGTTTVGIRTKE
PSB2_THEGJ      -------------------------------------------MEEKKTGTTTVGIKVKE
PSB2_THESM      --------------------------------------------MEKKTGTTTVGIKLKD
PSB2_THEON      -------------------------------------------METKKTGTTTVGIKAKD
PSB_NANEQ       -------------------------------------------------MTTIIGIKARD
PSB1_KORCO      ---------------------------------------------MLMKGTTTVGVKFKN
PSB1_AERPE      ------------------------------------------MS---FAGATALGIRVED
PSB1_IGNH4      ------------------------------------------MS---GPGATAVGIKVKD
PSB1_HYPBU      ------------------------------------------MSYEYGTGATAVGIRGAG
PSB2_PYRAE      -----------------------------------------MGEEVQ-IGATAVGIKAKD
PSB2_PYRAR      -----------------------------------------MGEEVQ-IGATAVGIKAKD
PSB1_PYRIL      -----------------------------------------MGEEVQ-IGATAVGIKAKD
PSB2_PYRNV      -----------------------------------------MGEEFQ-VGATAVGIRAKD
PSB2_PYRCJ      -----------------------------------------MGEEVS-IGATAVGIKTKE
PSB2_CALMQ      -----------------------------------------MSDQLELMTGTTVGIKAKD
PSB1_SULAC      ---------------------------------------------MEELPATAIGIKTKD
PSB1_SULTO      ---------------------------------------------MEELPATALGIKLND
PSB2_SULIA      ---------------------------------------------MEELPATAIGLKVND
PSB2_SULIL      ---------------------------------------------MEELPATAIGLKVND
PSB2_SULID      ---------------------------------------------MEELPATAIGLKVND
PSB2_SULIM      ---------------------------------------------MEELPATAIGLKVND
PSB1_SULIN      ---------------------------------------------MEELPATAIGLKVND
PSB2_SULIY      ---------------------------------------------MEELPATAIGLKVND
PSB2_SULIK      ---------------------------------------------MEELPATAIGLKVND
PSB1_SACS9      ---------------------------------------------MEELPATAVGLKVND
PSB1_SACS2      ---------------------------------------------MEELPATAVGLKVND
PSB2_METS5      ---------------------------------------------MEELPSTAVGIRLQD
PSB2_THEPD      ---------------------------------------------MEVLPGTTVGIRVSD
PSB1_DESA1      -------------------------------------------MGEVVLPGTAIGLKTSE
PSB1_STAMF      ---------------------------------MVFIAVFNGVFAMSSLPGTVLGIKAVN
PSB2_KORCO      -----------------------------------------------MVLATALGLRFDG
PSB1_CENSY      -----------------------------------------------MPGATAVGITYAG
PSB1_NITMS      -------------------------------------------MSMYMPGATAVGITFDG
                                                                   * :*.    

PSB_HALVD       GVVLATDMRASMG-YMVSSKDVQKVEEIHPTGALTIAGSVSAAQSLISSLRAEVRLYEAR
PSB_HALWD       GTVLATDMRASLG-RMVSSKDVQKVEEIHPTGALTIAGSVSAAQSLISSIRAEVRLYEAR
PSB_HALLT       GVVMATDMRASLG-GMVSSKDVQKVEEVHPRGALTIAGSVSAAQNLISTLKAETSLYETR
PSB2_HALMA      GVIIATDRRASLGGRFVSNKQVQKVEQIHPTAAMTLVGSVGGAQSFIRSLRAEADLYEVR
PSB_HALUD       GVVIATDRRASLGGRFVSNKNVVKVEEIHPTAAMTLVGSVGGAQSFIRTLRSEASLYETR
PSB1_HALMA      GVVIATDMRASLGGRFVSNKNVQKVEEIHPTAALTLVGSVGGAQSFIRTLRAEVNLYEAR
PSB_NATPD       GVVIATDMRASLGGRFVSNKNVQKVEQIHPSAALTLVGSVGGAQSFIRSLRAEVDLYEAR
PSB1_HALTV      GVVIATDMRASLGGRFVSNKNVQKVEQIHPTGALTLVGSVGGAQSFISSLRAEVNLYESR
PSB_NATMM       GVVIATDMRASLGGRFVSNKNVQKVEQIHPTGALTMVGSVGGAQSFIGSLRAEVNLYEAR
PSB2_HALTV      GVVIATDMRASLGGRFVSNKNVQKVEQIHPTGALTLVGSVGGAQSFIRTLRAEVNLYESR
PSB_HALMD       GVVIATDMRASLGGRFVSNKSVQKVEQIHPSAALTLVGSVGGAQSFIRTLRSESDLYEVR
PSB_HALS3       GVLMASDMRASLGGRVISNKNVQKVEEIQPNAALSISGSVGGAQSFIRSLRAEANLYEAR
PSB_HALSA       GVLMASDMRASLGGRVISNKNVQKVEEIQPNAALSISGSVGGAQSFIRSLRAEANLYEAR
PSB_METRM       GVVFASERRASMG-NLVAHKVAEKIFKIDNHIAATIAGSVADAQTLMKVISAETSLYRLR
PSB_METS3       GVVFASERRASMG-NLVAHKVAEKIFKINDHIVTTIAGSVGDAQNLMKIIEAEVSLYQMR
PSB_METTH       GVVFATERRASMG-NLIAHKATDKIFKIDEHIAATIAGSVADAQSLMKYLKAEAALYRMR
PSB_METST       GVVLATETRATMG-SLVANKNADKLFQIDDKIGATIAGTVSHAQSLMDILKAEISLYKLR
PSB_THEAC       AVIMATERRVTME-NFIMHKNGKKLFQIDTYTGMTIAGLVGDAQVLVRYMKAELELYRLQ
PSB_THEVO       AVIMATERRVTME-NFIMHKNGKKLFQIDTYTGMTIAGLVGDAQVLVRYMKAELELYRLQ
PSB_PICTO       YVIMGTDSRATME-NFISNKNAQKLYQIDNYAAMTIAGLVGDAQVLVRYMKAEMELYRVQ
PSB_ACIB4       GVVMGTEHRASME-TFIAHKTAQKLYKLDYNIGMTTAGLVGDLQVLVRYMRAEINLYRIR
PSB_ARCFU       GVVMATEKRATMG-NFIASKAAKKIYQIADRMAMTTAGSVGDAQFLARIIKIEANLYEIR
PSB_FERPA       GVVLATEKRATMG-NFIASRRAKKIYKITDRIAMTTAGSVGDAQFLARLIKVETNLYTIR
PSB_ARCPA       GVVLATEKRATMG-NFIASRRAKKIYRIADRVAMTTAGAVGDAQFLARLISVEIKLYEIR
PSB_METAC       GIVLASEQRATMG-HFIASKTAKKVYQIDDLVGMTTAGSVGDAQQLVRLVSVESQLYKMR
PSB_METMA       GIVLASEQRATMG-HFIASKTAKKVYQIDDLVGMTTAGSVGDAQQLVRLVSVESQLYKMR
PSB_METTE       GIVLASEQRATMG-HFIASKTAKKVYQIDDLVGMTTAGSVGDAQQLVRLVSVESQLYKMR
PSB_METBF       GIVLASEQRATMG-NFIASKTAKKVYQIDDLVAMTTAGSVGDAQQLVRLVNVESQLYKMR
PSB_METBU       GVVLATEQRATMG-HFIASKTAKKIYQIDDLVGMTTAGSVGDAQQIVRIISVESKLFKMR
PSB_METMS       GVVLATEKRATMG-NFIASKTAKKIYQIDDLVGMTTAGSVGDAQQLVRMISVESKLYKMR
PSB_METTP       GVVLASESRATMG-SFIASRTAKKIYQIDDLVGLTTAGVVGDAQALVRMIQAEARLYRMQ
PSB_METPS       GLVLATERRATMG-NLIASRDAQKIYQLTDNIAMTIAGSVGDGQRLARMLQAESKLFELR
PSB_METAR       GVVLATERRATMG-NFIASRDAQKIYRITDNAAMTIAGSVGDGQRLARILQVEAKLFELR
PSB_METB6       GVILATEKRATMG-YMIASKRAKKVYQIADRIGMTIAGGVGDAQQLARIITVECNLYQIR
PSB_METPE       GIILATEKRATMG-SMIASKRAKKVYQVADRIGMTTAGGVGDAQQLARIMSVECNLYQIR
PSB_METMJ       GVVLATEMRATMG-NMIASKRAKKIYQITPRIGLTTAGGVGDAQQLVRILQVECNLFEMR
PSB_METLZ       GVILATERRATMG-NLIASKKAKKVHAITDKIGMTIAGGVGDAQQLVRIINVECNLYEIR
PSB_METHJ       GVVLASEKRATMG-YLISNKTAKKIYQIAPRIGLTTAGGVGDAQQLARLMTVEANLYEIR
PSB_METJA       AVILATDKRASLG-NLVADKEAKKLYKIDDYIAMTIAGSVGDAQAIVRLLIAEAKLYKMR
PSB_METSF       AVILATDKRASLG-NLVADKEAKKLYKIDDYIAMTIAGSVGDAQAIVRLLTAEAKLYKMR
PSB_METFA       AVILATDKRASMG-NLVADKEAKKLYKIDDYIALTIAGSVGDAQAIVRLLTAEAKLYKMR
PSB_METVM       AVILATDKRASMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQAIVRALIAEARLYKMR
PSB_METM6       GVVLATDKRATMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQSLIRLISAEAKIYKMR
PSB_METM7       GVVLATDKRATMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQSLIRLISAEAKIYKMR
PSB_METM5       GVVLATDKRATMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQSLIRIISAEAKIHKMR
PSB_METMP       GVVLATDKRATMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQSLIRLISAEAKIYKMR
PSB_METVS       GVVLATDKRATMG-NLIADKEAKKLYKIDDYIAMTIAGSVGDAQSLIRLLSAEAKIYKMR
PSB_META3       GIVLATDKRATMG-NLIADKEAKKLYKIDDYMAMTIAGSVGDAQSLVRIISAEANLYKLR
PSB2_HYPBU      FVVLAADRRATAG-YFVAHKRTKKIIKITDYMAMTTAGLVADAQMLAEWLANHTHYYEIV
PSB2_IGNH4      AVVLAADKRATAG-NFIVHKRVEKIVKISDYMAMTTAGLVADAQVLADVLRMEVKNYELF
PSB2_AERPE      HVILAADKRATAG-FLIASRRVKKIVMLSNYVAMTVSGLVADAQILSDVLREEIRLYEMT
PSB2_DESA1      YVVLAADKRATAG-PMVYHKAVKKISKITDYAALTISGLVADAQYIVENARYIAREYEIE
PSB2_STAMF      YVVLAADKRATAG-SLVAHKRVKKIIRIDDYIAMTISGLVADAEIIAEQARFIARKYKLE
PSB2_PYRIL      GVVLATDKRVTAG-YYIAHKQGEKIWKIDDHVAATMSGGVADLQSLLSFLTLRAREYKIE
PSB1_PYRNV      GVVLATDKRVTAG-YYIAHKQGEKIWKIDDHVAATMSGGVADLQSVLSFLTLRAREYKME
PSB1_PYRAE      GVVLATDKRVTAG-YYIAHKRGEKIWKIDDHVAATMSGGVADLQSVLSFLTLRAHEYKIE
PSB1_PYRCJ      GVVLATDKRVTAG-YYIAHKAGEKIWKIDDHVAATMSGGVADLQSVLSFLSLRAREYRVE
PSB1_PYRAR      GVVLATDKRVTAG-YYIAHKKGEKLWKIDDHVAATMSGGVADLQNILSFLTVRAREYKTQ
PSB1_CALMQ      GVVLATDRRVTAG-YYIAHRKGRKIWKIDNHAAATMSGAVADVQMILNELTHLAMNYRIT
PSB1_THEPD      FVVLAADRRATAG-YFIANKQTWKIVEIDSHIAATIAGTVGDAQQLVDRLRVEARYYKTI
PSB2_CENSY      GVVLCADMRASAG-YFIANNNTMKIQRIDDHAGLTLAGGVADAQNIVDVLRYHASLHRIR
PSB2_NITMS      GVVLCADMRASAG-YFIANNNTMKIQKIDDHAGLTLAGGVADAQNIVDILRYHSNLHRVE
PSB_METKA       GVVLAADRRAVMG-NLIAGKQVKKIFRIHDYIGVTTAGSVADAQKIVDLMRAEARLYELR
PSB2_PYRAB      GVVLAADRRASLG-NIVYAKNVTKIHKIDEHLAIAGAGDVGDILNLVRLLRAEAKLYYAQ
PSB2_PYRHO      GVVLAADRRASLG-NIIYARNVTKIHKIDEHLAIAGAGDVGDILNLVRLLRAEAKLYYSQ
PSB2_PYRFU      GVVLAADTRASLG-NIIYAKNVTKIHKIDEHLAIAGAGDVGDILNLVRLLKAEANLYKST
PSB1_THEKO      GVVLAADRRASLG-NMVLSERVTKVFQIDDHLAIAGAGTVGDILSLVRLLRAEAKLYRAK
PSB1_THEON      GVVLAADRRASLG-NMVLSKEVTKVFQIDDHLALAGAGSVGDILSLVRLLRAEVKLYRAK
PSB1_THESM      GVVLTADRRASLG-NMVISKGVTKIFQVDDHLALAGAGAVGDILSLVRALRAESKLYRAK
PSB1_THEGJ      GVVLAADRRATLG-NMVTSKEVTKVFQIDDHLAIAGAGLVGDILSLVRLLRAEAKLYRAK
PSB2_SACS2      GVILAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB2_SACS9      GVILAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULIL      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULIY      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULIM      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULIA      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULID      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB1_SULIK      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSIT
PSB2_SULIN      GVVLAADRRASAG-FFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNNIT
PSB2_SULAC      GVVLAADRRASAG-YYVAHKYVRKVLYVTDNIGITTAGSVADLQFIYEALKYIYHRNSIT
PSB2_SULTO      GVVLAADRRASAG-MYVAHKYVRKVLYVAPNIGITTAGSVADLQFIYDLLKNIYHYNLIT
PSB1_METS5      AVILAADRRASAG-FFVANKMVRKIVYIDDRIGMTTAGSVADLQFIYNYMKNIYHYNLIS
PSB1_PYRAB      GVILAADTQASLD-HMVETLNIRKIIPITDRIAITTAGSVGDVQMIARILEAEARYYQFT
PSB1_PYRHO      GVILAADTQASLD-HMVETLNIRKIIPITDRIAITTAGSVGDVQMIARILEAEARYYYFA
PSB1_PYRFU      GVVLAADTQASLD-HMVETLNIKKIIPITDRIAITTAGSVGDVQMLARYLEAEARYYYFT
PSB2_THEKO      GVVLAADTQASLD-HMVETLNIRKILPITDRIAITTAGSVGDVQALARMLEAEARYYQFT
PSB2_THEGJ      GVVLAADTQASLG-NMVETLNIRKILPITDRIAITTAGSVGDVQALARMLEAQARYYQFT
PSB2_THESM      GVVLAADTQASLD-HMVETLNIKKILPITDRIAITTAGSVGDLQALARMLEAEAKYYQFT
PSB2_THEON      GIVLAADTQASLG-HMVETLNIRKIIPITDRIAITTAGSVGDVQALARMLEAEARYYQFT
PSB_NANEQ       GVVLASDKQASMG-NIVEDKRAQKIIPITDYILLAGSGTVADLQHIAKILKTELKLRELY
PSB1_KORCO      GVIVASDKRATSG-TFVASKSAVKTLKITDYAVATISGLVADGQYLVNNVRTIADLYSLD
PSB1_AERPE      GVVLAADKRMSYG-GFILSRNFKKIFVINDRIGIAFAGLYGDMGGLVRIVEGQMRLASLE
PSB1_IGNH4      GVVLAAERRMSYG-GFIMSKAARKVFKVGDRMGMACAGLYADMQAIARALENEIRYYEIS
PSB1_HYPBU      YVVLAAEKRVSYG-GFIISKTARKVYKITDYLGLALAGLFADLQAISKILRAEIEYYNIV
PSB2_PYRAE      GVVLAAEKRVSYG-FYTLSSAGKKVFVIDDKLAIASAGIIADMQTLAKILKLNAKAYELE
PSB2_PYRAR      GVVLAAEKRVSYG-FYTLSSAGRKVFVIDDKLAIASAGIIADMQSLARIVKINAKAYELE
PSB1_PYRIL      GVVLAAEKRVSYG-FYTLSSAGKKVFIINDKLAIASAGIIADMQTLARILKLNVMSYELE
PSB2_PYRNV      GVVLAAEKRVSYG-FYTLSTAGKKVFIVNDKLAIASAGIIADMQALAKILKLNARSYELE
PSB2_PYRCJ      GVVLAAEKRVSYG-FYTLSTAGKKVFIVNDRLAIASAGIIADMQTLAKILKLNAKAYELE
PSB2_CALMQ      GVVLAAEKRVSYG-FYLMSKSGKKVYPITNRIGLASSGILADIQTITKVIRANIANMEIE
PSB1_SULAC      GVVLAAERRLSYG-DFVLSKSARKVFKL-GRFGIAGAGIVGDIQTLTRIMNVEIKYYEMY
PSB1_SULTO      GIILAAERRLSYG-GFVLSRSAKKVFKI-GRFGIAGAGIMGDIQTLTRLMNVEIKYYEMY
PSB2_SULIA      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB2_SULIL      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB2_SULID      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB2_SULIM      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB1_SULIN      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB2_SULIY      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB2_SULIK      GIVLASERRLSYG-GYVLSKQAKKVHKI-GKFLMAGAGIYGDLQTLTRIMNVEIKYYEIS
PSB1_SACS9      GIVLASERRLSYG-GYVLSKQAKKVYKI-NKFLMAGAGIYGDLQTLTRIMNVEIKYYEVS
PSB1_SACS2      GIVLASERRLSYG-GYVLSKQAKKVYKI-NKFLMAGAGIYGDLQTLTRIMNVEIKYYEVS
PSB2_METS5      GVILGAVRRLSYG-GYVLSKSAKKVFPI-SRFGIGGAGLFGDLQALTRIMNANIKYYELY
PSB2_THEPD      GVVLAAEKRVSYG-LYLMSKSGKKVYRILDKMGMASAGLMADMQTLARIVEAEMRLYELD
PSB1_DESA1      GVVLASEKRLTYD-GFVLSRNARKIHMITNHIGVGFAGLMGDVNFLVKVLRLEAKNYELQ
PSB1_STAMF      GVVIAGEKRLTYD-GYVLSKNTRKVHPITKHVGIGFAGLVGDAQFIIRALRMEAENYELQ
PSB2_KORCO      GVVLAADRRVSYN-GFILSKSARKVFLINERVGVSTAGLPGDFQELVDVLKYNITMYELE
PSB1_CENSY      GVILASEKRIAYG-NFLVSKNTRKTFQITPYVGAACAGLVADMQILSLQISALAKIRKMD
PSB1_NITMS      GVVFASEKRIAFG-NFLVSKTTKKTFPITPKVGATCAGLVADMQILSLQIAALAKIRKME
                  :.    :              *   :         *  .    .              

PSB_HALVD       RGEDMSMQALSTLVGNFLRS--GG--FYVVQPILGGVDET-GPHIYSIDPAGSILEE-EY
PSB_HALWD       RGEDMSMEALSTLLGNFLRS--GG--FFIVQPILGGVDDD-GPHIYSIDPAGSIIEE-EY
PSB_HALLT       RGKDMSMEALSTLTGNLLRS--GA--FYIVQPILGGVDDE-GSHIYSIDALGGTTEE-EY
PSB2_HALMA      RDEPLSIHALATLAGNFARG--GP--YFAINPIVGGVDEE-GSHVYSVDPAGGVLED-DY
PSB_HALUD       RDEPMSINALATLAGNFARG--GP--FLAIHPILGGVDDE-GSHVYTIDPAGGVMED-DY
PSB1_HALMA      RGEDISMKALSTLAGNFARG--GP--FFAINPILGGVDDD-GHHVYSIDPAGGVMKD-DY
PSB_NATPD       RGEDISINALATLAGNFARG--GP--FFAINPILGGVDDE-GHHVYSIDPAGGVMKD-DY
PSB1_HALTV      RGEQMSIDALATLAGNFARG--GP--FFAIHPILGGVDEE-GSHVYSIDPAGGVMED-DY
PSB_NATMM       RGEPISMDALATLAGNFARG--GP--FFAIHPILGGVDEE-GSHVYSIDPAGGVMED-DY
PSB2_HALTV      RGEPMPIEALATLAGNFARG--GP--FRAINPILGGVDEE-GSHVYSIDPAGGVMAD-DY
PSB_HALMD       RGEPMSISALATLAGNFARG--GP--FFAINPILGGVDEE-GSHVYSIDPAGGVMED-DY
PSB_HALS3       RGEYMSIDALSTMASNLLRG--GP--FFRVVPILGGVDDD-GGHVFSLDPAGSSMSD-TY
PSB_HALSA       RGEYMSIDALSTMASNLLRG--GP--FFRVVPILGGVDDD-GGHVFSLDPAGSSMSD-TY
PSB_METRM       NGKDISLEAAAAVSSNILHS--S---PAYVQTLIGGVDDT-GASIYSLDAAGGMIKD-TF
PSB_METS3       NNDKISVKAAASVTANILRS--G---PMYVQTLLGGMDGD-KPSLYSLDPAGGMIED-TY
PSB_METTH       NSEKISIEAAAALAANILHS--SRFYPFIVQTLLGGVDEN-GAKIYSLDPSGGMIPD-KF
PSB_METST       NEKDMSIDALAVLTSNILKS--R---PYYVQTILAGVDKD-GAKLYTLDPSGSYIPD-TF
PSB_THEAC       RRVNMPIEAVATLLSNMLNQ--VKYMPYMVQLLVGGIDTA--PHVFSIDAAGGSVED-IY
PSB_THEVO       RRVNMPIEAVATLLSNMLNQ--VKYMPYMVQLLVGGIDTS--PHVFSIDAAGGSVED-IY
PSB_PICTO       RKVSMPIDAAATLLSNMLNQ--TKFYPYMVQLLVGGYDTK--PHIFSIDAAGGSVED-IY
PSB_ACIB4       RKMYMPVGAAATLLSNILNE--RKFFPYYVGLLVGGFDSK-GYHVFAIDAAGGAIED-KY
PSB_ARCFU       RERKPTVRAIATLTSNLLNS--YRYFPYLVQLLIGGIDSE-GKSIYSIDPIGGAIEEKDI
PSB_FERPA       KEEEPTVKAVATLVSNLLNS--VRYFPYLVQLLIGGVDKT-GAKIYSIDPIGGAIEEIDI
PSB_ARCPA       KEEKPTVKAIATLLSNILNS--VRWFPYFVQLLVGGVDKR-GPSIYSIDLLGGAIEEIDI
PSB_METAC       RNESMTIKGIATLMSNFLNA--NRYYPMMVQLLIGGVDKN-GPAIYSLDAMGGSIEETRI
PSB_METMA       RNESMTIKGIATLMSNFLNA--NRYYPMMVQLLIGGVDKN-GPAIYSLDPMGGSIEETRI
PSB_METTE       RDESMTIKGITTLMSNFLSR--NRYYPMMVQLLIGGVDKN-GPGIYSLDAMGGSIEETRI
PSB_METBF       RNESMTIKGIATLMSNFLNS--NRYYPMMVQLLIGGVDKN-GPGIYSLDALGGSIEETRI
PSB_METBU       RQESITIKGITTLLSNMLSG--QRYYPLMVQLLIGGVDKN-GPAIYSLDALGGNIEETRA
PSB_METMS       RQESITIKGLTTLLSNILGG--QRYFPLMVQLLVGGVDKN-GPAIFSLDAMGGNIEETKA
PSB_METTP       RGEPLTIKAITSLLSNILSA--RRYFPFLVQLVVGGVDKM-GPKIFSLDALGGQIEEHDI
PSB_METPS       RHGPMSINALSMLLSNLLWE--YRI--FYIQVLVGGVDKS-GPKLFSLDPAGGRITEVKF
PSB_METAR       RHGSMSINALSMLLSNILAE--MRYAPYYVQVLIGGLDKA-GPKIYSLDPLGGRIEEEKF
PSB_METB6       RSREITVGAASTLLSNYLNQ--NRYFPYYVQLLVGGIDDH-GPSVYSVDAMGGATKEEDI
PSB_METPE       RGRSISVGASSTLLSNYLNQ--NRGYPYYVQLLVGGVDAT-GPSVYSVDAMGGATRESDI
PSB_METMJ       RGKTMSVGAASTLLSNYLNQ--NRYYPYYVQLLMGGFDDE-GPSVYSVDAMGGATKEEDI
PSB_METLZ       RGQKISVGAAATILSNYLNQ--NRFSPYYVQLLVGGVDTS-GPSVYSVDAAGGATLEENF
PSB_METHJ       RGKRISVQAASTLLSNILHG--NRMFPFYVQLLIGGVDET-GPVLFSVDAVGGTGKEDGI
PSB_METJA       TGRNIPPLACATLLSNILHS--SRMFPFLTQIIIGGYDLLEGAKLFSLDPLGGMNEEKTF
PSB_METSF       TGRNIPPLACATLLSNILHS--SRVFPFLTQIIIGGYDLLEGAKLFSLDPLGGMNEEKTF
PSB_METFA       TGKNISPLACATLLSNILHS--NRYFPFLTQLIIGGYDLLEGAKLFSLDPLGGMNEEKTF
PSB_METVM       TGKNISPRACATLLSNILHS--SRMFPFLTQIIIGGYDLTDGPKLFSLDPLGGMNEEKTF
PSB_METM6       TGNNMTPLSCTTLISNVLHG--NRHYPLLTQLILGGYDLINGAKLFSLDPVGGINEESSF
PSB_METM7       TGNNMTPLSCTTLISNVLHG--NRHYPLLTQLILGGYDLINGAKLFSLDPVGGINEESSF
PSB_METM5       TGNNMTPLSCTTLISNVLHG--NRHYPLLTQLILGGYDLINGAKLFSLDPVGGINEESSF
PSB_METMP       TGNNMTPLSCTTLISNVLHG--NRHYPLLTQLILGGYDLINGAKLFSLDPVGGINEESSF
PSB_METVS       TGNNMTPLSCTTLTSNVLHG--NRHYPLLTQLIIGGYDLINGPKLFSLDPVGGINEESSF
PSB_META3       TGNNIPPHSCAMLLSNVLHG--SRHFPFLIQLIIGGYDTIHGAKLFSLDAVGGLNEETSF
PSB2_HYPBU      NKRRMSIHAAAQYLSIILHS-AKFY-PYIVQLLLGGYD-T-QPRLYNIDWFGSVTEE-KY
PSB2_IGNH4      HKKRMSVKAAATFLSNVLHS-ARFY-PYIVQLLVGGFD-T-APRLYSLDWFGTVAEE-EF
PSB2_AERPE      NKVKPSVRFVASLLSNILFS-SKFF-PYIVQLIVGGYD-T-QPRLYTLDLFGSITED-KY
PSB2_DESA1      MGGPIPIKALASRISLILSVYLRYS-PFIVQLLLGGRDST-GASLYYMDLYGSVTRE-KY
PSB2_STAMF      LGRPIKVSALASNLSIILNAYLRMS-PYIVQLLLGGYDDN-GPHLFYIDLFGSLSEE-KY
PSB2_PYRIL      YKRPIPIRALVNYVSLILFY-SRPY-IYLVHSIIGGVDREEGAVLYMVDWLGTVTRE-RY
PSB1_PYRNV      YKRPIPIRALVNYVSLILFY-SRPY-IYIVHSIIGGVDDEEGAVLYMADWLGTVTKE-RY
PSB1_PYRAE      YKRPIPISALVNYMSLILFY-SRPY-IYIVHSIIGGVDEEEGAVLYMVDWLGTVTKE-KY
PSB1_PYRCJ      HKRPIPIRALVNYVSLLLFY-SRPY-IYLVHSIVGGVDAEEGPVLYMVDWLGTVTKE-KY
PSB1_PYRAR      FRRPIPIRALVNYMSLILFY-SRPY-VYVVHSIIGGVDEEEGAVMYMVDWLGTVTKE-KY
PSB1_CALMQ      HQAPVPIKTLANYASVVMFY-SRPM-IYIAHMIIGGVDNEEGPVLYAVDWYGSFTREERF
PSB1_THEPD      TGDSMPVKSVATLASLILFQ-YRP--ILSVQMLIGGVDSD-GPSLFSVDWLGTVTRE-KY
PSB2_CENSY      KQGPIPIKSLARLTSLIFHQ-NRGY-PFMADILMGGFDAV-GPALYNIDMFGSVEEK-SY
PSB2_NITMS      KHGPISIHSLARLCSLIFHQ-NRGY-PFMADILVGGYDAE-GPALFNIDMFGSVEKK-AY
PSB_METKA       HNRMISARALANMISHVLHSSLKAFRPYLVQLIVGGFNDD-DPALYNLDPSGSIIEE-DY
PSB2_PYRAB      SGKRMSVKALATLLANMLNG--ARMLPYLAWFLVGGFDEK--PRLYSVDMMGGITED-KY
PSB2_PYRHO      SGKRMSVKALATLLANIMNG--AKYFPYLAWFLVGGYDEK--PKLYSVDMVGGITED-KY
PSB2_PYRFU      VGKEMSVKALATLLANILNG--SKYFPYLGWFLVGGYDEK--PRLFSVDMVGGITED-NY
PSB1_THEKO      VSREMSVKALATLTSNILHS--GRGFAYMAWFLVGGYDSA--PRLYSIDAAGGVTED-RF
PSB1_THEON      VGREISVKALATLTSNILHG--SRFMPYFGWFLIAGYDEK--PALYSLDMAGGVTED-KF
PSB1_THESM      VGKEMSTKALATLTSNILSG--RKYLPYFGWFLIGGYDEK--PSLYSIDMAGGITED-KY
PSB1_THEGJ      VGREMSVKALATLVSNVLHG--SRHLPYFAWFLIGGYDVK--PRLYSIDAAGGVTEE-RF
PSB2_SACS2      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB2_SACS9      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULIL      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULIY      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULIM      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULIA      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULID      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB1_SULIK      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB2_SULIN      KYGPISIKGIATRLANVLSA--TKYFPYIVQILIGGYDDQ--PRLFNLDYLGDITEE-NY
PSB2_SULAC      GEGPITVKGIATWLANVLSS--SKYFPYLVQILIGGVDDQ--PRLYNLDYLGDITEE-EY
PSB2_SULTO      GMRPITIKALATYLANMLSF--SKYLPYIVQILIGGVDEQ--PRLYNLDYVGDITEE-DY
PSB1_METS5      GNRPVTVKSLATYLTNILSQ--NKYFPYLVQILMGGYDTQ--PRLFNLDYLGDMTEE-TY
PSB1_PYRAB      WGRPMTTRAMANLLSNILNE--NKWFPYLVQIIIGGYVDE--PTIANLDPLGGLIFD-DY
PSB1_PYRHO      WGRPMTTKAMANLLSNILNE--NKWFPYLVQIIIGGYVDE--PTIANLDPYGGLIFD-NY
PSB1_PYRFU      WGRPMTTKAMANLLSNILNE--NRWFPYLVQIIIGGYVDE--PTIANLDPFGGLIFD-DY
PSB2_THEKO      WGRPMTAKAMAHLLSNILNE--NKWFPYMVQIIIGGYVEE--PTLANLDPLGGLIFD-DY
PSB2_THEGJ      WGRPMTTRAMANLLSNILNE--NKWFPYMVQIIIGGYVDK--PELASVDALGGLVFE-KY
PSB2_THESM      WGKPMTAKAMANLLSNILNE--SKWFPYMVQIIIGGYVEE--PTLASLDPLGGLIFD-NY
PSB2_THEON      WGKPMSTKAMANLLSNILNG--NKWFPYLVQIILGGYVEE--PTLANLDPLGGLIFD-DY
PSB_NANEQ       SRRTMNVIEAANLLSHLLYQ--NRFYLNPLGLLIAGPINSKEFGIYSLDGIGAISEIKDY
PSB1_KORCO      TERPLSVRGIARILAFLLRR--YRPYFLLAQLIVGGVDRE-GAHLFNVDPFGTLTEE-DY
PSB1_AERPE      TGKPATVRNVAKFLSSLLYS-YKFFP-FNVEAIVGGIDPGGEPKLYVLDPLGSIIEE-DY
PSB1_IGNH4      NKRKMKVRSAARLLGLILYS-NKLFP-LMTETVFGGYD--DEPRIFVLDPVGSVIEE-KY
PSB1_HYPBU      TGRRISVRAVARLLATILYS-YKYYP-FLSETLVGGLEADGTAKLYVMDPLGSLIED-DY
PSB2_PYRAE      MKRKPSTHSMARLLSVIMFS-RRFMP-FFAEVLVGGID-EEGPHLIVMDPLGSLIED-NY
PSB2_PYRAR      TRKKPTVRSMAKLLSVIMFS-RRYMP-FFAEVLVGGVD-EEGSHLIVMDPLGSLIED-NY
PSB1_PYRIL      VRKKPTVRAMAKLLSIIMFS-RRLLP-FYAEVLVGGVD-EEGPHLIVMDPLGSLIED-NY
PSB2_PYRNV      VKKKPTVKAMAKLLSVVMFS-RRFMP-FYAEVLVGGVD-EEGPHLIVMDPLGSLIED-NY
PSB2_PYRCJ      MKRKPSVHAMAKLLSVVMFS-RRFMP-FFAEVLVGGID-DEGPHLIVMDPLGSLIED-NY
PSB2_CALMQ      MKRPVSVRAAAKLLSIMLFQ-NKYMP-YIAETMVGGID-EEGPKLFILDSWGSLIED-DF
PSB1_SULAC      NSRKISARAAAKLLSVILYQ-NKVLP-YISELLFGGVD-EDGPKLFILDPIGSLIED-SY
PSB1_SULTO      NNKPISVKAAAKLLSVILYQ-YKWTP-FISELLFGGVD-DEGPKLFVLDPIGSLIED-NY
PSB2_SULIA      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_SULIL      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_SULID      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_SULIM      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB1_SULIN      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_SULIY      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_SULIK      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB1_SACS9      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB1_SACS2      TGKPISVHAAAKLLSVILYQ-YKVMP-FISEILFGGVD-EKGPQLYVLDPIGSLIED-NY
PSB2_METS5      NNRPISTRAAAKLLSIILYQ-YKYMP-FISEVLFGGVD-NGEPQLYVLDPLGSLLDD-IY
PSB2_THEPD      SNISPKVWTVAKLLSYILYE-RRLFP-YYAEIVVGGLD-EEGSHLYSLDPIGAIIED-DY
PSB1_DESA1      HGREIKTRSLAKLLSVILYS-YKLAP-MLTEVVVGGYD-EEGPSLYILDPVGSVIEE-KY
PSB1_STAMF      LGREIRVRGLAKILSLILYS-YKLAP-LMTEVVVGGFD-EKGPQIYVLDPVGSLIED-KY
PSB2_KORCO      NEKAATPTNVAKLLSILLYQ-GRFSGIYYAELVVGGID-NSGPKIFVLDPAGGLMEE-NF
PSB1_CENSY      LKRDIPPNSVAKMMSNMMYE-RRFFP-LLTQVIVGGVV--GEPAIYTLDSLGSVLPD-EY
PSB1_NITMS      LKRDVPPNTVAKMMSNMMYE-RRYFP-LLTQVIVGGVV--DKPIMYTLDPLGSVLPD-EY
                                                :..*        :   *  *        

PSB_HALVD       TVTGSGSQYALGVLEQEFEDGLSIEEAKGVATKAIRSAVERDLASGN-GINIAVVTED-G
PSB_HALWD       TVTGSGSQYALGVLEQQYNEDLSIEEAKTVAARSIESAVERDLASGN-GINVCVVTED-G
PSB_HALLT       TVTGSGSQYALGVLEQEYDDDVTVDEAKTMAAKAIQSAVERDLASGN-GINVAVVTDD-G
PSB2_HALMA      TVTGSGTMVATGTIEGQYDHGMSLSEARDLAIRAVNAAAERDTGSGN-GVVLAEITDE-G
PSB_HALUD       AVTGSGMQVAYGTIEGEYESDLSTEEAKELATNAVQAASERDTGSGN-GLVIAEITDE-G
PSB1_HALMA      TVTGSGLTVAYGTLEDRYEEDMTNEEAKEVAAASIKAAAERDTGSGN-GIYLADVTAD-G
PSB_NATPD       TVTGSGLTVAYGTLEREYEDDMTNEEAKRVAASGIKAAVERDTGSGN-GVFLATVTDE-D
PSB1_HALTV      TVTGSGMQLAYGHLEQAYEEDMSNEEAVSVAAHGIKSAVERDTGSGN-GVFLCEITDE-G
PSB_NATMM       TVTGSGMQLAYGLLEQEFEEDLSNDEATTVAARAIKSAAERDTGSGN-GVFLCEITDE-G
PSB2_HALTV      TVTGSGMQLAYGLLEQEYEEGLSLEEAQSVAARAIESAVERDTGSGN-GVFLAAVTGE-G
PSB_HALMD       TVTGSGMQVAHGKLEDRYHDDLSMEEAEELAVEAVYAATERDTGSGN-GVYVATVTGD-G
PSB_HALS3       TAQGSGMPYALGVLEQEYSEDLTMADAEQVAAHAVKSASERDTASGN-GIHITKITHD-G
PSB_HALSA       TAQGSGMPYALGVLEQEYSEDLTMADAEQVAAHAVKSASERDTASGN-GIHITKITHD-G
PSB_METRM       ISTGSGSTFAYGVLEDRFYEDITVEEATEVAIRAIKAATERDTFSGN-GFLVANVTKD-G
PSB_METS3       ISTGSGSIVAYGVLEDRYHEEITTDEGLEIAVRAIKAASERDTFSGN-GYLVAKVTKD-G
PSB_METTH       VSTGSGSPVAYGVLEDRYSDELYVDEAVDVAIRAIKSAMERDTYSGN-GILVATVTEEEG
PSB_METST       TSTGSGSPYAFGVLEDRYNEDITTEEGKKIAIKAITSAMERDVYSGN-NYRLGVITKD-G
PSB_THEAC       ASTGSGSPFVYGVLESQYSEKMTVDEGVDLVIRAISAAKQRDSASGG-MIDVAVITRKDG
PSB_THEVO       ASTGSGSPFVYGVLESQYNEKLSIDEGVDLVIRAISAAKQRDSASGG-MIDVAVITKKDG
PSB_PICTO       ASTGSGSPFVYGVLEAEYQKNMSLDDGINLVIKAISAAKQRDSASGN-MLQLGVVDPKKG
PSB_ACIB4       ASVGSGSLFVYGVLEDRWKDDLSLDEGINLVIRGINAAMRRDAASGD-GISVATITKDEG
PSB_ARCFU       VATGSGSLTAYGVLEDRFTPEIGVDEAVELAVRAIYSAMKRDSASGD-GIDVVKITED-E
PSB_FERPA       VATGSGSPMAYGVLEDNYRKDINVDEAVELAIRAIYSAMKRDSASGD-GIDVVKITEK-E
PSB_ARCPA       VATGSGSPTAYGVLEDRYTPEITVDDGVELAVRAIYSAMRRDSASGD-GIDVVKITKD-G
PSB_METAC       SATGSGSPMAYGVLEDQYKEDIAVKEGLDLAIRAIHNAMKRDSASGE-NIDVVVITKE-A
PSB_METMA       SATGSGSPMAYGVLEDQYREDIAVKEGLDLAIRAIHNATKRDSASGE-NIDVVVITKE-A
PSB_METTE       SATGSGSPMAYGVLEDQYRENMTVKEGLDLAIRAIHNATKRDSASGE-NIDVVVITKE-A
PSB_METBF       SATGSGSPMAYGVLEDQYREDMTVKEGLDLAIRAIHNATKRDSASGE-NIDVVVITKE-A
PSB_METBU       VSTGSGSPMAYGVLEDRYTEDMTVVEGVDLAIRALHNAMKRDSASGE-NIDVVVITKD-K
PSB_METMS       VATGSGSPMAYGVLEDRYHEGINVDEGMELAVRALYNAMKRDSASGN-GIDVVKITAD-G
PSB_METTP       VSTGSGSPIAYGVLESLYKPGLSIQDGSVLCVRAVHTAMKRDSASGN-GIALVRITKD-R
PSB_METPS       SSTGSGSPLAYGVLEDRYKQDMSVEQGVELAAKALESAMKRDSASGN-GMQFCVITPG-K
PSB_METAR       VSTGSGSPIAYGVLEDRYKPGMSVEEGVELAARALESAMKRDSASGN-GMQFCVITAE-K
PSB_METB6       VSTGSGSPMAYGVLEDRYRPGMNEDEAVELAVRALRSAMKRDAGSGE-GIHVVVITKD-R
PSB_METPE       VATGSGSPMAYGVLEDRYKKDLTEDEAIELAIRALRAAMRRDSASGE-GIHVVIITKD-A
PSB_METMJ       VATGSGSPFAYGVLEDQYRAGMKEDDAKDLAVRAVRSAMRRDSASGE-DIMVVVITKD-K
PSB_METLZ       VSTGSGSLTAYGVLEDRFKPNMTEEEAIELAVRALRAAMLRDSASGE-GYNVVIITQE-K
PSB_METHJ       VATGSGSPMAYGVLEDRYTLGMDERSAIELAIRALRSAIKRDAGSGE-GVAVVVITED-S
PSB_METJA       TATGSGSPIAYGVLEAGYDRDMSVEEGIKLALNALKSAMERDTFSGN-GISLAVITKD-G
PSB_METSF       TATGSGSPIAYGVLEAGYDREMSVEEGIKLAINALKSAMERDTFSGN-GISLAVITKE-G
PSB_METFA       TATGSGSPIAYGVLEAGYDRDMPVEEGIKLALKALKSAMERDTYSGN-GISLAVITKE-G
PSB_METVM       TSTGSGSPIAYGVLEAEYDRDMSIEEGLKLALKALKSAMERDTYSGN-GVSVAVITKE-G
PSB_METM6       TATGSGSPTAYGVLEAEYRSDVTIDKGLLVAVKALSSAMQRDAYSGN-GISLAHINKD-G
PSB_METM7       TATGSGSPTAYGVLEAEYRSDVTIDKGLLVAVKALSSAMQRDAYSGN-GISLAHINKD-G
PSB_METM5       TATGSGSPTAYGVLEAEYRSDVTIDKGLLVAVKALSSAMQRDAYSGN-GISLAHINKD-G
PSB_METMP       TATGSGSPTAYGVLESEYKSDIAIEKGLLIAVKALSSAMQRDAYSGN-GISLAHINKD-G
PSB_METVS       TATGSGSPTAYGVLEAEYKSEINIEKGLLIAVKALISAMQRDAYSGN-GISLAKIDKT-G
PSB_META3       TATGSGSPTAFGVLEEEYKKDMTINKGKLLAIKSLTAAMKRDAFSGN-GISLAVIDKN-G
PSB2_HYPBU      VATGSGSPTAIGVIEDQYSPNLSMEEAVELAKRAVASSIRRDTFTGN-GVDVVVIGK-DF
PSB2_IGNH4      LVTGSGSPMAVGVIEAEYNPNMDLEELVNLAVRAVFAATRRDTASGE-GIDVAVIDR-NG
PSB2_AERPE      TATGSGSPIAYGVLEERYREDLSVEEAIKVATTAIRSAVLRDAASGD-GADVVVIGP-QG
PSB2_DESA1      MATGSGSPVAFGILEKNYRSDLSLEEAKKLAFNAVSSAIMRDGFSGE-GVDIVVIGP-GI
PSB2_STAMF      MATGSGSPTAFGVLEEEYRSDLSLDEAKELAFKAVSAATKRDGFSGE-GVDIVVIGP-NT
PSB2_PYRIL      IATGSGSPYAKGALEVGYREDMSLEDAVDLAIRSVKAAIRNDPGSGE-GIDVVVITK-EG
PSB1_PYRNV      IATGSGSPYAKGALEVGYREDMSLEDAVDLAIKAVKAAIRNDPGSGE-GIDVVVITKREG
PSB1_PYRAE      IATGSGSPYAKGALEVGYREDMTLEDAVDLAIKAVKAAIRNDPGSGE-GIDVVVITRKEG
PSB1_PYRCJ      IATGSGSPYAKGALEVAYREDLTIDEAVELAIRAVKAAIRNDPGSGE-GIDVVTITKSDG
PSB1_PYRAR      VATGSGSPYAKGVLEVGYRGDLTVEEAVDLAINAIKAAIRNDPGSGE-GIDVVTITKRDG
PSB1_CALMQ      MSTGSGSPTAFGVLEDGYRDDMSLDDAVKLATRAVRAAMLHDPGSGE-GVDVITITKEAG
PSB1_THEPD      TATGSGSPYAVSLLEHEYREDLSLEEAVNLAVKAVNIALARDPGSGE-GVDIATITK-EG
PSB2_CENSY      VTTGSGSPVAYGTLEEEYRADLTADEAKGVALRAVKAAITRNIGTGD-GINVAVING-NG
PSB2_NITMS      VTTGSGSPVAYGLLEEEYREDLTVEEAKKIALRAVKAAIVRNIGTGD-GINIAIMDK-DG
PSB_METKA       TATGSGSPTAYGVLEAEYEEGMSLDDAIEVAVRAVKSALERDTGTGE-GVTVVTITREEG
PSB2_PYRAB      VAAGSGMEFAYSVLDSEYREDLKVREGIKIAVEAINSAIKRDVFSGD-GIMVVTITE-EG
PSB2_PYRHO      ATAGSGMEFAYSILDSEYKDNLTLEEGIKLAVKAINTAIKRDVFSGD-GILVVTITK-EG
PSB2_PYRFU      AAAGSGMEFAYSILDSEYREEMSVNDGIKLAVKAINVAIKRDVFTGD-GLLVVTITK-DG
PSB1_THEKO      TAAGSGMEFAFSVLEENYRDGIPLEEGVKLALRAIKAATKRDVFTGG-GVTLVTITE-EG
PSB1_THEON      TAAGSGMELAFAVLEDGYKDDINVEEGVKLALKAIKIATRRDVFTGD-GITLVTVTE-EG
PSB1_THESM      VSAGSGMEFAYSILDNEYSEKITLNNGVKLAIKAINAAIKRDVFTGD-GIMVVTIDR-EG
PSB1_THEGJ      IAAGSGMEFALALLEENFSDGMGLDEGIDLAVRAVKAAIRRDVYTGE-GVTVVAITK-EG
PSB2_SACS2      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB2_SACS9      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULIL      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULIY      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULIM      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULIA      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULID      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB1_SULIK      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB2_SULIN      VATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGT-GVIVAKIHS-KG
PSB2_SULAC      TATGSGSPEALGVLEDNYKPEMSLDEAAELAKRAIFSSIKRDSFTGT-GVIVTKITK-NG
PSB2_SULTO      TATGSGSVEAIGVIEDEYRPDMTLDEAADLARRAIFSSIKRDPYTGT-GVIVSKITK-NG
PSB1_METS5      VATGSGSPVAMGVLEDGYSPDLTGDQAMDLAARAVMSAIKRDSFTGT-GVIVTKITK-EG
PSB1_PYRAB      TATGSGTPFAIAILEEGYRKNLGIEKAKELAIKAVKAAGARDVYTGSKKIQVVTITK-DG
PSB1_PYRHO      TATGSGTPFAIAILEEGYKENLGIEEAKELAIKAIKAAGSRDVYTGSKKVQVVTITK-EG
PSB1_PYRFU      TATGSGTPFAIAVLEEGYREDLTIEEAKELAIRAVRAAGRRDVYTGSKKVQVVTITK-DG
PSB2_THEKO      TATGSGSPFAIAVLEDGFRKDMSLEEAKELAVRAVRTAGKRDVYTGDRKVQVVVISK-DG
PSB2_THEGJ      TATGSGSPFAIAIIEDGYREDMSIEEAKELAVRAVKTAGKRDVYTGERKVQVVVITK-DG
PSB2_THESM      TTTGSGSPFAIAILEDGYKEDMSIEDARELAIKAVRTAGKRDVYTGERKIQVITITK-EG
PSB2_THEON      TATGSGSPFAIAVLEDGYKKDMSIEEAKELAVRAVRTAGKRDVYTGSRKIQIVAITK-EG
PSB_NANEQ       FAEGSGGVIALGTLEAEYNPDITVRDAIKLAEKALKSSIARDVFSGY-GIEIYTITKKGV
PSB1_KORCO      LATGSGSPVAISVIESGYSPDMDRESALRLVISSMTAALSRDAATGD-GIDVVVIDDR-G
PSB1_AERPE      VAAGTGATTAFGLLEHVYKRGMSLEEAKKAAVEALRASMARDAGTGD-GIDVLVLPVSGK
PSB1_IGNH4      SAVGTGAPLAMALLDKEYREDMSLEEAQNLAIESVKVASGRDSLSGD-GIDVLVIPFGGK
PSB1_HYPBU      AAIGSGAPIAIGILENGYSKDMSVDDAKKLAIAAVRAAIERDAMSGD-GIDLLVIRRE-E
PSB2_PYRAE      AALGTGAKLAVAVLDTGYRPDITVEEAKKLAVQALKAAIERDPVSGG-GIDLAIVDKNGA
PSB2_PYRAR      AALGTGAKLAISVLDTGYREDITLQDAKKLAVKALKAAIERDPVSGG-GIDLVLIDQTGA
PSB1_PYRIL      AALGTGAKLAVSLLDATYRPDISLQEAKKLAVQAIKAAIERDPVSGG-GIDLAVVDNNGA
PSB2_PYRNV      AALGTGAKLAVSLLDASYRPDMTVEEAKKLAVQAVKAAIERDPVSGG-GIDLVVVDGGGA
PSB2_PYRCJ      AALGTGAKLAIAIIDASYKPDMSLQDAKKLAVQALKAALERDPVSGG-GIDLVVIDKNGA
PSB2_CALMQ      AALGNGARTAIGLIETGYSSSITVKEAKELAIKAIKEAIARDPTSGD-GIDTLVITGNGY
PSB1_SULAC      AAVGSGARVAIGVLEAEYNESLTSEAAKELAIKSMKSAVERDVMSGD-GIDILIINK-NN
PSB1_SULTO      AAVGSGARVAIGVLESEYDPSMNLDKGKEIVLKALKAAIERDVTSGD-GIDILTIKRDNT
PSB2_SULIA      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB2_SULIL      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB2_SULID      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB2_SULIM      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB1_SULIN      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB2_SULIY      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB2_SULIK      AAVGSGARIAIGVLESEYDPNMNLDIAAQLITKAIKASIERDITSGD-GIDLAIMDKKGN
PSB1_SACS9      AAVGSGARIAIGVLESEYDPNMSLDVATQLITKAIKASIERDITSGD-GIDLAIIDKKGN
PSB1_SACS2      AAVGSGARIAIGVLESEYDPNMSLDVATQLITKAIKASIERDITSGD-GIDLAIIDKKGN
PSB2_METS5      AAVGSGARVAIGVLEAEYSEKLTLTQGRELTIKSLRASAERDVTSGD-GIDILTISKDGK
PSB2_THEPD      VALGSGTQLAISIVESNYKKDMSLDEALSLALKSVYAAMKRDAASGD-GVDVLVIGKSGT
PSB1_DESA1      VAVGSGAQLALGYIEPRYNPGLGLKEAEELAVNAVKTVIERDVLSGD-GIDLVVIDKNGY
PSB1_STAMF      VALGSGGPIALGIIEKEYREDIDVDEAEKLAVSAIREAIERDAVSGD-GVDVLRITEEGY
PSB2_KORCO      SAVGSGAQIATGILERFFKEGMSEKEAVELAERAMREAISRDALSGD-GIDLLIITSKGS
PSB1_CENSY      AAVGTGAEMALGVLDPQFKSGMSEKDAVDLAVRGIRSAALRDSFSGD-GLDILALDANGA
PSB1_NITMS      AAVGTGAEMALGVLDPQFKPNMTKDEAIDLAKRAVRAASLRDSASGD-GVDVLVITKDGT
                   *.*   . . ::  :   :           .:     .:  :*        :     

PSB_HALVD       VDIQRHQNFEGLE--------------------
PSB_HALWD       VEITQHEDFEELV--------------------
PSB_HALLT       VDITRYKDFDDLL--------------------
PSB2_HALMA      VEIDAFDDYESAE--------------------
PSB_HALUD       VEIEEFDDLADAL--------------------
PSB1_HALMA      VDINGY-DFDELL--------------------
PSB_NATPD       VEIKGHKDFDEVL--------------------
PSB1_HALTV      VDIHGHHDFDEVL--------------------
PSB_NATMM       VDIHGHHDFDEVV--------------------
PSB2_HALTV      VDIQGHNDFDAVI--------------------
PSB_HALMD       VDITGYDDFEGAR--------------------
PSB_HALS3       LTTVGHKEFDALL--------------------
PSB_HALSA       LTTVGHKEFDALL--------------------
PSB_METRM       FKMLEKEEVDAIIEKINS---------------
PSB_METS3       FEMLDKEKVNDIVAKI-----------------
PSB_METTH       FRMLSEEEIQKRIENLN----------------
PSB_METST       MKIYTKEEIAQIKKQL-----------------
PSB_THEAC       YVQLPTDQIESRIRKLGLIL-------------
PSB_THEVO       YVQLPTEQIEARIKKLGLIL-------------
PSB_PICTO       FYYLSEDEILSRLKKLKLQL-------------
PSB_ACIB4       FVELSQEEVEKRMKKLKLK--------------
PSB_ARCFU       FYQYSPEEVEQILAKFRK---------------
PSB_FERPA       YVELTPEEIEAILEKLR----------------
PSB_ARCPA       YFELSKEEVDKILSSLRRA--------------
PSB_METAC       FKRLDPEEVKSRRDSLN----------------
PSB_METMA       FKRLDPEEVKSRRALLN----------------
PSB_METTE       FKRLDPEEVKSRRALLN----------------
PSB_METBF       FRRLDPEEVKSIRASLPK---------------
PSB_METBU       YERLDPEAVMKKRELLN----------------
PSB_METMS       YKRIETGEVDKILENLK----------------
PSB_METTP       YEEVPTSEVEEIVRSL-----------------
PSB_METPS       VEIFEREVGKQVCNS------------------
PSB_METAR       FEIFEREVSKQVINA------------------
PSB_METB6       YENVSEETIKKHLAKTIA---------------
PSB_METPE       YSELSEERLEQYTAAVTA---------------
PSB_METMJ       YEEHIESGLQRPSAARPTL--------------
PSB_METLZ       FEYLPEDKIAGYLPPAK----------------
PSB_METHJ       YHELSDEEISVLTPN------------------
PSB_METJA       VKIFEDEEIEKILDSMKAKPKKKTTKRSRRKSK
PSB_METSF       VKIFEDEEIEKILDGMKAKSKKKTTKRGRRKSK
PSB_METFA       VKIFEDEEIEKILNEITSKSKKKTTKRSRRKSK
PSB_METVM       VKLLSDEEITKLLGNDKSKTKKKSTRR-RKKSK
PSB_METM6       VNIYSDEEIEGFLKKIN---KKR----------
PSB_METM7       VNIYSDEEIEGFLKKIN---KKR----------
PSB_METM5       VKLYSDAEIEGFLKKIN---KKR----------
PSB_METMP       VKLYSDAEIEGFLKKIN---RKR----------
PSB_METVS       VTLYSDEEIENLVKKVT---KKK----------
PSB_META3       VKIYSDEEIEELSNILY---K------------
PSB2_HYPBU      YREYSFELKDILKTK------------------
PSB2_IGNH4      ITMRHYRLGDVIRLVRP----------------
PSB2_AERPE      YEEKFIPYNSLV---------------------
PSB2_DESA1      YSEETIPLKKTIESS------------------
PSB2_STAMF      YVEETKLFKRSIIAK------------------
PSB2_PYRIL      FRRVFTAQQKIIITE------------------
PSB1_PYRNV      FRRVFTAQQKIVLAE------------------
PSB1_PYRAE      FKRVFTTQQKLVLPSL-----------------
PSB1_PYRCJ      FRRVFTTQQKIIIPE------------------
PSB1_PYRAR      FKRIFTTQQKLLIPEI-----------------
PSB1_CALMQ      YREVQA---------------------------
PSB1_THEPD      IRMKRV---------------------------
PSB2_CENSY      FELLTREQKKAVIAL------------------
PSB2_NITMS      FRLLTEEQKKAVIEL------------------
PSB_METKA       YRELPEEEVEKLLS-------------------
PSB2_PYRAB      YRELSNSRLKAILRQ------------------
PSB2_PYRHO      YKELSDSELEATLKQ------------------
PSB2_PYRFU      YKEYRGAELEKMLK-------------------
PSB1_THEKO      YREWSEEELKSLLE-------------------
PSB1_THEON      YRELNREEIEALLK-------------------
PSB1_THESM      YRELSKEEVEKLLKKL-----------------
PSB1_THEGJ      YREL-----EPVLK-------------------
PSB2_SACS2      HEELEFYLNKKM---------------------
PSB2_SACS9      HEELEFYLNKKM---------------------
PSB1_SULIL      HEELEFYLNKKV---------------------
PSB1_SULIY      HEELEFYLNKKV---------------------
PSB1_SULIM      HEELEFYLNKKV---------------------
PSB1_SULIA      HEELEFYLNKKV---------------------
PSB1_SULID      HEELEFYLNKKV---------------------
PSB1_SULIK      HEELEFYLNKKV---------------------
PSB2_SULIN      HEELEFYLNKKV---------------------
PSB2_SULAC      HEEKEYYITKR----------------------
PSB2_SULTO      HEEKEYYPQRKI---------------------
PSB1_METS5      HVEREIYPNRKEAM-------------------
PSB1_PYRAB      MKE-EFVTL------------------------
PSB1_PYRHO      MQE-EFIKL------------------------
PSB1_PYRFU      MKE-EFVV-------------------------
PSB2_THEKO      MKE-EFVEFKE----------------------
PSB2_THEGJ      MKE-EFVEFKE----------------------
PSB2_THESM      MKE-EFVEFKE----------------------
PSB2_THEON      ITE-EFVEFND----------------------
PSB_NANEQ       EKLFLEAQK------------------------
PSB1_KORCO      VNFLSREEISDLVREVLR---------------
PSB1_AERPE      PSLETIKFRLVEG--------------------
PSB1_IGNH4      PSIRTVSLEA-----------------------
PSB1_HYPBU      DSIKAEEESITI---------------------
PSB2_PYRAE      REEEVRVQLLI----------------------
PSB2_PYRAR      KEEEVKVQLLI----------------------
PSB1_PYRIL      REEEVKIQMVI----------------------
PSB2_PYRNV      REEEVKVQVVI----------------------
PSB2_PYRCJ      REEEVKLQVLI----------------------
PSB2_CALMQ      LEDSIKL--------------------------
PSB1_SULAC      IYEDFIKI-------------------------
PSB1_SULTO      SSEDFIKIF------------------------
PSB2_SULIA      YENKFIPY-------------------------
PSB2_SULIL      YENKFIPY-------------------------
PSB2_SULID      YENKFIPY-------------------------
PSB2_SULIM      YENKFIPY-------------------------
PSB1_SULIN      YENKFIPY-------------------------
PSB2_SULIY      YENKFIPY-------------------------
PSB2_SULIK      YENKFIPY-------------------------
PSB1_SACS9      YENKFIPY-------------------------
PSB1_SACS2      YENKFIPY-------------------------
PSB2_METS5      INTEFLSS-------------------------
PSB2_THEPD      LEKTYPLSELQSVAV------------------
PSB1_DESA1      QSKEIIFKMTG----------------------
PSB1_STAMF      SLREYMFRRETS---------------------
PSB2_KORCO      RMEFIPVRTA-----------------------
PSB1_CENSY      REIAQAA--------------------------
PSB1_NITMS      EEFTEEIK-------------------------