CLUSTAL format seed alignment for MF_02117

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COWN_RHOS5      -----------------MNDHTPDR------------YVTFLGIDCDAKADRMMEMLSAR
COWN_RHOSK      -----------------MNDQTPDR------------YVTFLGLDCDAKADRLMDMLAVR
COWN_RHOCB      -----------------MNDQTPDR------------YVTFMGIACDTNADRLCEMLAAR
COWN_ALLVD      ---------------MSQAAVKIDR------------YITFEGIECDEQARRVLDCIRDC
COWN_AZOVD      --------------MSTTTYRSICG------------EESLPYIDCDRCIRALYARLQHY
COWN_HALHL      --------------MATADHEATG-------------------LDCDHAIRRLLRRIDAH
COWN_RHORT      ---------------MTMDGPAHMP----------RRYVTFQGVNVEGLSQQLIARILFH
COWN_AZOS1      -----------------MD-SFDAP----------DRYVSFKGIDCEGNSRRIIDRLHMH
COWN_AZOC5      ----MRASPTPWLSRAEPYCQRESPMNLLTTTPAGDRYVTFNGIDFEGNMARVLAHLRRY
COWN_XANP2      -------MDQPAAGFPALHFELEQP----------DRYLTFQGIDFEGNMRRVLAHLYRY
COWN_MAGSA      -----------------MTATTQAD-----------RYISFSGIDCDGNAKIVLERVVAL
COWN_MAGMM      -----------------MNTPAARP----------DRYQSFAHIPCDAMALKLLTHLEQL
COWN_ARCNC      --------MSNFE----IRVNES--------------YESFKNIDCFENACVVIDNMLRV
COWN_DENA2      --------MCNCKKN--IKVDES--------------YVSFKDIDCFENACLVIDNLLRI
COWN_WOLSU      --------MSSIFINKGVEMMESEK------SGGMDRYVTFERIDCFKNAHEVVSNALRV
COWN_GEOLS      ---------------------MSK----------PDRYVSFVGIDGDSNARKLVALLRRH
COWN_PELPD      ------------------MQKMTE----------TDRYVTFKGIDGDGNARRLVAMLRRH
COWN_AZOSB      MNAPDPRDQLARPLNNPFAEALDK----------PDRYVSFCGIDCDGNARILMQHIRRH
COWN_DECAR      ---------------MPQDCACRK----------TDRYVSFQDIDCTGNARRLMEHLDRQ
COWN_TOLAT      ---------------MPCSCKQKKATP---SDITTDRYITFDGIDCDGNARILMSYIHKH
COWN_BEII9      -----------------MTAQVDR-------------YVSFKGIDWVGRSREIFARLQSH
COWN_GLUDA      -----------------MTEQIDR-------------YVSFRNVEWERRTAEVFALLQPH
COWN_METSB      ------------------MGKYDR-------------YISFKNANWESQSSGVMDGLKPH
COWN_RHOP2      -----------------MSGSFDR-------------YVSFKNSNWEVRSERVMARLQKH
COWN_RHOPS      -----------------MSGSFDR-------------YVSFKNCDWKVRSERVMARLQRH
COWN_RHOPA      -----------------MSASFDR-------------YVSFQHCDWEGRSERVMQRLQRH
COWN_RHOPT      -----------------MSASFDR-------------YVSFQHCDWEGRSERVMQRLQRH
COWN_RHOP5      -----------------MTAAFDR-------------YVSFKNADWEGKSQRVMERLQIH
COWN_RHOPB      -----------------MNVPFDR-------------YVSFKNADWEGKSQRVMAKLQSH
COWN_RHOVT      -----------------MSEQIDR-------------YVSFKNIDCNARAGQMMDALQPY
                                                                    :       

COWN_RHOS5      LA-STD--SPWVRYFEQKLAEKARMA-------TDNLHFVGSQINSLYSFFEEAEDEEGL
COWN_RHOSK      IQ-EDD--SRWVGYFRQKLAEKERMA-------TDNLHFVGSQINSLYSYFEELEDADAL
COWN_RHOCB      MA-GND--SRWVAYFEKKLAENAQMG-------HDRLRFIGAQVNALMSFFEEEDDEAAL
COWN_ALLVD      IE-APEA-SSWSAYFERKLDEITRMG-------QDELFVVGSQVNYIRALFEHHGHREGL
COWN_AZOVD      VQ-QDRGDCPICAYFREKIGSRDGSE-------SDARLLLHAQVNVVYELFARHADQEAL
COWN_HALHL      IA-DEPRDSPVRRYLERELGGREGTE-------ADTRLVVHAQINVVRELFERRSDADGL
COWN_RHORT      VA-DPAKSNAFWEHFKAKLADADKTLART----ADSLCLLCGAIGYIDELFEDNDDEEGL
COWN_AZOS1      ID-DPAKTNAFWERFRAKLAIAEDPLKRQ----ADGLCLLCANIYYIADLFEEHDDEDGL
COWN_AZOC5      ID-DPRTGNAFWDRFKARLAAAESGGNAF----QDKLLLLHSHVYYMGDLFEDQEDEAAL
COWN_XANP2      ID-DPAHGNAFWDRFKARLQAAEAGAATI----CDKLLLLHSHVYYMVDLFEEQEDEIAL
COWN_MAGSA      VA-LPEYANCFWDRFLIRLAEADKVGARK----ADELCLACSNTYYIEELFEAAGDEMGL
COWN_MAGMM      LQ-AEDTLEPFWQLFLQKAAIAKQPQPGQ----ADALKLICSNSYYIFDLFAAQQDQAGE
COWN_ARCNC      LE-NPKNMNIYWKKIVPMIPKAYYDRDPKSDTKEELLYLVCSNSFYLDELFEKAEDEQAI
COWN_DENA2      LK-EPKNTNAYWEKFIEKIPEAYYTRDSKKDPSEALLYLVCSCTSNIMELFEEIDDEEAI
COWN_WOLSU      LEANPEMKNPFWEKFCSKIPDSFYSYTPQ----EDLLYLVCANVFYLEELFDEAEDEEGQ
COWN_GEOLS      ID-DPARTNRFWELFKDKLEKINKPDETSG-FSQDELYLVHAYINNIRELFETYDDQPAL
COWN_PELPD      ID-DPAKTNLFWEKFKEKLELAESPDTNNT-RRLDELFLIHSYINNIYDLLEEHGDQEAL
COWN_AZOSB      ID-DPTKGNAFWDKFRDKLEGRSSE-------RCDELFLVHSYINMIRELFETYEDDDAL
COWN_DECAR      LS-IPGRSTAFWEYFAKKRAGSAAA-------KPDDLFLIHSNINQFREFFEQWNDSDAL
COWN_TOLAT      ID-DPQKTNKFWDYFRKKAEGGNGP-------KPDDLFLIHSNLNQIRELFELYEDSEAL
COWN_BEII9      ID---QANSPFWPYFTRQR-KLAHSQ------GLDDLRVLHNYLPTLRELLENMGDLKTL
COWN_GLUDA      FD---GSTSPFWDYFLRQR-VIAHAQ------GLDDLRVLHNFLPTLKDLLEELDDERTL
COWN_METSB      IE---AADSPFWVYFMRQR-ELAHQR------GLDDLRVLHNFLPTLRELLEELDDQPTL
COWN_RHOP2      ID---AAENPFWAYFAQKRIELREKQ------GLDDLRVLHNYLPTLRELLEDNGDLETL
COWN_RHOPS      ID---AAENPFWAYFAQKRTELREKQ------GLDDLRVLHNYLPTLRELLEDNGDLETL
COWN_RHOPA      VE---AAENPFWAYFAQKRAELRDKQ------GLDDLRILHNYLPTLRELLEDNGDLETL
COWN_RHOPT      VE---AAENPFWAYFAQKRAELRDKQ------GLDDLRILHNYLPTLRELLEDNGDLETL
COWN_RHOP5      ID---AAQNPFWAYFAQKRTELNQKQ------GLDDLRVLHNYLPTLREILEDNGDQETL
COWN_RHOPB      ID---AADNPFWGYFAKKRTELNEKQ------GLDDLRVLHNYLPTLREILEESGDDETL
COWN_RHOVT      IQ---AAENPFWAYFQQKRAEFNAK-------GYDDLRVLHNYLPTLKELIE---DDELL
                .             :                       .       .   :    .    

COWN_RHOS5      DLLWHLEHNCC
COWN_RHOSK      DLLWHLEHNCC
COWN_RHOCB      ALLWHIEHHCL
COWN_ALLVD      DLLDRIEDECC
COWN_AZOVD      ALLERIEDDCC
COWN_HALHL      RLLSNIERECC
COWN_RHORT      TILRRLEDELC
COWN_AZOS1      AMLRQLEDECC
COWN_AZOC5      ADLRKLEEECF
COWN_XANP2      ADLKTLEEECF
COWN_MAGSA      AALRRLEDECC
COWN_MAGMM      AMMDELEYQCC
COWN_ARCNC      NALSKCEQECC
COWN_DENA2      DAMSKCEQECC
COWN_WOLSU      AIMSRCEFECC
COWN_GEOLS      ALLDRIEAESC
COWN_PELPD      TLLHQIEVESC
COWN_AZOSB      ALLQKIEEECC
COWN_DECAR      SLLLQIEEECC
COWN_TOLAT      ALLDVVEIECC
COWN_BEII9      GMLEELEQICM
COWN_GLUDA      SRLEELEVLCM
COWN_METSB      ALLEQLEESCM
COWN_RHOP2      AMLEELEVTLM
COWN_RHOPS      AMLEELEVNLM
COWN_RHOPA      EMLEDLEANLM
COWN_RHOPT      EMLEDLEANLM
COWN_RHOP5      AMLEDLEVTCM
COWN_RHOPB      AMLEDLEVTCM
COWN_RHOVT      AQLEDLEYTCM
                  :   *