CLUSTAL format seed alignment for MF_02118

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LIPM_BACSU      MQKETWRFIDSGNASPAFNMALDEALLYWHSEKKIPPVIRFYGWNPATLSVGYFQNIKKE
LIPM_BACVZ      MEKETWRFIDSGNESPAFNMALDEALLYWHSQKKIPPVIRFYGWNPATLSVGYFQNIKKE
LIPM_BACHD      --METWRFIDSGDRDPAYNMALDEALLNWHSEGLIPPTIRFYGWNPPTLSIGYFQKVQKE
LIPM_ANOFW      MEKEVWRFIDSGNCSPAFNMALDEALLEWHSEGKIPPTIRFYGWNPPTLSIGYFQKVEKE
LIPM_GEOKA      MAKEVWRFIDSGYCPPAFNMALDEALLDWHSEGKIPPTVRFYGWNPPTLSIGYFQKVEKE
LIPM_BACAN      MGKEKWCYINSGQCSPAFNMALDECLLNWQSEKKMPPTIRFYEWEVPTLTVGYFQRVEKD
LIPM_BACCR      MGKEKWCYINSGQCSPAFNMALDECLLNWQSEKKMPPTIRFYEWEVPTLTVGYFQRVEKD
LIPM_LYSSC      --MTTWYFLNSGKCSPSFNMALDEALLDWHSEGLIPPVIRFYEWEPATLSIGYFQQAKKD
LIPM_STAA8      -MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKE
LIPM_STAEQ      -MTEIWNFINTGSKNPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKE
LIPM_MACCJ      -MQEEWLFINTHKNNPYYNMAMDEALLNLVSQGALPPVIRFYGWAPKTLSIGYFQKLEKE
LIPM_BREBN      --MEQWRYIVTEAMSPAMNMAVDEAILQLHSEGKVPPTVRFYTWDPATLSIGYFQKAIKE
LIPM_EXIS2      -MIREWQVLTTERMEPALNMAIDEALIGFVGRGEVAPTLRFYSWEPRGLSVGHFQRATKD
LIPM_EXISA      MTGTTWHLLRTESTSPAENMAIDEAIANWVAKGELKPTLRFYSWAPHAISVGRFQRATRD
LIPM_KYRT2      --MQTWRLLHTGKGSAAFNMAVDEAVMIAHSRGEVPPTLRLYGWDPPTLSIGYFQRAGKE
LIPM_SYMTH      -METNWRLLDTGHRPGPENMAIDEAIAMAHGRGEVPPTLRFYGWNPPAVSIGYFQSMLGE
LIPM_MOOTA      MPAETWRLLDTGVSDPYTNMAIDEAILLEHREGKTPPTLRFYAWSPPTISLGYFQQLEKE
LIPM_CLOD6      --MNQWRVIHNKSYEGAMNMAIDEAIFTAYKKGHNKPTLRFYTWEPACLSIGYFQKLEDE
LIPM_OCEIH      -MREKWAFLENTPQDAAINMALDEALLHWHQKGEIPPTLRFYRWNKPTLSIGYFQKVDGK
LIPM_CARHZ      --METWRFIDHCSFSGAENMAIDEALLQEAINNHGAPVLRFYTWTRPTLSLGYFQKAQEE
                     *  :         ***:**.:     .    *.:*:* *    :::* **    .

LIPM_BACSU      INFEAVHKYNLGFVRRPTGGRGVLHDQELTYSVIVSEEHPEMPATVTEAYRVISEGILQG
LIPM_BACVZ      INFDAVHKHGLGFVRRPTGGRGVLHDKELTYSVIVSEDHPEMPATVTEAYRVISEGILQG
LIPM_BACHD      INMEMVEKHQLGFVRRPTGGRGVLHDKELTYSVIVTEEHPDMPASVTEAYRIISQGILEG
LIPM_ANOFW      IDMEAVKKYGLGFVRRPTGGRGVLHDQELTYSVIVSELHPAMPQTVTEAYRVISQGILEG
LIPM_GEOKA      IDLEAVKRHGLGFVRRPTGGRGVLHDKELTYSVIVSESHPAMPKTVTEAYRVISQGILEG
LIPM_BACAN      INMDVVNEKKYGFVRRQTGGRGVLHDKELTYSVIVSEDHPNMPKTVTEAYRVISQGLLDG
LIPM_BACCR      INMDVVNEKKYGFVRRQTGGRGVLHDKELTYSVIVSEDHPNMPKTVTEAYRVISQGLLDG
LIPM_LYSSC      INLDAVREQGLGFVRRPTGGRAVLHEHELTYSVIVTESYPDMPESVTEAYRVLSEGILQG
LIPM_STAA8      IDIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEG
LIPM_STAEQ      IDIDKVKEKGYGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYKIISQGLLEG
LIPM_MACCJ      IDLDKVNAGGYGLVRRATGGRGVLHDKELTYSVIVPESHPMMPESVTAAYKVISTGLLEG
LIPM_BREBN      INLEEVQNRGLGFVRRATGGRAVLHDQELTYSVIVSEDHPKMPSSVTEAYKIISLGLLHG
LIPM_EXIS2      IDRNRIEALGIPIVRRMTGGRAVLHADELTYSVILPEQMEGVPKTVIESYRMLTEGIRKG
LIPM_EXISA      LDRDALEANNIPVVRRLTGGRAVLHADELTYSVILPESTPALPTNIIESYRLLTEGVRRG
LIPM_KYRT2      VDFEALSARGYGFVRRPTGGRAVLHDREVTYSVVVSESYPGMPGSVTESYRVISEGLVRG
LIPM_SYMTH      VDLDAVRAGGYGYVRRPTGGRLIFHHMELTYSVVIREEL--LPGGVIETYREISRGLLAG
LIPM_MOOTA      IDLEAVKERGLGLVRRLTGGRAVLHDDEVTYSVVAREDHPLMIGGIRPSYLRLAKALAAG
LIPM_CLOD6      IDLDKCRCMNIDYTRRITGGRAVLHDNELTYSIIIGEDNPLIDKSINLSYRYISEGLVKG
LIPM_OCEIH      IDLQGIKKHQCQLVRRMTGGSAVLHDDELTYSIVISEKHEKVASSIRQAYFDLSKGIVRA
LIPM_CARHZ      VDFSECEKLGVEVVRRPTGGRAVLHEFELTYSIVGSIQHPKLSGTVLESYLKISKGLLLG
                :: .         .** ***  ::*  *:***::       :   :  :*  :: .:  .

LIPM_BACSU      FRNLGLDAYFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
LIPM_BACVZ      FRNLGLDANFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
LIPM_BACHD      FRDLGLDAYFAVPKTEEEKNALKNPRSAVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
LIPM_ANOFW      FRFLGLDAYFAVPKTEEEKADLKNPRSAVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQ
LIPM_GEOKA      FRYLGLDAYFAVPKTEEEKADLRSPRSAVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQ
LIPM_BACAN      FKALGLEAYYAVPKTEADRENLKNPRSGVCFDAPSWYEIVVEGRKIAGSAQTRQKGVILQ
LIPM_BACCR      FKALGLEAYYAVPKTEADRENLKNPRSGVCFDAPSWYEIVVEGRKIAGSAQTRQKGVILQ
LIPM_LYSSC      FHNLGMDAYFSVPDTEEKRADLKSPKSAVCFDAPSWYELVVEGKKIAGSAQTRQKGVILQ
LIPM_STAA8      FKNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQ
LIPM_STAEQ      FKNLGFETYFAIPRSKEERDKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQ
LIPM_MACCJ      FKNLGFQAEFSVPRTKEDRERLKDPRSSVCFDASSWYELVVEGKKIAGSAQTRQKGVILQ
LIPM_BREBN      FQNLGLSAEMVSLASEEEKEKYNSPGSSACFDSPSWYELVVEGKKVAGSAQTRQKGVILQ
LIPM_EXIS2      YHHLGIPVEFSVPMTEEEKEELRKPKSAVCFDAASYYELAVGKRKVAGSAQVRHQGVVLQ
LIPM_EXISA      YRELGVPAEFSVPLTEEDREALRKPKSAVCFDAASYYELAVDGKKIAGSAQVRHQGAVLQ
LIPM_KYRT2      LRKLGFDAHFARP-DEEGRQRLAAPSSAACFDSPSWYEVVVEGKKLVGSAQTRQRGVILQ
LIPM_SYMTH      MAELGVPAALSGG-DRDPRRADPDGFHTACFDTASAYELQVGGRKVAGSAQTRRDGVILQ
LIPM_MOOTA      LRELGAPVEIASG-RKGGRE---EHTTAACFDAPSWYEITCGGRKLVGSAQTRKGGVVLQ
LIPM_CLOD6      LNLSGIETDNLNRGERISRENL----SAACFNAHASYEVTINNKKVIGSAQSRKDGVLLQ
LIPM_OCEIH      YQLLGIEVDHAHEP---SSKGR----SNICFEQPAFYELVAKGKKISGNAQIRKRGILLQ
LIPM_CARHZ      LKNLGIEGEIAEG-------KKTSDLSAICFEAPSWYELTVMGRKVIGSAQVRRGDYLLQ
                    *                        **:  : **:    :*: *.** *: . :**

LIPM_BACSU      HGSILLDLDEDKLFDLFLYPSERVRERMQRNFKNKAVAINELIEKRVTMDEARKAFKEGF
LIPM_BACVZ      HGSILLDIDEDKLFDLFLYPSDRVRERMQRNFKNKAVAINALAPKRVTMDEARIAFKAGF
LIPM_BACHD      HGSIVLDIDEDKLFDLFNYPSERVRERMQRNFKNKAVPINELRDVPLSMEEVKKAFKDGF
LIPM_ANOFW      HGSILLHLDEDMLFSLFKYPNERVKERLRQNFKNKAVAINELTDRNITINEAKEAFFRGF
LIPM_GEOKA      HGSILLDLDEELLFSLFKYPNERVKERLQRDFKKKAVAINELTSRTVTIEEAKEAFYKGF
LIPM_BACAN      HGSIPLEIDLDELYDLFLFPNERVKERMKSMFASKAVAINELTDRTFTIEQLIKAFEVGF
LIPM_BACCR      HGSIPLEIDLDELYDLFLFPNERVKERMKSMFSSKAVAINELTDRTFTIEQLIKAFEVGF
LIPM_LYSSC      HGAILLDLDQEKLLSVFNFSSEEAKDRMRRKLPEKAVAINSLVDEPVTVEQCVTAFRDGF
LIPM_STAA8      HGSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGF
LIPM_STAEQ      HGSILQDIDIDDLFDMFKFKNERLKAKMKENFVQKAVAINDISNQHITLNEMENAFEAGF
LIPM_MACCJ      HGSILQSIDVDELFDLFIFSSERLKERMKRSFYSKAVSIADLTDEEITIAMMEEAFYEGF
LIPM_BREBN      HGSILLDMDVDLLFSLLHFPSERVKQRMIDSFRQKAVTINEVSSRPISLQESIEAFSKGF
LIPM_EXIS2      HGSVPLSVDEGELFDCFLYEDETMRERMKARFAGKAVALNELAGRSVSFEEVRLAFVKGF
LIPM_EXISA      HGSIPLSVDDEVLFDCFAM-DETEKQEAKTRFSEKAVALNDTLKRFVSFDEVAAAFETGF
LIPM_KYRT2      HGSILLDLDPEALFAVLRFPSDRVRDRLRRTFEEHAVSLRDLAGAPVSAERVEEALAEGF
LIPM_SYMTH      HGSILLDIDVPLLFRLMRLPEGIPAERLMARFRAKSTTLAEALGRPVSWAEARDAFAAGF
LIPM_MOOTA      HGSIVLTLNGDDLFAVLKMPSEAVRQRLLAKFYHQACGLEEVLGRRVEAGVIKENIVRAF
LIPM_CLOD6      HGSIILDFDVEKLFKLIKTKTPELKERAMKFTAKKASGIENEIGRKIDIDILQKNIVKGL
LIPM_OCEIH      HGSIPLSMNVEMLFDLFQFPADQMKERKKQRFYERATTINAELGEKQSYERVRNAFQQGF
LIPM_CARHZ      HGAIVIKMDVDKLFRVLKFKSLEQKERIRASFHRKAGAIHDFSSREFSLAEIKEAFLAGF
                **::   .:   *   :         .       ::  :                :  .:

LIPM_BACSU      ETGLNIHLEPYELSQEELDFVHHLAETKYASDEWNYKR---
LIPM_BACVZ      EEGLNIHLEPYTLTSEELAFVNELAETKYASDEWNYKR---
LIPM_BACHD      EKGLSIKLEPYTLTDAEEAEVKQIAKERYETDEWNFRK---
LIPM_ANOFW      EKGLNVQLERYELTDDELFYVQQLAKNKYETDEWNFKR---
LIPM_GEOKA      EKGLNIVLEPYTLTAEERAYVEELARAKYESDEWNFKR---
LIPM_BACAN      EKGLDVELVPYELTEEQLHEVQTLAKEKYESKEWNYKK---
LIPM_BACCR      EKGLDVELVPYELTEEQLHEVQTLAKEKYESNEWNYKK---
LIPM_LYSSC      AKSLQIELKPFTLSEEQLEYVRALEEKKYACDEWNFKK---
LIPM_STAA8      KKGLNIELKPLELTEAQLAEVEELTE-KYRSDEWMFRK---
LIPM_STAEQ      KKGLNIDFKPLELTEKQLEEVQELED-KYRSEAWMYRK---
LIPM_MACCJ      EKGLDIKLKPFEVTAEIEQEVSVLIE-KYRSEEWLKRR---
LIPM_BREBN      ASGLEVELTPSTLTDEELALAEELVRTRYATDEWNLRR---
LIPM_EXIS2      EDALQLTFRPLEFNS-TQWQEIERLAEKYRSEEWNWKR---
LIPM_EXISA      KDAFSLTFEPLVFTK-EQQAEIDLLVKKYESDEWVWKR---
LIPM_KYRT2      AEALGARLEPGELTA-EERETAEQLMAKYLADEWNYRK---
LIPM_SYMTH      ARALGLTLTPGQLTEREEKEAQTLVEAKYGCDNWNMRK---
LIPM_MOOTA      TRLYAVEFVPGGLTE-GEKGRLKELRAKYAAADWLKRR---
LIPM_CLOD6      AEQFNVEFVEGDLTDYEKQLVKELYEKYKNEEYNKKR----
LIPM_OCEIH      SEILNIELEPITLTEEQWKEVYQIAESNYSENNIKGAVSHV
LIPM_CARHZ      SEGFEVNFIRSELSLKERELSRQLLREKYNTREWLFRF---
                       :    ..