CLUSTAL format seed alignment for MF_02120

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E4UA83_OCEP5      ------------------------------------MPYEPPEDFM-------RALHDLL
DCDA_DEIRA        ------------------------------------MSLSR------------HALQDAA
DCDA_ECOLI        ----------------------------------MPHSLFSTDT-----DLTAENLLRLP
DCDA_ECOLW        ----------------------------------MPHSLFSTDT-----DLTAENLLRLP
DCDA_STRCO        --------------------------------MTSPSAPSSAERPRLPGALDGPRLAAAA
DCDA_BUCAI        ----------------------------------MPKPLNNTEN-----NLNTNRIKDLI
DCDA_BUCAP        ----------------------------------MPELLNKTKT-----NLNFENIKILI
DCDA_BUCBP        ----------------------------------MSGLLKK-KQ-----RFSCNDILKIV
Q97AJ0_THEVO      --------------------------------MENDNPFVWNGDDM---LVEGYSVKAIV
DCDA_THEAC        --------------------------------MGIYDIFD-DESAR---SISGMSIDEMA
DCDA_THEMA        ----------------------------------------------------MDILRKVA
DCDA_ARCFU        ----------------------------------------MFSTSDGILTVEGVKVTEIV
DCDA_METTH        ------------------------------------MFPDIEVNDKGHLLIGGADAVELA
DCDA_HELPY        ----------------------------------------------------MFNYEELF
DCDA_HELPJ        ----------------------------------------------------MFNYEELF
DCDA_CAMJE        -----------------------------------------------------MDYKQLK
DCDA_AQUAE        -------------------------------MELLKEYNPYLEYRDGELFIEGVSLKELA
DCDA_PSEAE        -------------------------------------MDTFSYR-DAELFAEGVALSRIA
DCDA_PSEFL        -------------------------------------MDAFNYR-GGELFAEGVALSAIA
DCDA_VIBCH        -------------------------------------MDYFNYQEDGQLWAEQVPLADLA
DCDA_HAEIN        -------------------------------------MNFFQYK-HNKLYAEDMPVQQLA
DCDA_NEIMA        ----------------------------------------------MTLFCEQVPYPRLA
DCDA_NEIMB        ----------------------------------------------MTLFCEQVPYPRLA
DCDA_ZYMMO        -------------------------------------MIPFSLK-NGTLCVEDIPLPEIA
DCDA_FRATH        ------------------------------------------MNKYIIFDNTKLLEYIGK
DCDA_BACTN        ------------------------------------------MKGIFPIDKFRTLQ----
DCDA_METJA        -------------------------------MKIMFLGNDTVEIKDGRFFIDGYDAIELA
DCDA_MYCTU        -------------------------MNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLA
DCDA_MYCBO        -------------------------MNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLA
DCDA_MYCLE        MNVHTAGPRHAEKTRHTATPQRVQPSDDLLRLASNVWPRNITRDETGVACIAGNKLTDLA
DCDA_MYCS2        MNAHPAGPRHAEELHHADVPDKPQSPDEIMLLAPNVWPRNLVRGADGVVTIAGVPVTDLA
DCDA_COREF        --------MTAETETGIPGVPGTQAADQFNELPAHVWPRNAVRQEDGVVTVAGVPLPDLA
DCDA_CORGL        ----------------------MATVENFNELPAHVWPRNAVRQEDGVVTVAGVPLPDLA
DCDA_ACTPA        --------------MTLAELLPSVGMTGEPALETGLWPLG-TRLERGELLLGGVPATELA
DCDA_BACMT        ----------------------------------MYFHGTTKVNEKGHLEIGGVDTIELA
DCDA_BACSU        ----------------------------------MFLHGTSRQNQHGHLEIGGVDALYLA
DCDA_BACHD        ----------------------------------MFFHGTSRVNGKGHLEIGGVDTVELA
DCDA_STAAC        --------------------------------------MTVKYNQNGELTMDGISLKTIA
DCDA_SYNY3        --------MLSTEMPLPTTGSTLLKTPASPSPNQNLLPLTAVINKNGELEIGGCSVPALV
Q8TY23_METKA      -------------------------------------------------MVESSTTSWRR
C7M3Q4_CAPOD      --------------------------------------------------MKINDLLNIA
Q24MH6_DESHY      -------------------------------------------MAVKNLPFNQEQLQKIM
C7P2F6_HALMD      -------------------------------------MSSDSPPVRRLADWDHDRLARLA
                                                                              

E4UA83_OCEP5      GRVPTPFYAYDLRRIEERTRRYLEA--F------PTARVFYALKANPRLRLLERLRSQGL
DCDA_DEIRA        QRFGTPLYLYDAEELDAALWRVQRA--F------GDARIFYAMKANPNLNLLRRYAAAGV
DCDA_ECOLI        AEFGCPVWVYDAQIIRRQIAALK-----------QFDVVRFAQKACSNIHILRLMREQGV
DCDA_ECOLW        AEFGCPVWVYDAQIIRRQIAALK-----------QFDVVRFAQKACSNIHILRLMREQGV
DCDA_STRCO        AEHGTPLWLYDAATIRAQIDRLR-----------RFDVIRYAQKACSNLHILRLMREEGV
DCDA_BUCAI        KKYSPPFWVYDADIIYKKINLLR-----------KFDVIRFAQKSCSNINILRLMKNKNV
DCDA_BUCAP        KKFQSPFWVYDSNIIHKKINLLK-----------EFDIVRFAQKACSNIHILRLMKQKNI
DCDA_BUCBP        SKYGTPLWVYDSNIIVKKIKELS-----------QFDVIRFAQKSCSNIHILNLFYKYNV
Q97AJ0_THEVO      ETFGTPVIIYSAPRIVKNVSSLFGA--MP-----KVTKCFYSVKANSNPNLVRLIGRQGC
DCDA_THEAC        KKYGTPVIIYSRARIVSNIRRIREA--YE-----NRVRMLYSVKANDNPRIIEIMHQESI
DCDA_THEMA        EIHGTPTYVYFEETLRKRSRLVKEV--FEG----VNLLPTFAVKANNNPVLLKILREEGF
DCDA_ARCFU        RETGTPVYVTSRALLERNLEAYKKAFSNE--------GLLYAVKANNNLALMRIIASHGF
DCDA_METTH        DEYGTPLYVIDEMRIRENYRRLYRAFSGEY----SRFQVFYACKANTNLAVMRILEEEGS
DCDA_HELPY        QTHKTPFYLYDFDKIKQAFLNYKEAFKGR------KSLICYALKANSNLSILSLLAHLES
DCDA_HELPJ        QTYKTPFYLYDFDKIKQAFLNYKEAFKGR------KSLICYALKANSNLSILSLLANLGS
DCDA_CAMJE        QEFNTPFYIYNFDFIKERFLNLKEAFKAR------KSQIFYAVKANSNLSLLQMLANLDS
DCDA_AQUAE        QTFGTPLYVYSSNFIKERFEAYRKAFP--------DALICYAVKANFNPHLVKLLGELGA
DCDA_PSEAE        ERFGTPTYVYSRAHIEAQYRAYADALAGM------PHLVCFAVKANSNLGVLNVLARLGA
DCDA_PSEFL        ERFGTPTYVYSRAHIEAQYRTFADALEGM------PHLVCFAVKANSNLGVLNVLARLGA
DCDA_VIBCH        NQYGTPLYVYSRATLERHWHAFDKSVGDY------PHLICYAVKANSNLGVLNTLARLGS
DCDA_HAEIN        EQFGTPLYVYSRATLERHWHAFDSAFGNR------PHLICFAVKSCSNIGVLNIMAKLGS
DCDA_NEIMA        EAFGTPLYVYSQSALTEAFEHYQTAFAEL------SPLVCYAVKANGNLSIIKHFASLGS
DCDA_NEIMB        EAFGTPLYVYSQSALTEAFEHYQTAFAAL------NPLVCYAVKANGNLSIIKHFASLGS
DCDA_ZYMMO        AQYGTPCYVYSHSYLTERARRFTKALDGAG---KGKSLVAFAVKANPSQAILASFAKEGL
DCDA_FRATH        NSLITPCYIYDLELLEDTFLNAKKSLDKN----FKNAEIHYAIKANHNPKIVGIAKKYGM
DCDA_BACTN        ----TPFYYYDTKVLRDTLSAINQEVAK-----YPSYSVHYAVKANANPKVLTIIRESGM
DCDA_METJA        EKFGTPLYVMSEEQIKINYNRYIEAFKRWEEETGKEFIVAYAYKANANLAITRLLAKLGC
DCDA_MYCTU        QEYGTPLFVIDEDDFRSRCRETAAAF-------GSGANVHYAAKAFLCSEVARWISEEGL
DCDA_MYCBO        QEYGTPLFVIDEDDFRSRCRETAAAF-------GSGANVHYAAKAFLCSEVARWISEEGL
DCDA_MYCLE        GEYGTPLFVIDEDDFRFRCREIAAAF-------GGGENVHYAAKAFLCTEIARWIDEEGL
DCDA_MYCS2        AKFGTPLFVIDEDDFRTRCRDIAAAF-------GGGQYVHYAAKAFLCSEIARWVDEEGL
DCDA_COREF        EEYGTPLFVVDEDDFRARCRDMASAF-------GGPDRVHYASKAFLSKTVARWVDEEGL
DCDA_CORGL        EEYGTPLFVVDEDDFRSRCRDMATAF-------GGPGNVHYASKAFLTKTIARWVDEEGL
DCDA_ACTPA        ARFGTPCQVLDEGTVRARARAFREAL-------PEAE-VVFAGKALPCREVYRWVADEGL
DCDA_BACMT        QKYGTPLYVYDVALIRERARGFKNTFDEL----GIKAQVAYASKAFSTVAMIQLAEEEGL
DCDA_BACSU        EKYGTPLYVYDVALIRERAKSFKQAFISA----GLKAQVAYASKAFSSVAMIQLAEEEGL
DCDA_BACHD        NLYGTPLFVYDVALIRERAKDFKQAFADE----GVQAQVAYASKAFSCIAMFQLAEELGL
DCDA_STAAC        QSFGTPTIVYDELQIREQMRRYHRAFKDS----GLKYNISYASKAFTCIQMVKLVAEEDL
DCDA_SYNY3        EQFGSPLYILDETTLRQAAQQYRQSFQAHY---PGSSQVIYASKAWSCLAVVAIAAQEGL
Q8TY23_METKA      PVRGHRCTSTTRMLPVKAAREYQEAFSWF----PDRVYVCYAMKANFNPYLVEHIVDETR
C7M3Q4_CAPOD      NTYGSPVYVYDAQKIASQYNRLTNAFASV-----PKLRINYAMKALSNISILKLMKDLGA
Q24MH6_DESHY      EDYGTPFHIYDEEAIRKNAQRLQAAFAWA-----PGFKEYFAVKALPNPYILKILGEEGF
C7P2F6_HALMD      EEHGTPLYVLDVDRVAANYRRFAAAF--------PDAHVMYAAKAHTGRAVLSGLLEAGA
                                                          :: *:     :         

E4UA83_OCEP5      GAEAVSLGEVVRAYVAGFM--------PDEVVLNGPVKPPEVLGELARSGVPTLVADSRA
DCDA_DEIRA        GFECVSLGELLRAEAAGAG--------GERMILNGPAKSDAEYAAAARLGATIVVDRE--
DCDA_ECOLI        KVDSVSLGEIERALAAGYNPQTH----PDDIVFTADVIDQATLERVSELQIPVNAGSVDM
DCDA_ECOLW        KVDSVSLGEIERALAAGYNPQTH----PDDIVFTADVIDQATLERVSELQIPVNAGSVDM
DCDA_STRCO        HVDAVSEGEIERALAAGYRVGGD----DEPIVFTADLLNRSTLRRVVELGIPVNAGSPQM
DCDA_BUCAI        KIDAVSLGEIERALLSGFKPSTN------EIIFTADILDEETLLKVAKYKIPVNAGSLDM
DCDA_BUCAP        KVDAVSLGEIERALVAGFKPNSN------EIIFTADLFDEETLSKVIDFKIPVNAGSIDM
DCDA_BUCBP        KIDAVSLGEIERALISKYRFTMD----Q-DVVFTSDIIERETLNKVVQYKIPINIGSIDM
Q97AJ0_THEVO      GSEVTSLGEIQIAMISSID--------PDDILFTPNNVSKEEMDFALDRGIKITFNSPGQ
DCDA_THEAC        GSDSASPMEIMMSIFSGIP--------PEDILYSPNNASEYDLNFALDRGIAINFNTFTQ
DCDA_THEMA        GMDVVTKGELLAAKLAGVP--------SHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFE
DCDA_ARCFU        GADVFSDGELYLASLAGFR--------KDMVLFNGNSKSRKEIEMGVTAGVKFSVDSLDE
DCDA_METTH        GIDAVSPGEIYTALMAGFD--------PDRILYTGNNVRDDELQFALDSGVRINVDSRSQ
DCDA_HELPY        GADCVSIGEIYRALKAGIK--------PYRIVFSGVGKSGFEIEQALKLNILFLNVESFM
DCDA_HELPJ        GADCVSIGEIQRALKAGIK--------PYKIVFSGVGKSAFEIEQALKLNILFLNVESFM
DCDA_CAMJE        GFDCVSIGEVKRALKAGAK--------AYKIIFSGVGKTKEELRQALEYDILYINLESEA
DCDA_AQUAE        GADIVSGGELYLAKKAGIP--------PERIVYAGVGKTEKELTDAVDSEILMFNVESRQ
DCDA_PSEAE        GFDIVSRGELERVLAAGGD--------PAKVVFSGVGKTRDDMRRALEVGVHCFNVESGE
DCDA_PSEFL        GFDIVSGGELERVLAAGGS--------ADKIVFSGVGKTREDMRRALEVGVHCFNIESTD
DCDA_VIBCH        GFDIVSVGELERVLAAGGD--------PSKVVFSGVGKTEAEMKRALQLKIKCFNVESEP
DCDA_HAEIN        GFDIVSQGELERVLAAGGD--------ASKVVFSGVAKSREEIMRALEVRIRCFNVESVS
DCDA_NEIMA        GFDIVSGGELARVLAAGGD--------AAKTIFSGVGKSEAEIEFALNAGVKCFNMESIP
DCDA_NEIMB        GFDIVSGGELARVLAAGGD--------AAKTIFSGVGKSEAEIEFALNAGVKCFNMESIP
DCDA_ZYMMO        GADVVSAGEIRRAVHAGIP--------PERIVFSGVGKTAEEMRYALEIGIGQFNIESVS
DCDA_FRATH        GIDCVSGGEIKRALEQKVD--------SQHIVFAR-----FEIELAIDNDIFAFNSESLE
DCDA_BACTN        GADCVSGGEIRAAVRAGFP--------ANKIVFAGVGKADWEINLGLEYGIFCFNVESIP
DCDA_METJA        GADVVSGGELYIAKLSNVP--------SKKIVFNGNCKTKEEIIMGIEANIRAFNVDSIS
DCDA_MYCTU        CLDVCTGGELAVALHASFP--------PERITLHGNNKSVSELTAAVKAGVGHIVVDSMT
DCDA_MYCBO        CLDVCTGGELAVALHASFP--------PERITLHGNNKSVSELTAAVKAGVGHIVVDSMT
DCDA_MYCLE        SLDVCSGGELAVALHASFP--------PERISLHGNNKSVAELKDAVKAGVGYIVLDSTT
DCDA_MYCS2        SLDVATGGELAVALHAGFP--------ASRITVHGNNKSVAELTAAVQAGVGHVVLDSEI
DCDA_COREF        SLDIASENELGIALAADFP--------GERITAHGNNKDASFLRACVRNNLGHVVLDSAQ
DCDA_CORGL        ALDIASINELGIALAAGFP--------ASRITAHGNNKGVEFLRALVQNGVGHVVLDSAQ
DCDA_ACTPA        SLDVCSAGELAIARSVGFP--------AERVLLHGNVKTPEDLKAALGYGVGRVVVDSFD
DCDA_BACMT        SLDVVSGGELYTALVAGFP--------VHKIHFHGNNKSRAELEMALEHQIGCIVVDNFH
DCDA_BACSU        SLDVVSGGELYTAVAAGFP--------AERIHFHGNNKSREELRMALEHRIGCIVVDNFY
DCDA_BACHD        SLDVVSGGELYTAQQAGVS--------MERIHFHGNNKSRAEIEMAVEAGIGCFVVDNFY
DCDA_STAAC        QLDVVSEGELYTALEAGFE--------PSRIHFHGNNKTKHEIRYALENNIGYFVIDSLE
DCDA_SYNY3        GFDVVSGGELFTTVSALKQLGWDEAEIAEKIYFHGNNKSVQELQEAIAINC-TIIVDNWL
Q8TY23_METKA      AADVVSLWEMKVAVNAGAE----------TVVVNGNAKSSDEIRAAVERSW-VINVDSFE
C7M3Q4_CAPOD      GLDTVSIQEVQLGLLAGFD--------PQQIIFTPNGVSMDEIEEAMRLGVQLNIDNLSF
Q24MH6_DESHY      GADCSSLAELILAEKAGIT--------EENIMLTSNNTPAEEFQKAKDLWAIINLDDITH
C7P2F6_HALMD      DIECAAAGELQRAIDAGAD--------PNTLQYTAVNPPGGDLDYAVDLADEHPGLTITG
                    :  :  *:                                                  

E4UA83_OCEP5      DL-ERIAQRLP----EARVLLRLNPDLPVDTHPHLATGRGDSQFGVLPEDWPDVFARGRE
DCDA_DEIRA        ---EEVVLLPP----GSRVLVRVNPAMTVSTHEHLATGTARSKFGLTPEQVPGTLAELRD
DCDA_ECOLI        -L-DQLGQVSP----GHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR
DCDA_ECOLW        -L-DQLGQVSP----GHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR
DCDA_STRCO        -L-DQVGRAAP----GHPVWIRINPGFGHGHSRKTNTGGEHSKHGIWHEHLEESLALVDR
DCDA_BUCAI        -L-KQLGKISP----GHHVWLRINPRFGYGHSKKTNTGGENSKHGIWHPEQ--AIPIIKK
DCDA_BUCAP        -L-EQLGKLSP----GHHVWLRINPGFGHGHSKKTNTGGENSKHGIWNPRL--AIPIIKK
DCDA_BUCBP        -L-EQVGKISP----GHNIWLRINPKFGHGHSKKTNTGGENSKHGIWDINL--AFPYITK
Q97AJ0_THEVO      -F-ELVSNRV------EEATFRINPGIGHGEHPGTTTGGHGSKFGIDPETALKLYTRAKE
DCDA_THEAC        -Y-RKMREKP------ERISFRINPGFGMGEFAGTTTGGARTKFGIDPDAAILAYRKARE
DCDA_THEMA        EM-EIWRELNPE---GVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPLEDLDSFMERFR-
DCDA_ARCFU        -L-RTISKIAKEVGKEVEIAFRVNPDVDPKTHPKIATGLRESKFGIPHEMVREAYEMALK
DCDA_METTH        -L-LRLSEIAPE---GLRISFRVNPLVGAGHHEHCITGGEMSKFGVMEREAPEVYRMAMD
DCDA_HELPY        EL-TTIETIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKE--ALEMFLWA
DCDA_HELPJ        EL-KTIETIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVEEKE--ALEMFLWA
DCDA_CAMJE        EM-MLLESVAKELNLKARISIRVNPNVDAKTHPYISTGLNENKFGVEIDI--ARKMYLYA
DCDA_AQUAE        EL-DVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIRE--AQKEYEYA
DCDA_PSEAE        EL-ERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDE--AEAVYARA
DCDA_PSEFL        ELGSRLQIVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAD--AEDVYVRA
DCDA_VIBCH        EL-QRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDR--AAQVYRLA
DCDA_HAEIN        EL-KHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNE--AREVYKLA
DCDA_NEIMA        EI-DRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYAD--ALEAYRHA
DCDA_NEIMB        EI-DRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYAD--ALEAYHYA
DCDA_ZYMMO        EI-EMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAED--ALSAYEKL
DCDA_FRATH        EI-QVINQIAQRKNKQVNICLRVNPNIDAQTHHYISTGQFDDKFGIAFVDI-LNWLKDEY
DCDA_BACTN        EL-EVINELAAAQNKIANVAFRINPDVGAHTHANITTGLAENKFGISMQD--MDRVIDVA
DCDA_METJA        EL-ILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMA
DCDA_MYCTU        EI-ERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRV
DCDA_MYCBO        EI-ERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRV
DCDA_MYCLE        EI-ERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFIATAHEDQKFGLSVASGAAMAAVRRV
DCDA_MYCS2        EI-ERLDQIAGAAGVVQDVLVRVTVGVEAHTHEFISTAHEDQKFGLSLATGAAMNAIRRV
DCDA_COREF        EL-ELLDYIAAGEGKVQPVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGAAFDAARAA
DCDA_CORGL        EL-ELLDYVAAGEGKIQDVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGSAFEAAKAA
DCDA_ACTPA        EI-EQLGALAEGP---QDVLVRVTPGVDPRTHRAVATGVEDQKFGFSLAGGDALEAVLRV
DCDA_BACMT        EL-DLIDSICSEKNVKTNILLRVTPGIEAHTHDYILTGQEDSKFGFDLQNGQAEKALQIA
DCDA_BACSU        EI-ALLEDLCKETGHSIDVLLRITPGVEAHTHDYITTGQEDSKFGFDLHNGQTERAIEQV
DCDA_BACHD        EL-DLLADICEQKRATANILLRITPGVEAHTHDYISTGQEDSKFGFDLVSGQATLAVKKA
DCDA_STAAC        EI-ELIDRYAND---TVQVVLRVNPGVEAHTHEFIQTGQEDSKFGLSIQYGLAKKAIDKV
DCDA_SYNY3        EL-ETLTKLAADSGAPVKIMLRLTPGIECHTHEYIKTGHLDSKFGFDP--NQLEAVFTYI
Q8TY23_METKA      EF-QRIEKIARHEGERALVALRVNPKVSPDTHSHIATAVEGSKFGVELE--IAERVCRRM
C7M3Q4_CAPOD      LE------QFGTQHPEIPVCIRINPHVMAGGNSNISVGHIDSKFGISIHQIPHILRIVEN
Q24MH6_DESHY      -----IDYLEKHTGLPEVLSFRYNPGSLRAGNAIIGN-PEESKYGLTKEQLFQAYEIVRD
C7P2F6_HALMD      GAEDTFDRLEDR-GYDGRVAIRINPGIGTGHHEKVATGKDAK-FGIPYDEVPALADDLRD
                                      .* .                   .*.              

E4UA83_OCEP5      L---GLEMRGLHVHLGSNLH-----NPADFAARLEVLQRLRERVGPL----EVLDLGGGF
DCDA_DEIRA        A---GHEVLGLHMHIGSAIE-----QAEDFTAAFARVTELRAHIGGL----SVLNVGGGW
DCDA_ECOLI        H---HLQLVGIHMHIGSGVD-----YAHLEQVCGAMVRQVIEFGQDL----QAISAGGGL
DCDA_ECOLW        H---HLQLVGIHMHIGSGVD-----YAHLEQVCGAMVRQVIEFGQDL----QAISAGGGL
DCDA_STRCO        H---GLDLVGLHMHIGSGVD-----YGHLESVCETMVKQVRMAGRDI----RAISAGGGL
DCDA_BUCAI        Y---KLKLIGLHMHIGSGVN-----YLHLKKVSQAMIKYAFQLNQKI----SSISVGGGL
DCDA_BUCAP        Y---KLKLIGLHMHIGSGVN-----YKHLKKVGQAMIEKAMEINEKI----LFISAGGGL
DCDA_BUCBP        Y---NFKLIGLHMHIGSGVD-----YCHLKRVCKAMIDQVLQCKFKI----HVISAGGGL
Q97AJ0_THEVO      L---GIRKFGIHMMVGSNNTDADLMLTFYKKFFDMASEIEKTAHLQF----SYIDIGGGF
DCDA_THEAC        D---GIREFGIHMMIGSNNRDHVKIAEAYSNFFRIADRIGREAGVSF----QFADVGGGL
DCDA_THEMA        ----SMNIRGLHVHIGSQIT------RVEPFVEAFSKVVRASERYGF----EEINIGGGW
DCDA_ARCFU        LD--GVVPVGIHCHIGSQILDLSPFVHALNKVMDIAVDI-EKLGVEL----SFVDMGGGL
DCDA_METTH        L---GFEPVGIHAHIGSGILDPEPFMLAVETLMDIAGRVHEATGVEF----EFIDFGGGL
DCDA_HELPY        KKSAFLEPVSVHFHIGSQLSDLEP-IIEASQKVAKIAKSLIALGIDL----RFFDVGGGI
DCDA_HELPJ        KKSAFLEPVSVHFHIGSQLLDLDP-ITEASQKVAKIAKSLIALGIDL----RFFDVGGGI
DCDA_CAMJE        KNSSFLEPVGVHFHIGSQLLDISP-IHEAAAIVAKLVRELKALQIDL----KFFDIGGGL
DCDA_AQUAE        SKLENLEIVGIHCHIGSQILDISP-YREAVEKVVSLYESLTQKGFDI----KYLDIGGGL
DCDA_PSEAE        AELDHLEVIGVDCHIGSQLTQLEP-FLDALERLLGLVDRLAGKGIGI----RHLDLGGGL
DCDA_PSEFL        AQLPNLEVLGVDCHIGSQLTTLEP-FIDALDRLLALVDRLGDCGIYL----RHIDLGGGV
DCDA_VIBCH        HSLPNLDVHGIDCHIGSQLTALAP-FIDATDRLLALIDSLKAEGIHI----RHLDVGGGL
DCDA_HAEIN        STLPNIKITGMDCHIGSQLTELQP-FLDATDRLIVLMEQLKEDGITL----KHLDLGGGL
DCDA_NEIMA        AQQPNLKIIGIDCHIGSQLTDLSP-LVEACERILILVDALAAEGIVL----EHLDLGGGV
DCDA_NEIMB        AQQPNLKIIGIDCHIGSQLTDLSP-LVEACERILILVDALAAEGIVL----EHLDLGGGV
DCDA_ZYMMO        ASYPSLKIQGIASHIGSQITDLAP-FEAAAERIYEIITALEKAGHAI----ETADLGGGL
DCDA_FRATH        RNFANINIIGLHYHVGSQILNYQV-FQSLAITTNEHIKLLRQNDINI----KHINFGGGL
DCDA_BACTN        LEMKNVKFIGLHFHIGSQILDMGD-FIALCNRVNELQDKLEARRILV----EHINVGGGL
DCDA_METJA        LEMEYVNVVGVHCHIGSQLTDISP-FIEETRKVMDFVVELKEEGIEI----EDVNLGGGL
DCDA_MYCTU        FATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGL
DCDA_MYCBO        FATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGL
DCDA_MYCLE        FATDNLRLVGLHSHIGSQIFDVAGFELAAHRVIGLLCDIVGEFDPEKTAQLSIVDLGGGL
DCDA_MYCS2        FATDNLRLVGLHSHIGSQIFDVAGFEIAAHRVIGLLRDVVAEFGVEKTSQMSIVDLGGGL
DCDA_COREF        VNAENLELVGLHCHVGSQVFDAQGFSLAAERVLELYSRIHDELGV----TLAELDLGGGY
DCDA_CORGL        NNAENLNLVGLHCHVGSQVFDAEGFKLAAERVLGLYSQIHSELGV----ALPELDLGGGY
DCDA_ACTPA        VEQPSLRLVGLHCHVGSQVRHVAVYEEAARRVVGLIASCGV--------RIEQLDLGGGF
DCDA_BACMT        LNSNFVEVLGVHCHIGSQIFDTTGFVLAARKIFEKLKEWKDRLSYEP----KVLNLGGGF
DCDA_BACSU        LQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKLDEWRDSYSFVS----KVLNLGGGF
DCDA_BACHD        LAVDSIHLLGVHSHIGSQIFETTGFVMAVEKIFEHLVTWREDHGFEP----SVLNLGGGF
DCDA_STAAC        QQSKHLKLKGVHCHIGSQIEGTEAFIETAKIVLRWLKE----QGIQV----ELLNLGGGF
DCDA_SYNY3        AQQPSLHCLGLHAHIGSQIFERQPHKDLGEVLVQWFTKGLTYGLPLT-----ELNIGGGL
Q8TY23_METKA      IESEWVEFLGLHYHIGSQITDLRPFSEALRSVRTFLEDTGLIEEISY------LNIGGGL
C7M3Q4_CAPOD      T---KMHINGIHMHTGSDILDIDVFLYAAEILFETAKHFKDL---------QFIDFGSGF
Q24MH6_DESHY      K---GVKRFGLHTMIISNELNPDFFIETAEMMFDLAIELKEKLGIRL----EFVNFGGGI
C7P2F6_HALMD      R----FDLVGLHAHAGSGVLREDL--DDHCRAIAKVAELAREVGDSD---LEFVDFGGGF
                           .:     *                                     . *.* 

E4UA83_OCEP5      GLDLDPRD--------------LAPGMFALARAYGAELWIEPGRALVADAGVLVARVWAE
DCDA_DEIRA        SLNADLEG--------------IAYEAHEAARVFGAELWVEPGRYLVASAGWLLTRVVGT
DCDA_ECOLI        SVPYQQGEEAVDTE-HYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSV
DCDA_ECOLW        SVPYQQGEEAVDTE-HYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSV
DCDA_STRCO        SVPYTPGDPEIDTD-RYFELWDAARRELVSELGHPVRLEIEPGRFLVAGAGVLAAEVRAQ
DCDA_BUCAI        PIPYKFNDQPIDIK-KYFMLWDIARKKISKFLGEKIELEIEPGRFLVAESGILISKVWAT
DCDA_BUCAP        PIPYTFNEKPIDTK-KYFIIWDEARKKISRFLNTPIQLEIEPGRFLVAESGILISQVRAI
DCDA_BUCBP        TVPYHCNDEPVNVK-NYFFLWNKARKIISNYLNRPIRLEIEPGRFLVAESGILVSEIRVI
Q97AJ0_THEVO      GVPYNDEQRSLDIK-K---LGSGLKELVDQY--GIERLFIEPGRYIVADAGILVGKVYDV
DCDA_THEAC        GIPYVQGENELDIA-A---LGSAVLKEFDRY--HFGDLVLEPGRYLVGDAGIIVGTVNDV
DCDA_THEMA        GINYSGEE----------LDLSSYREKVVPDLKRFKRVIVEIGRYIVAPSGYLLLRVVLV
DCDA_ARCFU        GIDYEGKGAPTPKD-LASAILPEFEGRKADLTSD-PQLWLEPGRSIVGNTTVLITRVNAV
DCDA_METTH        GIPYTPEEEPLDIDEFASKITGLFKDKLSEYGLGRPMMCLEPGRYIVGDASYLLTRVNTI
DCDA_HELPY        GVSYE-NEET--IKLYDYAQGILNSLQG-----LDLTIICEPGRSIVAESGELITQVLYE
DCDA_HELPJ        GVSYE-NEET--IKLYDYAQGILNSLQG-----LDLTIICEPGRSIVAESGELITQVLYE
DCDA_CAMJE        GVAYEKNECE--PDLYDYAQGILAQLHG-----LDLTIGMEPGRYLVAKSGEFVCSVLYE
DCDA_AQUAE        GIKYKPEDKE--PAPQDLADLLKDLLEN-----VKAKIILEPGRSIMGNAGILITQVQFL
DCDA_PSEAE        GVRYRDEQP---PLAGDYIRAIRERLHG-----RDLTLVFEPGRSIVANAGVLLTRVEYL
DCDA_PSEFL        GVRYRDEEP---PLVADYIKAVRERLDG-----RDLALMFEPGRYIVANAGVLLTQVEYL
DCDA_VIBCH        GVVYRDELP---PQPSEYAKALLDRLERH----RDLELIFEPGRAIAANAGVLVTKVEFL
DCDA_HAEIN        GVTYTDETP---PHPSDYANALLEKLKNY----PELEIILEPGRAISANAGILVAKVQYL
DCDA_NEIMA        GIVYQDEDV---PDLGAYAQAV-QKLIGT----RRLKLILEPGRSLVGNAGALLTRVEFV
DCDA_NEIMB        GIVYQDENV---PDLGAYAQAV-QKLIGT----RRLKLILEPGRSLVGNAGSLLTRVEFV
DCDA_ZYMMO        GVRYKDDQPE--PPSVEAYGEMIKRVTKG----WNCRLIFEPGRSLIANAGVLLSKVIRI
DCDA_FRATH        GIDYQNPQQNPIVDFDGYFARFREFFKYS----DELVLHFELGRSLVGQSGVLVSQVLFN
DCDA_BACTN        GIDYGHPNRQSVPDFKSYFATYAGQLKLR----PYQTLHFELGRAVVGQCGSLISKVLYV
DCDA_METJA        GIPYYKDKQ--IPTQKDLADAIINTMLKYKDKVEMPNLILEPGRSLVATAGYLLGKVHHI
DCDA_MYCTU        GISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTV
DCDA_MYCBO        GISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTV
DCDA_MYCLE        GISYLPDDDPPPIFELAAKLGAIVSNESAAVGLPVPKLMVEPGRAIAGPGTITLYEVGTI
DCDA_MYCS2        GISYLPHDDPPPMKELADKLLEIVRTESAAVGLPTPKLVVEPGRAIAGPGTITLYEVGTV
DCDA_COREF        GIAYTAAEEPLNVVEVAHDLLTAVGKTAAELGIEAPTVLVEPGRAIAGPSTVTVYEVGTI
DCDA_CORGL        GIAYTAAEEPLNVAEVASDLLTAVGKMAAELGIDAPTVLVEPGRAIAGPSTVTIYEVGTT
DCDA_ACTPA        AVPYLPGEGEFDLGGFAHRVRVALSHECALRRVPVPRLSIEPGRAVVARAGVTLYRVAAV
DCDA_BACMT        GIRYTEEDDPIPASQYVKEIINEVKKQVSAYSMKMPEIWIEPGRSLVGDAGTTLYQIGSR
DCDA_BACSU        GIRYTEDDEPLHATEYVEKIIEAVKENASRYGFDIPEIWIEPGRSLVGDAGTTLYTVGSQ
DCDA_BACHD        GIRYIEGDTPRPVGDYVKEMIRAVKQQIAEHEMSMPEIWIEPGRSLVGDAGTTLYTIGSR
DCDA_STAAC        GIKYVEGDESFPIESGIKDITDAIKSEIKVLGIDAPEIGIEPGRSIVGEAGVTLYEVGTI
DCDA_SYNY3        GICYTESDDPPSIEEWAQVAAISVAKACDRQNIPYPKLIAEPGRSLVGSACVTAYRVGGR
Q8TY23_METKA      GIRYRRGEEVPSPHDLAEELQEDLKELHSES--SGFDLYLEPGRSIVGEAGILVTSVRQV
C7M3Q4_CAPOD      KVPYKEGDIQTNIEELGERLSSRFADFCKEYG-RNLTLAFEPGKFLVSEAGYFLVKVNVV
Q24MH6_DESHY      GIPYRPEQEPVNLETIGEGVRKVYEEKIVAKGLDPLRICLECGRMITGPYGYLVTKVLHR
C7P2F6_HALMD      GVPYREETEPLDMQAVGERVREAVGDLSA-------RIKLEPGRYVVADAELILTTVNTV
                   :                                   :  * *: : .        :   

E4UA83_OCEP5      KRTR------RRYLLLDAGMTAFLRPLLYGARHPVRPLYASE------RTAVYDLAGPAC
DCDA_DEIRA        KRTG------RNFCLVDAGMTEFLRPMLYGASHPLYPMWDAL------ATEVWDVAGPAC
DCDA_ECOLI        KQMG-----SRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLC
DCDA_ECOLW        KQMG-----SRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLC
DCDA_STRCO        KPVG-----SNYFVLVDAGFNDLMRPAMYGSNHRVSVLDADG-APRASDARDTVLAGPLC
DCDA_BUCAI        KKMG-----NKNFVLVDVGFNDLMRPTMYGSYHHISVIYGDDRKMNEKETIDTVVAGPLC
DCDA_BUCAP        KKMG-----DKNFVLIDAGFNDLMRPTMYGSYHHVSVVTKDDRNIHETETIDTIIGGPLC
DCDA_BUCBP        KKTN-----NRTFILVDSGFNDLIRPAMYGSYHHISVIPRDGRCVNYDDTIEAVVCGPLC
Q97AJ0_THEVO      YNG---------FVGTDIGMNINIRHALYGAEHRFYALTGRS------DEAEYIVTGQIC
DCDA_THEAC        HNG---------FAGTDIGMNLNIRPALYGARHTIIPVGERV------EGEKITVTGQIC
DCDA_THEMA        KRRH-----NKAFVVVDGGMNVLIRPALYSAYHRIFVLGKQG------KEMRADVVGPLC
DCDA_ARCFU        KKGY------KNFVAVDAGFNVLIRPAMYGSYHRVAVANKMDA----EPEEVYTVVGPIC
DCDA_METTH        KESY------RKFAGVDAGFNTLLRPAMYGSYHHILVAERPLD----EPSEKMDVAGNVC
DCDA_HELPY        KKAQ-----NKRFVVVDAGMNDFLRPSLYHAKHAIRVITPSKGR----EISPCDVVGPVC
DCDA_HELPJ        KKAQ-----NKRFVIVDAGMNDFLRPSLYHAKHAIRVITPCGGR----EISPCDVVGPVC
DCDA_CAMJE        KQNK-----TKRFVVVDGAMNDLIRPSLYEAYHEI--ILPYNQG----EESLCDVVGGIC
DCDA_AQUAE        KDKG-----SKHFIIVDAGMNDLIRPSIYNAYHHIIPVETK-ER----KKVVADIVGPIC
DCDA_PSEAE        KHTE-----HKDFAIVDAAMNDLIRPALYQAWMDVQAV-RPRDA----APRRYDLVGPIC
DCDA_PSEFL        KHTE-----HKDFAIVDAAMNDLIRPALYQAWMDVTAV-RPRDT----AARSYDIVGPIC
DCDA_VIBCH        KHTE-----HKNFAIIDAAMNDLIRPALYQAWQDIIPL-RPRQG----EAQTYDLVGPVC
DCDA_HAEIN        KSNE-----SRNFAITDTGMNDMIRPALYEAYMNIVEIDRTLER----EKAIYDVVGPVC
DCDA_NEIMA        KYGE-----EKNFVMVDAAMNDLMRPALYDAYHHIEAV-EPKNI----APLTANIVGPIC
DCDA_NEIMB        KYGE-----EKNFVMVDAAMNDLMRPALYDAYHHIEAV-ETKDI----ATLTANIVGPIC
DCDA_ZYMMO        KESK-----TARFVILDAAMNDLVRPTLYDAYHEIKAV--TPSA----QTYQADIVGPVC
DCDA_FRATH        KVTQ-----GTHFVIIDAGMTELIRPALYQAQHKIAALIDENIN----QKQHYHIVGPIC
DCDA_BACTN        KQGT-----KKKFAILDAGMTDLIRPALYQAYHKMENITSEEP------VEAYDVVGPIC
DCDA_METJA        KETP-----VTKWVMIDAGMNDMMRPAMYEAYHHIINC--KVKN----EKEVVSIAGGLC
DCDA_MYCTU        KDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDA----PPVPARLVGKHC
DCDA_MYCBO        KDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDA----PPVPARLVGKHC
DCDA_MYCLE        KDVDVSATAHRRYVSIDGGMSDNIRTALYDAQYDVRLVSRTSDA----PAAPASIVGKHC
DCDA_MYCS2        KDVAVSQTAHRRYVSVDGGMSDNIRTSLYAAQYDARLVSRVSDA----PPALARIVGKHC
DCDA_COREF        KDVDVDDETTRRYISVDGGMSDNIRPALYGAEYDARVVSRFTEG----ETTNTRVVGSHC
DCDA_CORGL        KDVHVDDDKTRRYIAVDGGMSDNIRPALYGSEYDARVVSRFAEG----DPVSTRIVGSHC
DCDA_ACTPA        K-----RGVRRVFVAVDGGMSDNPRPALYGSRYAVRLVRR--GG----RRAPVTVVGRHC
DCDA_BACMT        KD----VPNVRHYVAVDGGMSDNIRPALYNAKYEAVLANKPLAK----ADETVSIAGKCC
DCDA_BACSU        KE----VPGVRQYVAVDGGMNDNIRPALYQAKYEAAAANRIGEA----HDKTVSIAGKCC
DCDA_BACHD        KE----IPNVRHYLSVDGGMSDNLRPALYQAEYEGALANRVNEQ----PVGMFSVAGKCC
DCDA_STAAC        KE----IPEINKYVSIDGGMSDHIRTALYDAKYQALLVNRN-EE----ADDSVTIAGKLC
DCDA_SYNY3        K----VVPNIRTYISVDGGMSDNPRPITYQSVYRVALANRMNDE----ITETVTVAGKHC
Q8TY23_METKA      KR------GRRRWVFVDTGMNALIRPALYDA-YHEVVVHGGDYS----ATEKASVAGPLC
C7M3Q4_CAPOD      KQTT-----STVFAGIDSGFNHLIRPMFYGANHYIENISNPEGK-----NRFYSVVGYIC
Q24MH6_DESHY      KDTY------KNYIGVDASMSDLMRPGIYGAYHHITVMGKEDLP----EDHIYDVTGSLC
C7P2F6_HALMD      KETP-----ATTVVGVDASLATLIRPAMFDSYHPIRNVSAPDRD-----PHPVSIGGPCC
                                  * .:    *   : :                       : *  *

E4UA83_OCEP5      ESGDVLARDVE-------LPVPREGDAVAFLEAGAYGEAMHLDYLDHPRPGAYAWD-GAR
DCDA_DEIRA        ESGDLIARGVP-------LPTPQRGHLLLIGEAGAYGASMSSTYLSRPRPAEVLWT-GHD
DCDA_ECOLI        ESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFD-NGQ
DCDA_ECOLW        ESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFD-NGQ
DCDA_STRCO        ESGDVFTQVEGGDVEPVPVPRTDVGDLVVFHDTGAYGASMSSTYNSRPLIPEVLVD-GAE
DCDA_BUCAI        ESGDIFTQKEGGTVQTRKLPTIKVGDYLIFHDTGAYGAAMSSNYNTRPLIPEILLK-NND
DCDA_BUCAP        ESGDIFTQKEGGNITTRKLPILKIGDYLIFHDVGAYGASMSSNYNTRPLIQEILLE-NNT
DCDA_BUCBP        ESGDVFTQNEYGDIKTRILPNVQIGDFLVFHDTGAYGASMSSNYNSRPLIPEILFK-DNE
Q97AJ0_THEVO      ENTDVTGRLTG---------KVQIGDLVAMYDAGAYIYSMSSNYNGRFRPTEVIVDHDGV
DCDA_THEAC        ENTDRIGDTAW---------RLSEGDRIMVLDAGAYVYSMSSRYNGRPRPPEIMIMEDGK
DCDA_THEMA        ESGDVIAYDRE-------LPEVEPGDIIAVENAGAYGYTMSNNYNSTTRPAEVLVRENGR
DCDA_ARCFU        ESGDVLARDRK-------LPKVEVGDLIAVFDAGAYGFVMSSQYNGRPRCAEVLVS-GDR
DCDA_METTH        ESGDLFARDRQ-------LPEINEGDVLAIMNAGAYSFSMSSQYNSRPRPAEVLVR-EGK
DCDA_HELPY        ESSDTFLKDAH-------LPELEPGDKLVIEKVGAYGSSMASQYNSRPKLLELALE-DHK
DCDA_HELPJ        ESSDTFLKDAN-------LPELEPGDKLAIEKVGAYGSSMASQYNSRPKLLELALE-DHK
DCDA_CAMJE        ESGDFFAKARS-------LPSTQSDDIMVIKNTGAYGFSMSSNYNTRNKVCELALE-EGQ
DCDA_AQUAE        ETGDFLALDRE-------IEEVQRGEYLAVLSAGAYGFAMSSHYNMRPRAAEVLVE-NGS
DCDA_PSEAE        ETGDFLAKDRD-------LALAEGD-LLAVRSAGAYGFVMSSNYNTRGRAAEVLVD-GEQ
DCDA_PSEFL        ETGDFLAKGRE-------LALEEGD-LLAVHSAGAYGFVMSSNYNTRGRCAEVLVD-GDQ
DCDA_VIBCH        ETSDFLGKDRD-------LVLQEGD-LLAVRSSGAYGFTMSSNYNTRPRVAEVMVD-GNK
DCDA_HAEIN        ETSDFLGKQRE-------LSIAEGD-YIAQCSAGAYGASMSSNYNSRARTAEVLVD-GDQ
DCDA_NEIMA        ETGDFLGKDRT-------IACEEGD-LLLIRSAGAYGASMASNYNARNRAAEVLVD-GNE
DCDA_NEIMB        ETGDFLGKDRT-------IACEEGD-LLLIRSAGAYGASMASNYNARNRAAEVLVD-GNE
DCDA_ZYMMO        ETGDIFARNRS-------ISAVKADDLMAIMSAGAYGATMASAYNSRPLVAEVMVS-GNK
DCDA_FRATH        ESSDVFAKYYQ-------LPKLKRGDLLAIYSAGAYGKVLASEYNLRPSVQEYFI-----
DCDA_BACTN        ESSDVFGKAID-------LNKVKRGDLIALRSAGAYGEIMASGYNCRELPKGYTSD-ELV
DCDA_METJA        ESSDVFGRDRE-------LDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTS-KKG
DCDA_MYCTU        ESGDIIVRDTW------VPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVH-AGN
DCDA_MYCBO        ESGDIIVRDTW------VPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVH-AGN
DCDA_MYCLE        ESGDIVVRDTW------VPDDLKPGDLVGVAATGAYCYSLSSRYNMLGRPAVVAVC-AGQ
DCDA_MYCS2        ESGDIVVRDTW------VSDDIAPGDLIGVAATGAYCYSMSSRYNLLCRPAVVAVA-DGQ
DCDA_COREF        ESGDILINEAT------YPSDIHTGDLLALAATGAYCYAMSSRYNAFARPAVVSVR-AGA
DCDA_CORGL        ESGDILINDEI------YPSDITSGDFLALAATGAYCYAMSSRYNAFTRPAVVSVR-AGS
DCDA_ACTPA        EAGDVLAEDVP------LPEDVRAGDLLAVPVTGAYHHALASNYNAVGRPPVVGVR-DGV
DCDA_BACMT        ESGDMLIWDLP------LPKADS-DDILAVFCTGAYGYSMANNYNRIPRPAVVFVE-NGE
DCDA_BACSU        ESGDMLIWDID------LPEVKE-GDLLAVFCTGAYGYSMANNYNRIPRPAVVFVE-NGE
DCDA_BACHD        ESGDMLIWDLP------LPEANH-EDILAVFCTGAYGYSMANNYNRIPRPPVVFVE-DGD
DCDA_STAAC        ESGDIIIKDAK------LPSSVKRGDYLAILSTGAYHYSMASNYNQMQKPSVFFLK-DGK
DCDA_SYNY3        ESGDILVKDVA------LPAAEP-GDIMVVAATGAYNHSMASNYNRLGRPAAVLVN-QGQ
Q8TY23_METKA      ESGDVLAEDRE------LPIDISEGDLVVFLSAGAYCESMASNYNCYPIPGSVVVR-NGE
C7M3Q4_CAPOD      ETDTFASNRQ--------IAEITEGDILCFHNAGAYCYTMASNYNSRLRPAEVLWQ-NGE
Q24MH6_DESHY      ENNDKFAVDRE-------LPRIEIGDTLVIHDTGAHGHAMGFNYNGKLRHAELLLQADGS
C7P2F6_HALMD      TSADVFATDRP-------IARPERTDLLAIGNAGAYGYELANQFHSQPRPAEVAIE-DGD
                                             :     **:   :   :                

E4UA83_OCEP5      WEVWRRPGRLPALWEDEPDRAEYL---------
DCDA_DEIRA        WQLLRRRETPQDIWAAEV---------------
DCDA_ECOLI        ARLIRRRQTIEELLALELL--------------
DCDA_ECOLW        ARLIRRRQTIEELLALELL--------------
DCDA_STRCO        TRLIRRRQTVAELLAPELEPGPALSPRPSRDPR
DCDA_BUCAI        SIVIRRRQTIEEILNLEK---------------
DCDA_BUCAP        FRTIRRRQKINELLNLEK---------------
DCDA_BUCBP        FHIIRRRQTMKELLELEINCI------------
Q97AJ0_THEVO      -YRIRRRETVNDILATVTGMEKVNV--------
DCDA_THEAC        DVMIRRREDFSDFIATVV---------------
DCDA_THEMA        ISLIRRRETEMDIFKDVVM--------------
DCDA_ARCFU        WDVIREKESYGDLIEKQRLPEWLL---------
DCDA_METTH        VDVVRERETFSDLLRGQNVPARLLKR-------
DCDA_HELPY        IRVIRKREALEDLWRLEEEGLKGV---------
DCDA_HELPJ        IRVIRKREALEDLWRLEIEGLEGV---------
DCDA_CAMJE        VRLIRQRENFEDQIALEEKFLKA----------
DCDA_AQUAE        VKLIRKRENYDYIVEPSLDI-------------
DCDA_PSEAE        THEVRRRETVQELYAGESLLPQ-----------
DCDA_PSEFL        AFEVRRRETVAELFAGESLLPE-----------
DCDA_VIBCH        TYLVRQREELSSLWALESVLPE-----------
DCDA_HAEIN        SYLIRRRETLQELWALESTI-------------
DCDA_NEIMA        YRLIRRRETLEQQMANELACL------------
DCDA_NEIMB        YRLIRRRETLEQQMANELACLQAEHQNAV----
DCDA_ZYMMO        SALIRKRQSVEDLMRDEQKVEWL----------
DCDA_FRATH        ---------------------------------
DCDA_BACTN        ---------------------------------
DCDA_METJA        VFLIRERETYADLIAKDIVPPHLL---------
DCDA_MYCTU        ARLVLRRETVDDLLSLEVR--------------
DCDA_MYCBO        ARLVLRRETVDDLLSLEVR--------------
DCDA_MYCLE        ARLILRRETVDDLLSLEVR--------------
DCDA_MYCS2        ARLVLRRETVEDLLSLEVKGQ------------
DCDA_COREF        AKLMLRRETLDDILSLEV---------------
DCDA_CORGL        SRLMLRRETLDDILSLEA---------------
DCDA_ACTPA        ARVLVRRETEEDLLRREV---------------
DCDA_BACMT        SMLVVKRKHMRTSSAMICL--------------
DCDA_BACSU        AHLVVKRETYEDIVKLDLPFKTGVKQ-------
DCDA_BACHD        AQLVIQRERYEDLVRLDMPLVKKVKV-------
DCDA_STAAC        AREVIKRQSLRQLIINDTK--------------
DCDA_SYNY3        ANLILQRETYTDLLRQDCLPNRLLS--------
Q8TY23_METKA      ITGVRRVQDYEAFSKTWW---------------
C7M3Q4_CAPOD      AKLIRKAETFEDLLRGQIY--------------
Q24MH6_DESHY      VKLIRRAETLEDYFATLDFSEL-----------
C7P2F6_HALMD      ERVVRRRETMADVVRVEDEAGE-----------