CLUSTAL format seed alignment for MF_02114

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COFC_METJA        ------------MNCGIKMKVIIPVSPINSLKTRLSEFLSGE-----ERKNLLLNMLKDI
COFC_METFA        ------------------MKVIIPVSPINSLKTRLSEFLSSE-----ERKNLLLNMLRDI
COFC_METSF        ------------------MKVLIPVSPINSLKTRLSEFLSSE-----ERKNLLLNMLRDI
COFC_METVM        ------------------MIVIIPVSPINSLKTRLSEFLSEE-----ERKYLLLNMLKDI
COFC_METIM        ------------------MNTIIPISPINNLKTRLSEFLTLE-----ERKNLLFNMLRDI
COFC_METM7        -----------------MLAALIPVSPLSNVKSRLKEFLSSE-----ERIELIKNILLDT
COFC_METM6        -----------------MLAALIPVSPLSNVKSRLKEFLSSD-----ERIELIKNILIDT
COFC_METM5        -----------------MLAALIPVSPLSNVKSRLKEFLSSD-----ERIELIKNILLDT
COFC_METMP        -----------------MLAALIPVSPLSNVKSRLKDFLSSG-----ERIELIKNILLDT
COFC_METVS        -----------------MLAALIPVSPLSNVKSRLKEFLSSK-----ERIDLIKNILLDT
COFC_META3        -----------------MFSALIPVSPLNAVKTRLKDFLTPD-----ERIELIKNMLLDV
COFC_METRM        ---------------MDKIYAIIPVNQFANAKTRLSPFLTPE-----ERRDLLKAMLKDI
COFC_METS3        ---------------MDDIYGIIPVSKFKECKTRLSPFLSEE-----ERENLLKVMLKDV
COFC_METTH        ----------------MKTCAIIPVSRFTHAKTRLSPTLSPS-----EREGLLKAMLMDV
COFC_METST        ---------------MNKIITIIPISSFNNSKTRLSPFLSES-----ERTNLLKVMLKDI
FBID_CONWI        ----------------MSTFAILPVKRFEGAKGRLAGGLAAG-----PRRALAEAMYVDV
FBID_RUBXD        ----------------MSVFAVVPVKELRGAKSRLGAVLDPV-----GRAGLTLHMLRRV
FBID_THET1        -------------MSAMNIAVLVPVKKLDKAKMRMADTLDRS-----QRRQLMMVTLRRV
FBID_CHLAA        -----------------MIGIVIPIKRLHLAKSRLIDLLDPA-----DRQQLVVTMVRHV
FBID_CHLSY        -----------------MIGIVIPIKRLHLAKSRLIDLLDPA-----DRQQLVVTMVRHV
FBID_CHLAD        -----------------MIGIAIPIKRLQFAKSRLAGVLAPA-----ARQRLVLRLAQHV
FBID_SPHTD        ----------------MTTIAVVPVQRLSTAKSRLAARLAPD-----ERRTLVLSLLDHV
FBID_THERP        ----------------MQVLAVVPVQRLEQAKSRLAPALEPA-----ARQALVRELAERT
F6FU04_ISOV2      ------------MSARGGAVAVVPLRDGVSGKSRLAGELDPP-----ARRRLVAALARHV
A5V3B5_SPHWW      ----------------MDTHLVLAVRPPEEGKSRLAATIDSD-----QRSALNYKMFRHV
FBID_ROSCS        ----------------MDLYAIVPVKELRHAKQRLAHALDAH-----ERQELSLAMLGDV
FBID_ROSS1        ----------------MVIHAIVPVKELHRAKQRLARVLDAH-----ERRALSLAMLNDV
FBID_RHOOB        -------MSTATRSVAPRAHVLVAVKELHAAKTRLSGVFDTD-----DRTGLVLSMLRDT
FBID1_RHOJR       --------------MAPRAHVLVAVKELHAAKTRLSSVFDTA-----DRTGLVLSMLRDT
FBID_RHOE4        ------------------MHAIVAVKSLRSAKSRLAGELDAD-----ARADLVLAMLHDT
FBID_NOCFA        -------------MRPHAVHALIAVKRLDQAKSRLADRLRPE-----HRARLVLAMLADT
FBID_MYCSK        MRGTTSNGAAP---SGAGVAVVIAVKRLADAKTRLAPIFAPH-----DRETVVLAMLVDT
FBID_MYCSS        MRGTTSNGAAP---SGAGVAVVIAVKRLADAKTRLAPIFAPH-----DRETVVLAMLVDT
FBID_MYCSJ        MRGTTSNGAAP---SGTGVAVVIAVKRLADAKTRLAPIFAPH-----DRETVVLAMLVDT
FBID_MYCS2        MSGRRTPGAASDGSAGGQAAVIIAVKRLTAAKTRLAPIFSAA-----TREEVVLAMLVDT
FBID_MYCGI        ---MRNSAP------DADIGLVIAVKRLTAAKTRLAPVLSAT-----NRESVVLAMLVDT
FBID_MYCVP        ---MNNS--------HADVGLVIAVKRLTAAKTRLAPMFSAR-----TREDVVLAMLVDT
FBID_MYCBO        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCBP        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCTU        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCBT        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCTA        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCTF        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCTK        MSGTPDDG---------DIGLIIAVKRLAAAKTRLAPVFSAQ-----TRENVVLAMLVDT
FBID_MYCMM        MSGIRADGT-------GDVGLIIAVKRLGAAKTRLAPVFSAA-----ARESVVLAMLMDT
FBID_MYCUA        MSGIRADGT-------GDVGLIIAVKRLSAAKTRLAPVFSAA-----ARESVVLAMLMDT
FBID_MYCLB        MSGTRAGGT-------ADVGLIIAVKRLAAAKTRLGPVFSTR-----TRENVVLAMLVDT
FBID_MYCLE        MSGTRAGGT-------ADVGLIIAVKRLAAAKTRLGPVFSTR-----TRENVVLAMLVDT
FBID_MYCPA        MSGKRADGGHD---GAGDVALIIAVKRLAAAKTRLAPVFSAR-----TRESVVLAMLTDT
FBID_MYCA9        -MGRQAGT---------DFGVIIAVKNLATAKSRLAPSLPAP-----QRERLVLGMLTHA
FBID_STRCO        ----------------MQWTLVVPVKALARAKSRLSDTADDG-----LRPGLALAFAQDT
FBID_STRAW        ----------------MQWTLVVPLKALARAKSRLADTAGDG-----LRPGLALAFAQDT
FBID_STRSW        ----------------MQWTLVVPVKPLARAKSRLSDTAADA-----VRPGLALAFAQDT
V6KNN3_STRRC      --------------------MVIPLKPLSRAKSRLSDTAADG-----VRPGLALAFAQDT
FBID_THECD        ------MAVETSHDAELTWSLVLPVKPLARAKTRMAEAAGP------LRQALALAVAADT
FBID_STRRD        ------MLKAMPASESSGWTLVVPVKTLVAAKTRLSEAAGP------HRAALAVAIACDT
FBID_SALAI        --------------MTQVWTVVVPVKRLGVAKSRLRGALP--DQP---HEALALALAVDT
FBID_GEOOG        ------------MVAVRAWSVVVPAKRLPLAKTRLRPLPEGLDGPPDAHDRLVLALLADT
FBID_FRACC        -----MVAFVWLPRNGVSWTVVLPLKNLTRAKTRLDRPDR---------SRLALAMALDT
E3IZY0_FRAIE      --------------------MVLPLKRLGAAKSRLEHPDR---------AALALAMATDT
A1SF03_NOCSJ      ---------------MARWCAVVPQKALASAKSRTGLPDAQ-------RRELATALLRDT
COFC_METPS        ------------------MKAVVPFKT-VNAKSRLSAVLT-----ADERTKLARLMLDDI
COFC_METAR        ------------------MKAIVPFKV-VNVKSRLASLLT-----PEERSELAKLMLRDI
COFC_METMA        ------------------MRAVIPYKK-AGAKSRLSPVLS-----LQEREEFVELMLNQV
COFC_METAC        ------------------MRAVIPYKK-AGAKSRLSPVLS-----LEEREEFVELMLNQV
COFC_METBF        ------------------MKAVIPYKK-SSAKSRLSPVLT-----REEREEFVDLMLNQV
COFC_METBU        ------------------MRAVIPYKN-ENAKSRLSPILS-----KKDREEFVELMLKDV
COFC_METMS        ------------------MRAVIPYKK-ENAKSRLSTVMT-----REQRETFVEKMLLDV
COFC_METB6        ----------------MCPHALIPFKP-AGPKSRLSGILS-----PEEREAFARAMLEDV
COFC_METPE        ----------------MTPLAVIPFRP-LNPKSRLSGIMT-----REERELFAAAMLTDV
COFC_METMJ        ----------------MYFHALIPFKP-VNPKTRLSCILN-----QEEREAFARAMLEDV
COFC_METLZ        ----------------MYFHALIPFKP-VNPKTRLSSVLS-----QEEREEFARIMLEDV
COFC_METHJ        ---------MVTFVSEMRIPVVIPYKP-IQPKTRLSCILT-----DEEREDFAFMMLRDV
COFC_ARCFU        ------------------MRILIPFKA-NNPKSRLSSILS-----EEERKELARLMLLDV
COFC_FERPA        ------------------MKIYVPFKP-TNPKSRLSKIMS-----EDERREFAFQLLLDV
COFC_ARCPA        ------------------MLVLIPFKP-VNPKTRLSKVMR-----KNERENFARCMLLDV
COFC_NATMM        ------------------MHVVVPFAA-DTPKTRLSEVLS-----PPERTALARAMLADV
COFC_HALTV        ------------------MQVVVPFAA-TEPKTRLADVLT-----PAERTAFARAMLADV
COFC_HALLT        ------------------MEVIVPFST-ERPKSRLSAVLT-----PDERAAFARTMLQDV
COFC_HALMD        ------------------MRVVVPFSA-TEPKTRLAPVLD-----ADERRAFARVMLADV
COFC_HALUD        ------------------MHVVVPFDG-RDPKTRLAPVLD-----APERRDFARAMLADV
COFC_HALVD        ------------------MRVVVPFGG-RDPKTRLAPFFD-----ADERREFAVSMLRDV
COFC_NATPD        ------------------MDVLVPFAA-REPKTRLAGTLD-----ADERAAFARAMLLDV
COFC_HALMA        ------------------MRLAVPVSG-STPKTRLASVLS-----PDERRDFTEAMLADV
COFC_HALS3        ------------------MRTVVPFDP-RDPKSRLAEFFAD----AEERRGFAYAMLADV
COFC_HALSA        ------------------MRTVVPFDP-RDPKSRLAEFFAD----AEERRGFAYAMLADV
COFC_METTP        --------------MLRPVHCVVPFKS-SGCKTRLSSALS-----GEQRWQLAVAMLRDV
FBID2_RHOJR       ------------MSDYGEWAVIVPFRSLDVAKSRLAVSCR---------RDLALAFLQDT
FBID_PHEZH        -----------------MAEAILAVRGGLGAKSRLAAVFSDA-----ERAALVEAMLLDM
FBID_OLICO        -------------MARSDAFVILPVKAFVGAKSRLAPLLSVG-----ERTMLARVMLNDV
COFC_METKA        ------------------MRFVVPFADRGDRKTRLSSCMDEE-----TRERFALAMLRHV
FBID_COLP3        ----------------MRTNIVIPMKDPQLSKTRLDPQLSSR-----QRQALALSMFKTT
FBID_MYCRK        -MRCNGMSPVSVAQRNTGIWAVVPLKAPECAKTRLSGVLSHA-----ARQALFFSMASHV
E6N7L0_CALS0      ----------------MKNVAILPVKNLAQAKSRLSTVLPMD-----SRLNLARKLFNHV
A9A392_NITMS      ----------------MKIAAIIPVKTFSNAKTRLDLPPQ-------KVEDLCKVMLEEI
                                        :.       * *                 .        

COFC_METJA        IKALDGL--------DIVIVSRDEEILDFAKNE--------------------------L
COFC_METFA        KKALEGL--------DVVVVSRDDEILDFAKYE--------------------------L
COFC_METSF        NKALEGL--------DVVIISRDEEILEFGKNE--------------------------L
COFC_METVM        KSALINL--------DTVVVSRDEEILNFAKKE--------------------------L
COFC_METIM        FKALKGL--------NIYAISKDPEILEFCNN---------------------------L
COFC_METM7        YETVKECSD------ACYVVSKDEEILEFSKN---------------------------L
COFC_METM6        YETVKECSD------ACYVVSKDEEILEFSKN---------------------------L
COFC_METM5        YETVKECSD------ACYVVSKDEEILEFSKN---------------------------L
COFC_METMP        YETVKECAD------ACYVVSKDEEILEFSKN---------------------------L
COFC_METVS        YEKVKSCVD------ACYVVSKDDEILEFSKN---------------------------L
COFC_META3        YEGISPICD------KIYVVSKDKEILEFLKP---------------------------Y
COFC_METRM        TDTLKPIVD------KVVIISRDEEVLAYAEE---------------------------L
COFC_METS3        TDTLRKYTD------KIIIISADEDVLNYAKS---------------------------L
COFC_METTH        SGALARHVD------RVLVISADEDVLEYAYS---------------------------L
COFC_METST        VSNIQDHVS------DIIVTSKDEYVLNYAKY---------------------------L
FBID_CONWI        LTALRRTQG----VDRVLVLTADPGAQRVAEG------------------------YDAI
FBID_RUBXD        VPALRGAG-----LRRVLVVSPDPAVLEEARL------------------------LGAA
FBID_THET1        LSALQKAQ-----IGDVYLVASDPQVKNIACD------------------------LCVK
FBID_CHLAA        ITTARQAVSYLSIPARIWLVSPEPTLATDSE--------------------------GIE
FBID_CHLSY        ITTARQAVSYLSIPARIWLVSPEPTLATDSE--------------------------GIE
FBID_CHLAD        INAARQATGSFTMPARIWLVSADPAIAALAQA------------------------SGVE
FBID_SPHTD        LTALNAARQ----VDAVILVSPDPEVLEHAAR------------------------RGAI
FBID_THERP        IRILRSVPA----VAVIGLLTPDPSLASLASR------------------------WGVR
F6FU04_ISOV2      VEVLAAMPA----VERIVVVTADLGFVHETLAGLLGP-------------------AGRV
A5V3B5_SPHWW      LKIGSELFP----PGQIILVSRSAALRDEVAA------------------------LGGH
FBID_ROSCS        LAALSQSQ-----VRRVTVISRDTAAYQIATA------------------------YGAV
FBID_ROSS1        LVALSYSP-----VSRIIVIGRDVETGHTARA------------------------HGAA
FBID_RHOOB        LAVVSDVATV----VGVTVVTPDPAVARLARS--V--GAHV-------------------
FBID1_RHOJR       LAVVSDVATV----VGVTVVTPDPAVARLARS--V--GAHV-------------------
FBID_RHOE4        LATVAAVSAI----DTVTVVTPDPTVAALAYS--V--GVTV-------------------
FBID_NOCFA        MTATTSVPGI----AAVTVVTPDAAVADLARS--L--GGHV-------------------
FBID_MYCSK        VAAAAAVAA-------VTVVTPDPAAAEAARA--L--GAQV-------------------
FBID_MYCSS        VAAAAAVAA-------VTVVTPDPAAAEAARA--L--GAQV-------------------
FBID_MYCSJ        VAAAAAVAS-------VTVVTPDPAAAEAARA--L--GAQV-------------------
FBID_MYCS2        ITAASTVAP-------VTVVTPDEVAADAARQ--L--GAGV-------------------
FBID_MYCGI        IGAAITVPAV----RSVLVVTPDDGAASAARR--L--GARV-------------------
FBID_MYCVP        ITAAIAVPAL----RSVLVVTPDEDAADAARQ--L--GALV-------------------
FBID_MYCBO        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCBP        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCTU        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCBT        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCTA        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCTF        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCTK        LTAAAGVGSL----RSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCMM        LTAAARVGDL----RSITVITPDESAAAAATE--L--GAEV-------------------
FBID_MYCUA        LTAAARVGDL----RSITVITPDESAAAAATE--L--GAEV-------------------
FBID_MYCLB        LTAAAPVSAL----RSITVITPDEAAAAAAAE--F--GAEI-------------------
FBID_MYCLE        LTAAAPVSAL----RSITVITPDEAAAAAAAE--F--GAEI-------------------
FBID_MYCPA        LTAATRVPSL----GSITVITPDEAAAAAAAG--L--GADV-------------------
FBID_MYCA9        IAVAFSAAG------TVAVISPDPTAKAAASE--A--GARF-------------------
FBID_STRCO        VAAALACPA----VADVAVVTDDARAGRELAA--L--GAGV-------------------
FBID_STRAW        VAAALASAA----VRDVAVVTGDPVAGRELAA--L--GARI-------------------
FBID_STRSW        VAAALAATA----VRGVVVVTDDPLAARELTA--L--GARA-------------------
V6KNN3_STRRC      VAAAVSCTA----VADVVVVTDDELAARELAA--L--GARI-------------------
FBID_THECD        VAAALRCAA----VAEVIVVTDDPLAAAELSA--L--GARV-------------------
FBID_STRRD        VEAALSCVI----VARIVVVTGDPLAAEALGG--V--GAHV-------------------
FBID_SALAI        VSAVLACPV----VADVLVVTDDPAVATETGM--A--GARV-------------------
FBID_GEOOG        VAAALSSPA----VTGVLVVTDDPAAAAEVTR--L--GART-------------------
FBID_FRACC        VMAVLESETDL--VGAVMIVTNDRTADHALST--L--LNSHYIGADQPNLSPAARSARLV
E3IZY0_FRAIE      AAAAAAAGPDL--VAGVLLVTNDPAASAAITG--D--GLAH----------PDDRPTPVV
A1SF03_NOCSJ      VAALEETPA----VDAVLVLWDDELDRVVLPA--V--RSVP-------------------
COFC_METPS        TGVLREAGL------KVVLLTTAPFKYD--------------------------------
COFC_METAR        TSTLAAAGV------EVELLTTQPFEWDG-------------------------------
COFC_METMA        ISSLKGAGIE-----QVDILSPSVYGLEEM-----------------------------T
COFC_METAC        IDSLRGAGIE-----KIDILSPSVYGLEDM-----------------------------T
COFC_METBF        IDTLKEAGVG-----TIDILSPSMYGLENM-----------------------------T
COFC_METBU        IKALDDAEVV-----NIDILTTSAEGIPND-----------------------------F
COFC_METMS        VATLKEGGIR-----NIDIITTNACDVKKE-----------------------------V
COFC_METB6        IAAARDANC------SPVIVATELFDSED-------------------------------
COFC_METPE        IGAVTAAGC------TPLVLATTPYTVAS-------------------------------
COFC_METMJ        IAAVQKSGC------SATLLCTHSFKHEN-------------------------------
COFC_METLZ        ILAVRRTGC------SATLLCTSKYECRD-------------------------------
COFC_METHJ        VNAVKNAGC------SPLILATAPVELDD-------------------------------
COFC_ARCFU        IDAAKPFG-------EIKVVCPSELDVEG-------------------------------
COFC_FERPA        LDCCEE---------AVVLSASRDERLRD-------------------------------
COFC_ARCPA        LDALSSFDC------DIKIISTHPFKIES-------------------------------
COFC_NATMM        LSAITATGH------VPTVLSTSPLSLENGCSCDDL------------PSTTPPGLESAS
COFC_HALTV        LTAVVEAGH------EPTVLATAPLDLE----------------------TLDLEAAVRD
COFC_HALLT        LAAIDAADG------EPRILATGAVGID-------------------------------L
COFC_HALMD        LDALDTVGV------DPTVLATEAIDLD--------------------------------
COFC_HALUD        AETIESISF------EPTILATTDVECE--------------------------------
COFC_HALVD        LDAVRAVGG------DPAVVADALVTVD--------------------------------
COFC_NATPD        CDAVEAAGG------EPTVLATEPLAIE--------------------------------
COFC_HALMA        VDAVTSAGH------EPEVISTAPLDCA--------------------------------
COFC_HALS3        LGAVRDAGG------DPVVVATAPVSRP-------------------------------V
COFC_HALSA        LGAVRDAGG------DPVVVATAPVSRP-------------------------------V
COFC_METTP        LRTLRSIGMV-----TVLARPGMREDIIAD-----------------------------L
FBID2_RHOJR       LAALTLSNHI----SSVIVVSRNAALSETIGT----------------------------
FBID_PHEZH        LDALAGAGAGA--VRRVWVVTPTERLERLAAA---------------------------A
FBID_OLICO        LDAAIAAVGP----QSVSVVTSADDVADHARR---------------------------A
COFC_METKA        VRVLSKFGE-------VEVVTPDS------------------------------------
FBID_COLP3        LSFFNKYFPQ----HHLLVVTASEFISDIACT---------------------------Y
FBID_MYCRK        IGTLRASPRI----ASLLVVTPSESTAEMARA---------------------------A
E6N7L0_CALS0      WKTCLEAGL------RPYAVTSDKNLAAELGK----------------------------
A9A392_NITMS      LQTVSISPQI----DKVVMVTKEEKAIEIGKK---------------------------F
                                                                              

COFC_METJA        KAETIKEKY------------KGLNNAIKQAFEEIED--------KEVIIIPADIPLIKK
COFC_METFA        KAEIVKEKY------------KGLNNAIKQAFDEIDD--------EEVIIIPADIPLIKK
COFC_METSF        KAETIKEKY------------KGLNKAIKQAFEEIED--------DEVIIIPADIPLIKK
COFC_METVM        NAKTIKERE------------KGLNNAIKQAFEEINQ--------EEILIIPADIPLIKK
COFC_METIM        GAKTIEEKG------------KGLNQALNQAFSVVN---------EDLLIVPADIPLIRE
COFC_METM7        GIIPIREDSS----------VKGLNEAISFSLKFIKE--------DSILITPADVPLLKE
COFC_METM6        GIIPIRENSS----------VKGLNEAINFSLKFIKE--------DSILITPADVPILKE
COFC_METM5        GIIPIREESN----------VKGLNEAINFSLKFIKE--------DSILITPADVPLLKE
COFC_METMP        GIIPIREDSN----------VKGLNEAINFSLNFIKE--------ESILITPADVPLLKE
COFC_METVS        GIIPIKEDLN----------TKGLNEAIEYSLNIIKE--------DSVLITPADVPLLKE
COFC_META3        AVIPIMETEN----------IKGLNDALNYAFNYIEE--------DNIIITPADIPLIKK
COFC_METRM        ELTTIVEEEYKKSKAVNSSDDNPLNKALKQAMKWSRKKT----RK--VIILPSDIPLIGK
COFC_METS3        NLSVLKE-----------NDNSNLNKALKQAMEYCKGKT----KK--VIIMPSDIPLIGK
COFC_METTH        GLKILEE-----------EGERDLNGALEQAMDFCAPEF----DR--VIITPSDIPLIGK
COFC_METST        NLNVFKEKE---------HEHDFLNNAISDAISYISKNY----DNYSVMILPADIPLFNS
FBID_CONWI        PLDDPAEAG---------------QNRAVMRGVAHAREL----GATRVLCLSGDTPMLDP
FBID_RUBXD        GLRQEGFG----------------LNAALEEGRRRALEE----GAGALLALPADLPLIEP
FBID_THET1        FIPDQGDE----------------LNPSLELARG-ELCQ----NYDALLVVFGDLPMISD
FBID_CHLAA        WLPDNQEE----------------LNAALTEARQRIQAA----GVQIMMVLAGDLPFVTV
FBID_CHLSY        WLPDNQEE----------------LNAALTEARQRIQAA----GVQIMMVLAGDLPFVTV
FBID_CHLAD        WLPDRCEE----------------LNAALTEARKQIQNA----GAQTMIVLAGDLPLVTA
FBID_SPHTD        ALLQPGVG----------------LNEGLRLGRDEALRR----GADTLLIVLADLPWITA
FBID_THERP        TLRDAAHG----------------LNDAVRLAQAEACRL----HLPALLIVLGDLPLLDP
F6FU04_ISOV2      TVVEQPAQRPG-------------LNAAVAVGREHASGL----GAERLLVVHADLPALAP
A5V3B5_SPHWW      ALEESGDD----------------LNAALEQGAAFAMGH----GAGSLLSLSSDLPSLTV
FBID_ROSCS        IAVDQTSD----------------LNAALY--QAAVDVP----DDAAILIVPSDVPLLRA
FBID_ROSS1        FVIDQSAA----------------LNDALH--QAAADIP----DHAAALVAPSDLPLLGA
FBID_RHOOB        -YADPAPVAAGDPADEG-GTEHGLNAALAAAAEHVRRNE----SGVDVVALQADLPSLRG
FBID1_RHOJR       -YADPAPVSAEDRPDEG-GTEHSLNAALSAAAEHVRRNE----RGVDVVALQADLPSLRG
FBID_RHOE4        -YADPAPHISLTNGASP-RAEETLNAALSAAAADIRAKR----GVVDLVVLQADLPAMQP
FBID_NOCFA        -HPEPAADSA-----------DSLNAALAAAAAGVRARH----GGVDLLALQADLPALRP
FBID_MYCSK        -LDDPTPAGH----------PDPLNNALRAAEAAVRA------TVPNVVALQGDLPALQA
FBID_MYCSS        -LDDPTPAGH----------PDPLNNALRAAEAAVRA------TVPNVVALQGDLPALQA
FBID_MYCSJ        -LDDPTPAGH----------PDPLNNALRAAEAAVRA------TVPNVVALQGDLPALQA
FBID_MYCS2        -LADPTPEGH----------HNPLNNAIMAAEEHLRA------GTPNIVVLQGDLPAMQP
FBID_MYCGI        -LADPTPAGH----------RDPLNNALSAAETAIRE------ECSNIVVLQGDLPALKS
FBID_MYCVP        -LPDPTPQGH----------HDPLNNALTAAEVVARR------ENTNVVALQGDLPALRT
FBID_MYCBO        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCBP        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCTU        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCBT        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCTA        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCTF        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCTK        -LADPTPEDD----------PDPLNTAITAAERVVAE------GASNIVVLQGDLPALQT
FBID_MYCMM        -LADPTRQGD----------PDPLNNAILTAEQVVSG------SVPNIVVLQGDLPAMQT
FBID_MYCUA        -LADPTRQGD----------PDPLNNAILTAEQVVSG------SVPNIVVLQGDLPAMQT
FBID_MYCLB        -LADPTPDGH----------GDPLNNAIAAAEHAIAG------SFSNIVVLQGDLPALQT
FBID_MYCLE        -LADPTPDGH----------GDPLNNAIAAAEHAIAG------SFSNIVVLQGDLPALQT
FBID_MYCPA        -LADPTPEGH----------PDPLNNAIATAERAVSG------SFTNIVALQGDLPALQS
FBID_MYCA9        -IFDDTPEGH----------PDPLNNALRSAAAQLRA------SSPNLVVLQADLPVVTA
FBID_STRCO        -VADEPGGG--------------LNAALAHGAAVVRAAR----PESPVAALNADLPALRP
FBID_STRAW        -VADEPAGG--------------LNAALAHAAAVVRSGR----PDSGVAALNADLPALRP
FBID_STRSW        -VPEDPGGGPG----------DGLNAALRHGAALVRDVR----PQSPVAALNADLPALRP
V6KNN3_STRRC      -VPDAPGSG--------------LNAALAHGAAVVREKR----PRTPVAALNADLPALRP
FBID_THECD        -VPDEPDCG--------------LNPALAHGAALARAAR----PRAGVGAMSADLPALRP
FBID_STRRD        -VGD-PEAG--------------LNAALRRGAQEAVRLA----PGDAVGALQADLPALRP
FBID_SALAI        -VPDRPAAG--------------LNSAVRHGAATAGAGW--------IAGLTADLPALRP
FBID_GEOOG        -VPDEPGRG--------------LNPALEHGARATGGRA--------VAALSSDLPALRP
FBID_FRACC        VIPDEPDRG--------------LNPALVHGAALASARW----PTRAVAALSADLPALRP
E3IZY0_FRAIE      AIPDLPDRG--------------LNPALRHGARAVARRW----PGHGVAALSADLAALRP
A1SF03_NOCSJ      ----VAGLG--------------LNASLERGAAVALDRL----PGRGIVVVPGDLPALDP
COFC_METPS        -AEIVVSEKD-------------LNSALNDFLSSASE---------PVMIIMADIPLITV
COFC_METAR        -ATVIVSEKE-------------LNPALNDYLLANDS---------PVMIVMADIPLITE
COFC_METMA        EARVLLDEKD-------------LNEALNRYLKEAEE---------PVLIVMADLPLLSP
COFC_METAC        KARVLLDEDD-------------LNEALNRYLAGSEE---------PVLIVMADLPLLAP
COFC_METBF        KANVLLDKND-------------LNEALNGYLEQAEE---------PVIIVMADLPLLSP
COFC_METBU        NGNVTITEPG-------------LNDSINEYLQNANE---------PILIIMADLPLVTG
COFC_METMS        KANIIEDDTD-------------LNDCLNKYLSQKEE---------PILIIMADLPLVKF
COFC_METB6        -VQITIADKD-------------LSGTLNEVLSQAAG---------PVLILMADLPLATG
COFC_METPE        -VRVRVTDAD-------------LSTALNTLLRDQDG---------PVLIMMADIPLATK
COFC_METMJ        -ALVAVRTEP-------------LNDAINWALGQFHC---------PALIIMGDIPLVTA
COFC_METLZ        -ALVAIRKEG-------------LNEAINWALPQFHC---------PALIIMSDLPMVTP
COFC_METHJ        -VPVRILEEG-------------LNETINGFCEGNDE---------PLAIVMADLALADR
COFC_ARCFU        -VEVVVDTSD-------------LNTTVNKVMD--EA---------PLAVIMSDLPLLSE
COFC_FERPA        -LKHEVDERD-------------LDTAVTSRIK--KE---------DSAFVMSDLALISK
COFC_ARCPA        -YDVVVDSRE-------------LDDAINSRI---EG---------ETAVIMSDIPLINS
COFC_NATMM        DIPVTVDDRP-------------LTAAVNAQLEAAEE---------PVAIVMADLALATP
COFC_HALTV        AGSVAVDDRP-------------LTEAVNARLPERGDGGDDGTHIDPVAVVMADLALATA
COFC_HALLT        PSPVEIDDRP-------------LTDAVNAAIDARLGNDG----AERVAVVMADLALATP
COFC_HALMD        -RPVTVDDRP-------------LDAAINGLLAASDE---------PVAVVMADLALATP
COFC_HALUD        -WPVVVDERS-------------LDAAVNDQLAVADG---------PVAVVMADLALVTP
COFC_HALVD        -APVTVDDRP-------------LTEVVGGELDDLGGG--------PVAVVMADLALATP
COFC_NATPD        -QPVVVDKRP-------------LTPAIDAHLS----P--------PAAVVMADVALVTP
COFC_HALMA        -VPVTVDDRG-------------LDPLVNDLLASTVTDDE-----GALAVVMADLPLVTR
COFC_HALS3        DAPVTVDDRA-------------LSTAVAAAIADGPL---------PTAVVMADLALATP
COFC_HALSA        DAPVTVDDRA-------------LSTAVAAAIADGPL---------PTAVVMADLALATP
COFC_METTP        DATLRFSELE-------------LGDALNGFIDENTAAGW----PADILIVMADLPLIRE
FBID2_RHOJR       --PVIKDQGS------------GIDDAVEIGHRWLREHG----HDGHYSVVMPDLPALRT
FBID_PHEZH        GARVIREPRP-----------AGLNAAFRCGLAAAAEEA----PYADIVLLPGDLPTLRA
FBID_OLICO        GVGVIDDEGA-----------RGTNAAVKVGFARIAARR-----RGAVLTLSSDIPGLIP
COFC_METKA        SLSVPGTKVR-------------RSDASLDELPLPDG---------EFGLVMSDLPLLSE
FBID_COLP3        GASVLIETKL------------GLRQAVESAARWSLNND-----FQSQLLIPADIAELDY
FBID_MYCRK        GAEILWGPPD-----------EGMANACSRAMAHIAAAG-----GERVMFVPGDLPLLDG
E6N7L0_CALS0      --NAIPDTGH------------GLNRAIKHALETLKP--------TSYFIILPDLPMLTA
A9A392_NITMS      KVHTIIDEKE-----------ESVNSAVALADKYLLENN-----FDASMVFPQDIPYIKT
                                                                       * .    

COFC_METJA        KHIEDILK---LSKNYDLIIAPSRGGGTNLLYLKS---KDLIEIKYEGFSFLKHLEEAKK
COFC_METFA        KHIEDILK---LSKDYDLIIASSRGGGTNLLYLKS---KNLIELRYEGFSFLKHLEEAEK
COFC_METSF        RHIEDILK---LSKDYDVIIAPSRGGGTNLLYLKS---KNLIEIKYEGFSFLKHLEEAKK
COFC_METVM        HHIEDIIN---LSNHYDMIIAPSRGGGTNLLYLKS---KNLIDLKYEGFSFLKHLKEAEN
COFC_METIM        SHIKEIKK---LKEEFEAIIAPSRGGGTNLLYLSR---ASLINLRYEGFSFLKHLEEFKR
COFC_METM7        ENLKAVTD---KSVKNSIVICPSRGGGTNLLLLNP---KECIKTQFEGFSFLKHIEEAEK
COFC_METM6        ENLKVITN---KSVKNSIVICPSRGGGTNLLLLNP---KDCMKTQFEGFSFLKHIEEAEK
COFC_METM5        ENLKTITS---KSVENSIVICPSRGGGTNLLLLNP---KDCMKTQFEGFSFLKHIEEAEK
COFC_METMP        VNLKAITS---KSVKNSIVICPSRGGGTNLLLLNP---KNCMKTQFEGFSFLKHIEEAEK
COFC_METVS        ENLESIVK---KSVENSVIICPSRGGGTNLLLLNP---KNCIKPQFEGFSFLKHIKEAEI
COFC_META3        ENINNIVK---ECKENSVILCPSRGGGTNLMVLN----RSSIKTRYEGFSFLKHIEECKE
COFC_METRM        TNVKLLID---QAKNFDFIIVPSKGGGTNTL-IIK---PLAIDMKFEGFSFNKHIEEAKR
COFC_METS3        TNLKMVID---SSKQLDFIIIPSKGGGTNTI-IMK---PLAIRTKFGDFSYKEHVNAADR
COFC_METTH        ADVSNLLD---HASRADVVIAPANGGGTNTL-ILR---PSAMSLRFGDCSFFEHIHEARE
COFC_METST        RNMKYILK---NRD--DFIISPSKGGGTNLLYINR---EYNYKPLFGAFSFFKHVQEAKN
FBID_CONWI        ADLDALLGRPRTADRYVVIVPDRHGEGTNGLLLC---PPDGMKPSYGVDSCARHKALAEE
FBID_RUBXD        ADVAALLEVA-GEGPCAVISPDDARSGTNALLLR---PPGALPFSFGPGSFGVHLQAALR
FBID_THET1        KDIKTIVRLG-SSKPSCVIAPDKRNVGTNVLFLH---PPYLLPFTFGGNSYERFRSNCEK
FBID_CHLAA        RDLILLSEAL-TDND-VVVAPDQHGQGTNALGLH---LPSQLPFGFGPDSAGYHLRTAAR
FBID_CHLSY        RDLILLSEAL-TDND-VVVAPDQHGQGTNALGLH---LPSQLPFGFGPDSAGYHLRTAAR
FBID_CHLAD        EDVAALYDAL-SEAD-LVLAPDQQQRGTNALALR---LPSPLPFLFGLDSANRHVAAATQ
FBID_SPHTD        DEIDALVAAL-PERG-IALAPDRHDHGTNAAALR---PPDAIEPAFGAGSFARHQAQARS
FBID_THERP        HAIRHALALL-ESPG-VVLAPDRHGTGTNLLALA---PPDVIAPAFGPFSRWRHRRAAAG
F6FU04_ISOV2      DDVEAVLRA----DADVVVATDRHASGTNLLLVPLHPPGSSFTFRFGPDSRAAHVAEAGR
A5V3B5_SPHWW      DDVRAMLDA----PAPVAIATDRLRTGTNALRM---RPAGAIPFRYGVDSLAAHLAAATA
FBID_ROSCS        DDVMMLAA------QPGVAITPAHDGGTNLLLTP---AIRGWTFLFGPDSFVRHCAEARR
FBID_ROSS1        EDVIALTCIS--GDKPGVAIAPAHDGGTNLLLVS---PVVGWTFLFGPDSLTHHIAAARQ
FBID_RHOOB        GEFGEALAAARTGG--RSVVVDHHGTGTAALFSCDP--EVPLDPRFGPGSAKRHLESGAR
FBID1_RHOJR       GEFGEALAAARTGG--RSVVVDHHGTGTAALFSCDP--EIPLDPRFGPGSAKRHLESGAR
FBID_RHOE4        SELTEAVAAARSGG--RSVVVDHHGTGTSALFACG---ESALDPRFGPESARGHANSGAR
FBID_NOCFA        DELADVLATAPRGG--RAIVTDHAGTGTAALLVRD---GGELAPAFGPDSARRHIAAGAV
FBID_MYCSK        QELSEAIAAARTRP--RSFVGDRHGTGTSALFAFG----VPLDPRFGPDSAERHRRSGAV
FBID_MYCSS        QELSEAIAAARTRP--RSFVGDRHGTGTSALFAFG----VPLDPRFGPDSAERHRRSGAV
FBID_MYCSJ        QELSEAIAAARTRP--RSFVGDRHGTGTSALFAFG----VPLDPRFGPDSAERHRRSGAV
FBID_MYCS2        RELAEALAAARTYP--RSFVGDRHGTGTSALFAFG----VPLQPRFGADSATHHRHSGAI
FBID_MYCGI        IELAEALHAARAHP--RSFVTDRHGTGTAALFAFG----VALQPRFGAGSAQRHRESGAV
FBID_MYCVP        VELAEAIGAARAHA--RSFVTDRHGTGTSALFSFG----APLDPHFGLDSAQRHRRSGAV
FBID_MYCBO        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCBP        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCTU        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCBT        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCTA        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCTF        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCTK        QELAEAISAARHHR--RSFVADRLGTGTAVLCAFG----TALHPRFGPDSSARHRRSGAV
FBID_MYCMM        QELADAICAARAHQ--RSFVADRLGTGTAALCAFG----SALDPQFGPDSSARHRRSGAV
FBID_MYCUA        QELADAICAARAHQ--RSFVADRLGTGTAALCAFG----SALDPQFGPDSSAQHRRSGAV
FBID_MYCLB        QELSEAIAAARHHQ--RSFVADRLGSGTAALCTFG----TALNPQFGPDSSAQHRRSGAI
FBID_MYCLE        QELSEAIAAARHHQ--RSFVADRLGSGTAALCTFG----TALNPQFGPDSSAQHRRSGAI
FBID_MYCPA        QELAEAVAAARAHR--RSFVADRLATGTAALFAFG----TRLDPRFGSDSSARHRSSGAI
FBID_MYCA9        TEFAAALAAARGHA--RSFVADRHGTGTAALFSTD----GDLNPLFGIDSAQRHRDSGAI
FBID_STRCO        AELARVLAAATQFP--RAFLPDAAGIGTTLLTVAP---GQELAPAFGADSRARHRASGAV
FBID_STRAW        AELARVLEAAVEFP--RAFLPDAAAIGTTLLAAAP---GRELLPAFGTDSRARHRASGAV
FBID_STRSW        GELTRVLGAAAAFP--RAFLADAAGTGTTLLAAAP---GHGLSPAFGPGSRTRHRRSGAV
V6KNN3_STRRC      AELAVVLGAAAEFS--RAFLADAAQLGTTLLAAGP---DGELRPEFGVDSRSRHRTSGAR
FBID_THECD        AELGRALAAAAGFA--ESFVADAQGVGTTLYAVRP---GVPFSPAFGPGSRARHAAQGAR
FBID_STRRD        AELALVLTAAAEFE--QAFLPDAADVGTTFYGVRP---GVPFTPGFGGESRDRHLRRGAK
FBID_SALAI        AELAAALSAARTGPTSRRYLPDAPGTGTVLLAAPP---GVPLNPRFGGSSAAAHAASGAL
FBID_GEOOG        EELTAALAAAEAAP--RCFVPDAQGTGTTLLTAA----GTDLSPAFGTGSAQRHAAGGAV
FBID_FRACC        PELHQALSEASQHR--RAVLADATGTGTVLLTASA---GATLQPAFGPHSHATHRRSGAV
E3IZY0_FRAIE      GELRAALLAAPAAG--RAVLADAAGTGTVLLCAAP---GSPLLPHFGVGSHARHVRSGAF
A1SF03_NOCSJ      AELGRCLAEAARFR--RAFLPDRDGTGTTVLTAG----AGDLRPAYGAGSASRHAATGAV
COFC_METPS        KNVRDMLA-----SPADVVISPGRGGGTNVQFIKEP---QKYHVDYYGASFLDHMRIAGD
COFC_METAR        KNVRDMLA-----SPADIVICPGRGGGTNVQLIRRP---DKYHVDYYGASFMDHMRIAQE
COFC_METMA        EHIKEISS-----TEKDVCIVPGKGGGTNALFIKNP---SKYRVKYYGSSFLTHCSIATD
COFC_METAC        AHIKGISS-----TEKDVCIVPGKGGGTNALFIKNP---SRYRVKYYGSSFLTHCSIATD
COFC_METBF        DHVKGITS-----TKEDVCIVPGKGGGTNALFIKNP---SCYRVRYYGSSFLTHCSIAEK
COFC_METBU        DHIRKIIS-----FSEDVVIVPGKGGGTNILFIRHP---NEFTVKYHDCSFISHCEITDE
COFC_METMS        SHIEDIVA-----GKADVTIVPGKGGGTNILFIRKP---ENFRVKYYGSSFESHCMIAAQ
COFC_METB6        PAIKRVAS-----TTSDIGIVPGRGGGTNAIFVREP---AKFHVDYYGMSFLKHIRIAQE
COFC_METPE        EAITAVIS-----ADADVAIVPGRGGGTNAIYLQQG---SSFATDYYGQSFMKHCRIAEE
COFC_METMJ        GDIQRLIR-----TEKDMSIVPGRGGGTNIIFLKKP---RCFRADYYGASFLDHMRIAEE
COFC_METLZ        GSLQRVIS-----TKADMAIVPGLGGGTNVIFVKKP---EKFHVEYYGFSFRRHLQIAEE
COFC_METHJ        SAILTLLT-----SGGDLAIAPGRGGGTNAIYVRSA---KMFQAQYYGMSYEKHVRYGTD
COFC_ARCFU        EVLKRFFE-----TEGDVVVAPGRKGGTNMLLVRK----RGFRVSYHFGSFFKHLEMARK
COFC_FERPA        KIVKKFLD-----TDGDVVIAPGRKGGTNMLLSRS----REFYTSYHYGSFLKHVRIAEK
COFC_ARCPA        RILRRFFE-----SEGDVVIAPGRKGGTNMIIIRD----RKFKVRYYYCSFLRHLEFAKS
COFC_NATMM        AALSTLFASG---AADGVAIAPGRGGGTNALVVRH----PDFRVDYHGASYLDHREHAAE
COFC_HALTV        DALEALFS-----AAADVAVVPGRGAGTNALVVDH----PEFRVDYHGASYLDHREIAHD
COFC_HALLT        NALRELFAAG---REAEVAIAPGRGGGTNAFVAGH----PAFRVDYHGASYLDHRRIADE
COFC_HALMD        DALDRLFA-----AEGDVVLAPGRGGGTNAFVARH----PDFRVDYHDASIRDHRRIARD
COFC_HALUD        DALDRLFR-----AGGEVVLAPGRGGGTNAFVARH----HDFRVDYHDASITDHRSIAEE
COFC_HALVD        AALSRLFE-----TDADVVAAPGLGGGTNALVVRH----PEFSVDYHGASILDHRRIARD
COFC_NATPD        AALRRLFA-----TTGDVVIAPGLGGGTNALVVRA----DGFTVDYHGTSVRDHRRAAEG
COFC_HALMA        ESIERLLA-----PEADVVLAPGLGGGTNAFVCRH----PEFRVDYHGASIRDHRETARD
COFC_HALS3        DAIRRVFA-----ASGDVVLAPGSGGGTNVVLART----ADVPVSYHGVSFRDHVTAAER
COFC_HALSA        DAIRRVFA-----ASGDVVLAPGSGGGTNVVLART----ADVPVSYHGVSFRDHVTAAER
COFC_METTP        EDVLEMIR-----TPGGVVLAPGRGGGTNMILIRD----SRFRTRYKGLSFAKHKREAEE
FBID2_RHOJR       GDIDNFLSAA--SRFPRAFVADSAGTGTTCLTTQQ----AAILSAFGRNSAQRHTRMGYK
FBID_PHEZH        QDVDAALLLL--RTHDLVLALASRDGGTGLLAVRA---GVPFTPQFGAQSCARHRRQARA
FBID_OLICO        SDIVALISAAERSR--VALAPACDDGGTNALACDVV---GRIPLCFGPGSFARHIAAANA
COFC_METKA        EDVERALEGL---KDADVVLCPSRRGGTSGVFVRKG---VRFRPTFGGVSFPRNLRRAEK
FBID_COLP3        REFERLLMIY--RPVPSVLLCPAFDLGTNALLTTPP---NAIPFLYGIDSSLAHQRVAQE
FBID_MYCRK        AAIDMLSRAP---VDAIGMAPNRDGHGTNGLICRP----GAIPLFFSGPSFSAHQNAARC
E6N7L0_CALS0      TDLKTIYEI----GCEYVVCPDKKLRGTNIIYVNKW---DGYQPCFGVNSFMKHLRLHIC
A9A392_NITMS      QDIDFMLNYK-MHPNFAIIVPSRRFDGTNALVRMPI---DLMETHYDEDSYKIHMSTAKE
                    .                       **                 :   *          

COFC_METJA        RNLRYYIYDSFLISVDINTPEDLGEIFIHGNDTY-------TKNYLKSLGIDVEPKHSSA
COFC_METFA        RNLRYYIYDSFLISVDINTPEDLGEIFIHGDNTY-------TKNYLKGLGIEVEPKHSSA
COFC_METSF        KNLRYYIYDSFLISVDINTPEDLGEIFIHGDSTY-------TKNYLKGLGIEVESKHSSA
COFC_METVM        KNLKYYIYDSFLVSVDINTPEDLGEIFIHGEKTH-------TKEYLKSLGIYVEPKHSSA
COFC_METIM        NKVSYYIYDSFYLSIDINTPEDLGEIFIHGDGSY-------TKRYLESLNIKVEPKHSSA
COFC_METM7        NNLKVIKCHSFYTSIDVNTVEDLGEIYIHGTDTK-------TYQYLKNLGIEVLPKHSSA
COFC_METM6        NNLKVIKCHSFYTSIDVNTVEDLGEIYIHGTDTK-------TYQFLKNLGIEVLPKHSSA
COFC_METM5        NDLKVIKCHSFYTSIDVNTVEDLGEIYIHGTDTK-------TYQYLKHLGVEVLPKHSSA
COFC_METMP        NDLKVIKCHSFYTSIDVNTVEDLGEIYIHGTDTK-------TYAYLKSLGVDVLPKHSSA
COFC_METVS        NNLNIIKCHSFYTSIDINTVEDLGEIFIHGKDTK-------TYKFLKNLNIEAFPKHSSA
COFC_META3        NNINPIIFPSFYISIDINTVEDLGEILIHGGGTY-------TYNYLKKLNINAKPKHSSA
COFC_METRM        KKLVPIVHDSFYMALDVNTTEDLGEIMLHGNGTE-------TKKYLESLGIKVESSHDHE
COFC_METS3        KNLNPQVHDSLFMALDVNTTEDLGEIIVHGENTE-------TRRYLKELKINVESVHGSE
COFC_METTH        RGLSVSVYDSFYLSLDVNTAEDLGEIILHGEGTH-------AREYLRKLRFTVKPSRGSD
COFC_METST        NNLDVNIYDSFYLSLDVNTPEDLGEILLHGRNTH-------TYNYLSNLNIGVESNHGKE
FBID_CONWI        AGLAVEIAEIPSVALDVDTPDDLDALRELIASRR-------GGAAHTRGMLNQLLRTNPK
FBID_RUBXD        RGVRVRVCERPNVAFDLDSPEDLARLEASGGVQY-------RPRRA--------------
FBID_THET1        LGVQFLVYQSQNTALDLDYPQDILDLAALRGHKI-------SGLEEILDPGVLAQISQVT
FBID_CHLAA        LGLRASLISTPTLAFDLDDGERLQQYYRCIASCD-------NFAR---------------
FBID_CHLSY        LGLRASLISTPTLAFDLDDGERLQQYYRCIASCD-------NFAR---------------
FBID_CHLAD        LGLRARLLTTPTLAFDLDDSERLRQYCAAERPA---------------------------
FBID_SPHTD        RGLPLRELRVQGLAFDIDTPADLEELAGHAPVGA-------SSDESGT------------
FBID_THERP        ARCTIRELWSRALVLDLDTPEDLA-LVHRVREGE-------R------------------
F6FU04_ISOV2      LGLRAVVVHRPGTAADLDTIDDWTELPPAVRARV-------RTAVGHRLP----------
A5V3B5_SPHWW      AKLEAVVIERPGLAGDIDTPADLAEWRRR-------------------------------
FBID_ROSCS        RGWTVHVVRLPHLERDIDEVDDLVWLAQQPGHTA-------AQRLAREFLMRKGARIW--
FBID_ROSS1        RHLPVHLLRLPHLERDIDDIDDLIWLAQQPGDTS-------AQRLARMFLERKGAQLWQS
FBID_RHOOB        PLD----GHWPGLRTDVDTADDLDAAQALGVGPA-------TRAALDALEHSAPSHCGNE
FBID1_RHOJR       PLD----GHWPGLRTDVDTADDLDAAQALGVGPA-------TRAALDALEHTDPSRCGNE
FBID_RHOE4        PLN----GQWPGLRTDVDTHADLDTVRALGVGPA-------TLASLTRLKAT-PSNSR--
FBID_NOCFA        DLP----GEWPGLRRDVDTAADLERAVELGAGSS-------TRALLRDIGWSCRVHEPAR
FBID_MYCSK        ELT----GSWPGLRYDIDTPDDLLAARRLGVGTQ-------TARAVGAER----------
FBID_MYCSS        ELT----GSWPGLRYDIDTPDDLLAARRLGVGTQ-------TARAVGAER----------
FBID_MYCSJ        ELT----GSWPGLRYDIDTPDDLLAARRLGVGTQ-------TARAVGAER----------
FBID_MYCS2        ELT----GAWPGLRCDIDTAEDLRTARRLGVGPA-------TAQAIAAHR----------
FBID_MYCGI        ELT----GDWPGLRSDIDTPEDLVAACELGVGPA-------TSQAISAA-----------
FBID_MYCVP        ELT----GDWPGLRSDIDTPDDVLALNDLGVGPA-------TARAIARAQ----------
FBID_MYCBO        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCBP        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCTU        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCBT        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCTA        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCTF        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCTK        ELT----GAWPGLRCDVDTPADLTAARQLGVGPA-------TARAVAHR-----------
FBID_MYCMM        ELT----GAWPGLRCDVDTPADLAAARSLGVGPA-------TARVVAHHR----------
FBID_MYCUA        ELT----GAWPGLRCDVDTPADLAAARSLGVGPA-------TARVVAHHR----------
FBID_MYCLB        ELT----GPWPGLRCDVDTPADLAAARRLGIGAA-------TTRVVAHL-----------
FBID_MYCLE        ELT----GPWPGLRCDVDTPADLAAARRLGIGAA-------TTRVVAHL-----------
FBID_MYCPA        ELT----GAWPGLRCDVDTPTDLAAARRLGVGAA-------TARAIAAH-----------
FBID_MYCA9        ELT----GDWPGLRCDVDTPEDLAVARELGAALP-------L------------------
FBID_STRCO        ELR---LDAVDSVRQDVDTGGDLRSALALGVGPR-------TAAVAAR------------
FBID_STRAW        ELG---LGGVNSVRQDVDTGADLRAALALGVGPR-------TAAAAAR------------
FBID_STRSW        ELD---LTAVDSVRQDVDTGDDLRAALGLGVGPR-------TAAAAAR------------
V6KNN3_STRRC      ELE---LAGVDSVRQDVDTGDDLRAALALGVGPY-------TAATSAG------------
FBID_THECD        ELA---IEGLDSLRRDVDTPGDLRAALALGTGPR-------TAALAAR------------
FBID_STRRD        EIC---LDGIDSVRRDVDTPDDLRAALALGLGPR-------TLAMVER------------
FBID_SALAI        AL----LGDWPSLRRDVDTATDLAEAARLGLGPR-------TALLCGT------------
FBID_GEOOG        AL----TGAWPGLERDVDTPGDLRGALALGVGPH-------TAALLGG------------
FBID_FRACC        DLTGTLGGSVPGLRRDVDTLADLAQARDLGVGRA-------TRAALTAGYHSPLVAEDSG
E3IZY0_FRAIE      DLTGPLAAAVPGLRRDVDTVADLAAARLLGVGPA-------TRAVLAS------------
A1SF03_NOCSJ      SLD---VAGVDTVRADVDDLDSLAAVLDGRCGRH-------TRAAAAR------------
COFC_METPS        SGLTAEVFDSFNASSDIDEAQDLVELHIHGKGR--------AAEYLRTF-MALDVSK-GR
COFC_METAR        NGLTTEVFDSFNVSSDIDEAGDLIELYIHGKGD--------AAKYLRSI-TVLDDSK-GR
COFC_METMA        SGQDFEIYDSFMAGTDIDEPEDLVELLIHGKGA--------AKDYIESK-FRLEVKK-GR
COFC_METAC        TGQNFEIYDSFLAGTDIDEPEDLVELLIHGKGP--------AKEYISRK-FRLEVSR-GR
COFC_METBF        TGQSVEVYDSFFAGTDIDEPEDLVELLIHGSGA--------AKEYISKK-FRLEMSR-GR
COFC_METBU        LDKSMHIFDSFLASTDIDEPHDIVELMLHGKGQ--------AKEYAEKR-FGSETGK-GR
COFC_METMS        QNLSIRVYDSFLASTDIDEPQDITELILHGHGI--------AKDYAEKR-FGKKEGK-GR
COFC_METB6        AGLSCEVIDSFLLHTDIDEEDDLVELLTHGSGK--------SRKYLEDLGFVLSAEN-GR
COFC_METPE        RNLSLEVIDSFRLYVDIDEEEDLVDLLIHGTGE--------SAALLRSFGFQPISMK-GR
COFC_METMJ        CGFSVEVIDSFRMSTDIDEKEDLVEILIHGKGRR-------SREYLENSGFSIALDEKGR
COFC_METLZ        LELTVEIIDSMRMSTDVDEPADLVELMIHGHGN--------AREWLYEHGFSLSVED-GR
COFC_METHJ        AGLMVKIIDSFRLYCDIDEQDDLIEVFIHNTGY--------SREWLISHGFEIAMKK-SR
COFC_ARCFU        MGMKAKIFDSFYSSVDIDDESDLLELMMHGSGKK-------SYEFLRKIGFSVSF-EETP
COFC_FERPA        LGLNLSIFDSFYASIDIDDESDLLELMLHGKGKR-------SYEYLESIGFYVDFSEKEP
COFC_ARCPA        LDLKCTVFDSFYASVDIDTPDDLLELMIHGEGKK-------SYEFLYSIGFRIKY-EKEP
COFC_NATMM        IGAPLESVDSFRLGTDVDEPADLVEVLIHGRETAADGGESRTATRLRELGFELETTD-GR
COFC_HALTV        VGATLETVDSFRLGTDIDEPADLVEVLVHGTET------DRAPARLREFGFELERTD-GR
COFC_HALLT        IGAGVRVVDSHRLATDVDEPADLAELLIHAEAD---GDGGRAARWLRDAGFALDTTD-GR
COFC_HALMD        AGGTVTEIDSYRLSTDVDEPADLAEVLLHGEGR--------AADWLRGAGVQLTVAD-GR
COFC_HALUD        IGADTVEVDSFRLASDVDEPDDLAEVLLHGEGR--------AAAWLREHGFDLSMDE-GR
COFC_HALVD        AGCSFAEVDSMRLAVDVDEPSDLVEVLVHGEGR--------AREWLVDAGVRLARGS-GR
COFC_NATPD        AGIDARSVDSFRLAVDIDEPTDLAEVLLHGDGR--------SADWLKNAGFRLAETD-GR
COFC_HALMA        VGASVTEVDSRRLATDIDEPDDLAEVLLHSDGA--------AADWLKQSGFELTATG-GR
COFC_HALS3        AGLTVTTVDSFRLAADVDDASDLVDVFVHNTRR--------TREWLIAGGWRLAVDD-GT
COFC_HALSA        AGLTVTTVDSFRLAADVDDASDLVDVFVHNTRR--------TREWLIAGGWRLAVDD-GT
COFC_METTP        LGIEAGYCYSYRAGCDIDEPGDLIEILLHTNGE--------SRALLERFGLRILESD-GR
FBID2_RHOJR       QIP----LGLPSLRLDVDTIDDLERAARMGVGRH-------TQRLLISNNELHSLRFPCA
FBID_PHEZH        RGLSCALVEAGSLALDLDRPEDAVEVARGPCGRR-------TAEVLSDLKSRWRAQ----
FBID_OLICO        ADVRPAVLLNQRLGLDLDEPHHLMQFLDRGTSTQ-------TDAYLRVLRLKERKGHSFV
COFC_METKA        QGVEVAVVKSLGFFADVDEPEDLLDAALLGRRE--------VAKIARSVVEV--------
FBID_COLP3        RDIVCQVIKLPALALDIDTPDDLELLALLSSPVT---------QELNKLCKTA-------
FBID_MYCRK        AGIDVWIVRSREWALDVDLPADLEEFESSIKDAK--------RRVLCQI-----------
E6N7L0_CALS0      PKI----YYGLGTALDIDEPSDLSLLALLSSSSP-------RKDKQRGYKD---------
A9A392_NITMS      HTLNVAMVFVKRIMWDVDNAEDLKFLLEQKEKPH-------VAEKIKQILESP-------
                                 *::                                          

COFC_METJA        GRFVVKRR----------------------------------
COFC_METFA        GRFVVKRR----------------------------------
COFC_METSF        GRFVVKRGGDNEVSNPM-------------------------
COFC_METVM        GRFVVKRRD---------------------------------
COFC_METIM        GRFKIYRE----------------------------------
COFC_METM7        GRFNVIRK----------------------------------
COFC_METM6        GRFNVIRK----------------------------------
COFC_METM5        GRFNVIRK----------------------------------
COFC_METMP        GRFNVIRK----------------------------------
COFC_METVS        GRFNIIRKSQ--------------------------------
COFC_META3        GRFEVIRQNTE-------------------------------
COFC_METRM        -RLKVTRD----------------------------------
COFC_METS3        -RLKVTRGS---------------------------------
COFC_METTH        -RLEVSRSP---------------------------------
COFC_METST        -RLYVYRKNE--------------------------------
FBID_CONWI        N-----------------------------------------
FBID_RUBXD        ------------------------------------------
FBID_THET1        SMSGAKMGA---------------------------------
FBID_CHLAA        ------------------------------------------
FBID_CHLSY        ------------------------------------------
FBID_CHLAD        ------------------------------------------
FBID_SPHTD        ------------------------------------------
FBID_THERP        ------------------------------------------
F6FU04_ISOV2      ------------------------------------------
A5V3B5_SPHWW      ------------------------------------------
FBID_ROSCS        ------------------------------------------
FBID_ROSS1        SDMPPH------------------------------------
FBID_RHOOB        ------------------------------------------
FBID1_RHOJR       ------------------------------------------
FBID_RHOE4        ------------------------------------------
FBID_NOCFA        RVC---------------------------------------
FBID_MYCSK        ------------------------------------------
FBID_MYCSS        ------------------------------------------
FBID_MYCSJ        ------------------------------------------
FBID_MYCS2        ------------------------------------------
FBID_MYCGI        ------------------------------------------
FBID_MYCVP        ------------------------------------------
FBID_MYCBO        ------------------------------------------
FBID_MYCBP        ------------------------------------------
FBID_MYCTU        ------------------------------------------
FBID_MYCBT        ------------------------------------------
FBID_MYCTA        ------------------------------------------
FBID_MYCTF        ------------------------------------------
FBID_MYCTK        ------------------------------------------
FBID_MYCMM        ------------------------------------------
FBID_MYCUA        ------------------------------------------
FBID_MYCLB        ------------------------------------------
FBID_MYCLE        ------------------------------------------
FBID_MYCPA        ------------------------------------------
FBID_MYCA9        ------------------------------------------
FBID_STRCO        -------LLIAGQ-----------------------------
FBID_STRAW        -------LLIPGPQGDR-------------------------
FBID_STRSW        -------LLIPGQ-----------------------------
V6KNN3_STRRC      -------LLIPGP-----------------------------
FBID_THECD        -------MPAFSPGAETSRG----------------------
FBID_STRRD        -------IRGGFPSP---------------------------
FBID_SALAI        -------AAPTAGRSV--------------------------
FBID_GEOOG        -------AARPTG-----------------------------
FBID_FRACC        GSGGESGTSAESGLSVPPGIVGGTQRRIVSDASGPGRAKKYP
E3IZY0_FRAIE      -------TAANAG-----------------------------
A1SF03_NOCSJ      --------LGPALEAVG-------------------------
COFC_METPS        VKVMRDVQKVPEGRHPGRSVATQ-------------------
COFC_METAR        VRVVKEESNLRAVRIPGKMTG---------------------
COFC_METMA        VGLVPL------------------------------------
COFC_METAC        VGLVLL------------------------------------
COFC_METBF        VGLVHI------------------------------------
COFC_METBU        VKISHLSKLSGFV-----------------------------
COFC_METMS        VKISPFNEIPMY------------------------------
COFC_METB6        VGVKRPVQPAPAT-----------------------------
COFC_METPE        VSVIRSSP----------------------------------
COFC_METMJ        VGVQRDPHEEAL------------------------------
COFC_METLZ        VKVHRDGKEVV-------------------------------
COFC_METHJ        IGVKRPGYE---------------------------------
COFC_ARCFU        RLERRVFMQP--------------------------------
COFC_FERPA        KLKRA-------------------------------------
COFC_ARCPA        KLVRISNTFP--------------------------------
COFC_NATMM        VTVAR-DRS---------------------------------
COFC_HALTV        VTVARLEESRPK------------------------------
COFC_HALLT        VGVRRE------------------------------------
COFC_HALMD        TTVERP------------------------------------
COFC_HALUD        VSVQR-------------------------------------
COFC_HALVD        VEAVRERR----------------------------------
COFC_NATPD        TTVERRG-----------------------------------
COFC_HALMA        VDVERFR-----------------------------------
COFC_HALS3        PTVVREPND---------------------------------
COFC_HALSA        PTVVREPND---------------------------------
COFC_METTP        GRLDQTQSNE--------------------------------
FBID2_RHOJR       PG----------------------------------------
FBID_PHEZH        ------------------------------------------
FBID_OLICO        VAAQQATGARRLAV----------------------------
COFC_METKA        ------------------------------------------
FBID_COLP3        ------------------------------------------
FBID_MYCRK        ------------------------------------------
E6N7L0_CALS0      ------------------------------------------
A9A392_NITMS      ------------------------------------------