CLUSTAL format seed alignment for MF_02124

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLGE_CHLTE       ------------------------------------------------------------
GLGE_METI4       ------------------------------------------------------------
GLGE_PSEAE       ------------------------------------------------------------
GLGE_XANCP       ------------------------------------------------------------
GLGE_BURPS       ------------------------------------------------------------
GLGE_RHOS4       ------------------------------------------------------------
GLGE_RHORT       ------------------------------------------------------------
GLGE_MYXXD       ------------------------------------------------------------
GLGE_PICTO       ------------------------------------------------------------
GLGE_SALRD       ------------------------------------------------------------
GLGE1_STRCO      -----------------------------------------------------MPATHHS
GLGE2_STRCO      ------------------------------------------------------------
GLGE_BIFLO       ----------------------------------MAAVQHRATTRTSNTDNSTTKTKSKA
GLGE_BIFLB       -----------------------------------------MEAQHNETEAAGKPAAKKT
GLGE_ARCHD       ----------------------------------------------------MSTLQHKT
GLGE_MYCTU       ------------------------------------------------------------
GLGE_MYCBO       ------------------------------------------------------------
GLGE_MYCS2       ------------------------------------------------------------
GLGE_CORGL       ------------------------------------------------------------
GLGE_CORP1       ------------------------------------------------------------
                                                                             

GLGE_CHLTE       ----------------MKPEFVLPAPI---------RLDRPFDGRRRVVIDRVFPEIDGG
GLGE_METI4       ----------------MKMPSFGYEVE---------KSFLPVDGRKRIVIERIFPSVDCS
GLGE_PSEAE       ----------------MSSIVRNSDDD----------PLVIAIQQPRIAIESVSPVVEEG
GLGE_XANCP       ----------------MRPRVQT------------------AAAWPRVCIESVTPSVDNG
GLGE_BURPS       ------------------<VTTAPAEDRRGNRPGTRASVTAALAGERIAIERIEPVVDDG
GLGE_RHOS4       ----------------------MAAATGAQDRRDGGEEALMRLADARVAIEGVNLEIDGG
GLGE_RHORT       ----MSSALPPFRPSLVSDPLSARQDP---------SLPGILPVSAPILIEDIGPRVSDG
GLGE_MYXXD       ----------------------------------------MTERLGSVFIEGVSPELDAG
GLGE_PICTO       --------------------------------------------MDPVAIENVTPEIECG
GLGE_SALRD       ----------------------------------------MPKSWSRVVISSVAPAIDGG
GLGE1_STRCO      SATSAE----------------------------------RPTVVGRIPVLDVRPVVQRG
GLGE2_STRCO      --MRMS----------------------------------ATVGIGRIPVRDVQPVVEYG
GLGE_BIFLO       TSARKSPATKRKRVSAETARAAAALKGLAVEAPAPSIEANEPGQFGRINVMDITPAEERG
GLGE_BIFLB       TRTRKPRASKQA--------------TFIAEAPAMPIAIKEPGQFGRVNILNCQPSVEDD
GLGE_ARCHD       SSARRS--SRRS------------------------VAAPDFVAVSRIPIVEVSPQLLDG
GLGE_MYCTU       ------------------------------MSGRAIGTETEWWVPGRVEIDDVAPVVSCG
GLGE_MYCBO       ------------------------------MSGRAIGTETEWWVPGRVEIDDVAPVVSCG
GLGE_MYCS2       --------------------------------------MRSGWVAGRIGIDDVAPVVSCG
GLGE_CORGL       -------------------------------------------MTGRLGIDDVRPRILDG
GLGE_CORP1       -------------------------------------------MTGRLAIEDVRPRIAGG
                                                                : :         .

GLGE_CHLTE       RFPVKRVEGDRMTVEADIFTDGADTIVAELLYRRK------------------------G
GLGE_METI4       DFPLKRVIGQTMVVRAYVFADGHERISVHLAYRHI------------------------A
GLGE_PSEAE       AYPAKTESDRDLRLAARIFADGHEVLGAEVVWRRV------------------------G
GLGE_XANCP       RFPVKRTVGDRICVEADAFCDGHDRIAVAVLWRPA------------------------D
GLGE_BURPS       RFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAA------------------------D
GLGE_RHOS4       RFAAKVVAGWEVAVEADIFCDGHDSIDAAVLHRQR------------------------G
GLGE_RHORT       RYPIKRVLGEGVVVSAAVFRDGHVPLAAALLWRRSPRPGE----------------PAGG
GLGE_MYXXD       RHAVKRVVGERCTVKADVFKEGHDVLVAVIRWRQVT--------------------PRAQ
GLGE_PICTO       RFPAKIVVNSKFTVTAEVFRAGHDLVYPVLMYRKL-------------------------
GLGE_SALRD       QWPIKRAVGEQVEVTAGVLVDSHDALAVELVVRHA------------------------S
GLGE1_STRCO      RRPAKAVTGESFEVSATVFREGHDAVGANVVLRDPR------------------------
GLGE2_STRCO      RRPAKAVTGETFEVTATVFREGHDAVAANVVLKDPE------------------------
GLGE_BIFLO       IFPARVELGEPFEMTAQVFIEGRTKVGATAIVRNPR------------------------
GLGE_BIFLB       VYAARVEIGEQFTVSAQVFMEGRTKVGATAVLKNPR------------------------
GLGE_ARCHD       TAPVKSTVDESFPVQATIFREGHDKFAARAVLVDGA------------------------
GLGE_MYCTU       VYPAKAVVGEVVPVSAAVWREGHEAVAATLVVRYLGVRYPHLTD----RPRARVLPTPSE
GLGE_MYCBO       VYPAKAVVGEVVPVSAAVWREGHEAVAATLVVRYLGVRYPHLTD----RPRARVLPTPSE
GLGE_MYCS2       RYPAKAVVGEVVPVRATVWREGHDAVSATLVVRYLGTEFPRLASGPGTTPPAVPLGTVVQ
GLGE_CORGL       N-PAKAVVGEIVPVSAIVWREGHDAIAATLNVSGPE--------------------DSSV
GLGE_CORP1       SQPSKAVIGEMIPVSALVWREGHDAVSATLNVISP-------------------------
                   . :   .    : *     .   .                                  

GLGE_CHLTE       EAAWSAVPMTHI--GNDRWKASFEV-----------------GAPGMCEYTVQGWVDHFE
GLGE_METI4       DSQWTEISMEEL--GNDEWEASFPL-----------------EKLGIYEVKIIGWIDHFQ
GLGE_PSEAE       ETAERRLPLLPE--GNDFWSAQLRT-----------------PPCGRLYFRIEAWIDRFA
GLGE_XANCP       AKTWASAPMRAL--GNDRWRAEFPL-----------------ERIGTYEFRVEGWRDVFA
GLGE_BURPS       ENGWHEARCAAE--GNDAWRADIPL-----------------ERLGRHLFRVIAWRDDWA
GLGE_RHOS4       TDDWIEVRMEFL--VNDRWQAHVTF-----------------AENAFHELTFLAWRDLYT
GLGE_RHORT       RGAWHEVPLTQIEPGLARWRARFDP-----------------PAIGRFDYLIEAWSDDWA
GLGE_MYXXD       QTDWEEVPMRFL--GNDRWEGEFPL-----------------TRNGRYEYTIEAWPDLFR
GLGE_PICTO       KKRWRSVAMKGT--GNDLYEASFTP-----------------DEPGIYEYKISAWKDSYG
GLGE_SALRD       EETEHVTRMPHVE--NDEYAGAFEV-----------------SAPGRYLYRVRAWINRFA
GLGE1_STRCO      GRPGPWTPMRELAPGTDRWGATV-----------------TAGETGTWSYTVEAWGDPVT
GLGE2_STRCO      GRPGPWTPMRELAPGSDRWGATV-----------------TPGAPGNWTYRVEAWSDPVA
GLGE_BIFLO       GKETMRRAMTCVNPGLDRWTVMVKCGEHSDLKPWEDGYAAVKRQLGEWTVTIEGWEDAYV
GLGE_BIFLB       GRIMARVPMTVENAGLDLYTAKLQAGEHSTLNPWDAEFAEVKKQLGNWRVAIEGWEDTYG
GLGE_ARCHD       GHTVDSVPMCDVSPGLFRFEGWL-----------------TPRVPGPHRFFVEAWSDPYA
GLGE_MYCTU       PQQRVKPLLIPMTSGQEPFVFHGQF---------------TPDRVGLWTFRVDGWGDPIH
GLGE_MYCBO       PQQRVKPLLIPMTSGQEPFVFHGQF---------------TPDRVGLWTFRVDGWGDPIH
GLGE_MYCS2       PGKRVKPQILQMSKGRTPDVFHGEF---------------TPDAVGLWTFRVDGWGDPIA
GLGE_CORGL       AAEPIQIHMRPTPDNQD--QSNAFF---------------VPDVPGNWTFRVDAWSDPMA
GLGE_CORP1       TGEVTRTTMEPAPFDQD--KMFSSF---------------VPDALGTWKFRVDAWSDPMS
                                                              .     . .* :   

GLGE_CHLTE       TWRKGLQKKLDAGQ---DVSLDLRIGATIVELGAARAKDEDAGTLHHYVGL---LSVG--
GLGE_METI4       NWLEKLHKLAENDK---DIAVELSIGIGLLEKNWAFSRSQ---ELKDWIDR---LKDERL
GLGE_PSEAE       GYRRELRAKHGARL---PLDLELREGDELLQRCAERGGPEIAAACAPLAER--LQACQSV
GLGE_XANCP       TLHADLEKKRAAST---VLPVDVQEAVAVVQAAHARSEGALATQLQDILTR--IGAQSEP
GLGE_BURPS       TLVDEIGKKHAAGQ---AVALELEEARRLAADVLTRAPEANPAALAVLREF--AAALDAA
GLGE_RHOS4       TWRKEVAKKLAAGQ---KIDLELEEGRRLLQSVETAGAEDRALVDRILGED--GADQEAG
GLGE_RHORT       GWRHDTLIKRDAGL---DLSLEVLEGMALIEATIARIDGTDQAADQGLLSSWLADAQGLE
GLGE_MYXXD       TWTSELKRKVDAGR---DVRSELLEGAALLEGAVARARTAKQPDDARVLGEAAVRLRQPP
GLGE_PICTO       TLIRNINAWLGSNE---DVEQDLIEAINLIKDAYKRSSGNDKKIIKRYLDD------LIN
GLGE_SALRD       TWQDQFRRRVEGGEPPSEIESELTAGASLLDEAAEHAPEDDREMLTAHIEA---------
GLGE1_STRCO      TWRHHARIKIPAGL---DTDLVLEEGARLYERAAADVPGRE---DRRELLAAVDALRDES
GLGE2_STRCO      TWRHAARIKVPAGI---DAGLVLEEGSELYRRAAAGVPKDS---GRDVLLAAATALLDDT
GLGE_BIFLO       SWLHDARIKVRVMD---DVDNALNSGAELLARWAETPDTGLTARDRKTLEKAAETMADQT
GLGE_BIFLB       AWLHDARIKVDVLS---DVENTLTSGSELLTRWASTRDANLNAEQRKTLREAAKSMMDTS
GLGE_ARCHD       TWLHNAEIKVPAGI---DVGLVFAEAEVLFK--AALKGTPVRSGERAAIRDALTVISKRR
GLGE_MYCTU       TWRHGLIAKLDAGQGETELSNDLLVGAVLLERAATGVPRGL----RDPLLAAAAALRTPG
GLGE_MYCBO       TWRHGLIAKLDAGQGETELSNDLLVGAVLLERAATGVPRGL----RDPLLAAAAALRTPG
GLGE_MYCS2       TWRHAVEAKLEAGQSETELNNDLLVGARLLMRAAEGVPRKL----RDPLLEAAQQLRTPG
GLGE_CORGL       TWRHAITTKIEAGQGSDELYNDFEHGAQLFERAAENLSKED----RTALFDVASSLRRGG
GLGE_CORP1       TWRHAVIAKIEVGQDEDDLFNDLEHGAQLFEKAAENASKPT----AQKLFAVADSLRSNQ
                                       .  .  :                               

GLGE_CHLTE       GSDAAVEAALSEGLLAAMRRSPEKAMATLYDKILLLQIDQKKAGFSTWYEFFPRSWSEEP
GLGE_METI4       SLHQRLQLIKNPYLEELVQKNPDRSLSVESESPLFIFVERSKAQFSSWYEFFPRSWSSVP
GLGE_PSEAE       --EERVALWLAAQTGELLRLVGPREHLVR-SREYPVEVERPLARFASWYELFPRSESGDP
GLGE_XANCP       --LQQLAIVLEPDTAQAMALADDKPFRSEYPVTFRVESERRAAHFSSWYELFPRSQSGDG
GLGE_BURPS       PPDQRLALIGAPHVADAFAALRERAFATRDAPVFPVDVERRAARFASWYEMFPRSASDDV
GLGE_RHOS4       ---ARFARMSSPEAVAAMKRCAPRTNLTC-YKILPIFADREAAAFSAWYEMMPRSQSDDP
GLGE_RHORT       TAGGRATLMLSETLDAVMARHPDRSGAVRSGPPLSVVVDPPRAGFAAWYEMAPRSQASEP
GLGE_MYXXD       S-PDLLAVALAPELADVASTHPDRSLARRYDKVLEVFADREKARFSAWYEFFPRSAKRDG
GLGE_PICTO       SDLNKKVMILNDNNFSSIIKKYQKKIDKTDYRTLRLIADPEYGGYGSWYELFPRSI----
GLGE_SALRD       FENGNAEAALGDEIAELARRHAPH-HQQTSSATYEVFVDPERARTGAWYEFFPRSVRDD-
GLGE1_STRCO      RPAASRLAAALTPQVDAVLARHPLRDLVTSSDPLPLLVERERALYGAWYEFFPRSEGTPH
GLGE2_STRCO      LPVATRLAAALTPQVDAVLARHPLRDLVTSSDPLPLLVERERALYGAWYEFFPRSEGTPH
GLGE_BIFLO       LSAEDRLAAGDNPTIAALHETHPLRDGISPSQPQRFKVERPKSSFAAWYQFFPRSEGATI
GLGE_BIFLB       LDAKSRLTFADNADIEALHETNPLRDGLTSSGDHVFHVERPKSSFSAWYQFFPRSEGAYL
GLGE_ARCHD       ALPEVKLAAARSEEVRAAFAAYPVKELVSRSREYPVFVDRVRALVGSWYELFPRSVGATR
GLGE_MYCTU       -DPVTRTALALTPEIEELLADYPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPRSTGGWD
GLGE_MYCBO       -DPVTRTALALTPEIEELLADYPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPRSTGGWD
GLGE_MYCS2       -DPYQRAGGALSPEVADLLLQYPLREFVTRGEVHGVWVDRPLARFSSWYEMFPRSTGGWD
GLGE_CORGL       -DVRARLAPALTASVTHLLELNPLRELVTMGENLQVRVERRAALVNSWYELFPRSTGGWD
GLGE_CORP1       -PLRARVAPALSKEIHEILHEHPVRELLTRGQNHTVLVERKKAQFSSWYELFPRSTGGWD
                                                    .  :   .   :**:: ***     

GLGE_CHLTE       GKH------GTFRDCIKLLPRIARMGFDVIYLPPIHPIGLTKRKGKNNALVAGPDDPGSC
GLGE_METI4       GKH------GTFKECERLLPDIAAMGFDVVYLPPIHPIGKKARKGKNNALIASPEDVGSP
GLGE_PSEAE       TRH------GTFDDVIRRLPQIAAMGFDVLYFPPIHPIGRTHRKGRNNSLRAEAGDPGSP
GLGE_XANCP       QRH------GTFDDVIGRLAHIRAMNFDVLYMPPIHPIGAKNRKGRNNAVTAQDGEPGSP
GLGE_BURPS       RRH------GTFDDVVAHLPRIRDMGFDVLYFPPIHPIGTTARKGRNNSLQAAPDDVGSP
GLGE_RHOS4       ERH------GTFDDVIRKLPYVRDLGFDVLYFTPIHPIGRVNRKGRNNSLTPAPDDPGSP
GLGE_RHORT       GRW------GTFADCAARLPDIRAMGFDTLYLMPIHPIGRIHRKGPNNSLKAGPDDPGSP
GLGE_MYXXD       VTH------ATFRDAEGWLPYIQQLGFDTVYLPPIHPIGRTARKGKNNSLAAAADDVGSP
GLGE_PICTO       ---------GNFNDIIKHLNYVKSMNFNVLYLTPIHPIGITNRRGKNGSRISDKNDPGSP
GLGE_SALRD       DEH------ATLDEAAERLPRIQEMGFDIVYLPPIHPIGETNRKGPDDAPEAGPDDPGSP
GLGE1_STRCO      TPH------GTFRTAARRLPAIAAMGFDVVYLPPIHPIGTTHRKGRNNTLSATGDDVGVP
GLGE2_STRCO      TPH------GTFRTAARRLPAIAAMGFDVVYLPPIHPIGTTHRKGRNNTLSATGDDVGVP
GLGE_BIFLO       DPNTGKIIQGTLKTSMAGLERAAAEGFDIVYLPPVFPIGVTNRKGRNNTLVAGPDDPGSP
GLGE_BIFLB       DDN-GKKVQGNFHTAVSGLERAKAEGFNIVYLPPIFPIGVTNRKGPDGALNAGPDDPGSP
GLGE_ARCHD       DSESGEWTSGTLRTAATDLDRVAGMGFDVVYIPPVHPIGLTNRKGRNNSLTAVPGDPGSP
GLGE_MYCTU       DDG--NPVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTDVGSP
GLGE_MYCBO       DDG--NPVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTDVGSP
GLGE_MYCS2       ENG--HPVHGTFATAAAALPRIARMGFNVVYLPPIHPIGKVHRKGRNNSVTAAPGDVGSP
GLGE_CORGL       ESG--TPVHGTFATTAQALERVAKMGFDTVYFPPIHPIGEVNRKGRNNTLTPEPHDVGSP
GLGE_CORP1       TDG--NPVHGTFSTTAKALKRVAAMGFDTVYFPPIHPIGEIHRKGKNNSLIAEANDVGSP
                          ..:      *      .*: :*: *:.***   *:* :.:  .   : *  

GLGE_CHLTE       WAIGS-----ADGGHTSVHPELGTMEEFEAFVQEAEAQGISVALDIAFQCSPDHPWVKEH
GLGE_METI4       WAIGS-----AEGGHKSIHPSLGSLEDFRHFVKKAADYGIEVALDIAFQCSPDHPYLLEH
GLGE_PSEAE       YAIGS-----EEGGHEAIHPELGDREDFRRLLVAVREHGMELALDFAIQCSPDHPWLREH
GLGE_XANCP       YAIGA-----ADGGHTEVHAELGGLEGFRRLIQAARAHGLEVALDFAIQCAPDHPWLQEH
GLGE_BURPS       YAIGS-----PAGGHTAVHPQLGSLDAFRRLVAAARAHDLEIALDFAVQCSPDHPWLTEH
GLGE_RHOS4       YAIGS-----EEGGHDAIHPELGDFESFGRLVEAAHAHGLEIALDFAIQCAPDHPWIREH
GLGE_RHORT       YAIGA-----AEGGHTAIHPELGTLDEFRALVAQAGEMGMDVALDIAIQCAPDHPWVSEH
GLGE_MYXXD       WAIGA-----SEGGHKAVHPKLGTLEDFRHFVETAQAHGIEVALDLAFQCSPDHPYVKEH
GLGE_PICTO       WAIGN-----DSGGHYSINSDLGSLEDFKNLLRSAREKNIMIAMDIALQCSPDHPYVRDH
GLGE_SALRD       WAIGGFLADGSKGGHKSVHPKLGGIEAFDRFVETAHDLGLEVALDVAFQCSPDHPYVEEH
GLGE1_STRCO      WAIGSPE-----GGHDSIHPALGTLDDFDHFVTEAGKLGLEIALDFALQCSPDHPWVHKH
GLGE2_STRCO      WAIGSPE-----GGHDSIHPALGTLDDFDHFVTEAARHGLEIALDFALQCSPDHPWVHKH
GLGE_BIFLO       FGIGSEL-----GGHDTVDPLLGTMDDFKALCQRAHELGLEIALDFALQCSPDHPWVKAH
GLGE_BIFLB       FGIGSEL-----GGHDTVDPLLGTMDDFKAFCQRAHELNLEVALDFALQCSPDHPWVKEH
GLGE_ARCHD       YAIGSDAA----GGHDAIEPSLGTFEDFDVFVGRAHELGMEVALDLALQCSPDHPWVKEH
GLGE_MYCTU       WAIGSDE-----GGHDTVHPSLGTIDDFDDFVSAARDLGMEVALDLALQCAPDHPWAREH
GLGE_MYCBO       WAIGSDE-----GGHDTVHPSLGTIDDFDDFVSAARDLGMEVALDLALQCAPDHPWAREH
GLGE_MYCS2       WAIGSDE-----GGHDAVHPDLGTIDDFDAFVAAARDAGLEVALDLALQCAPDHPWAKEH
GLGE_CORGL       WAIGSKD-----GGHDATHPRLGTIEDFQALLARARELNLEVALDLALQAAPDHPWAQEH
GLGE_CORP1       WAIGSAA-----GGHDAVHPQLGTLKDFQALVSTAEELGLSVALDLALQAAPDHPWARTH
                 :.**        ***   .. **  . *  :   .   .: :*:*.*.*.:****:   *

GLGE_CHLTE       PQWFRWRPDGTVQFAENPPKRYEDILPIDFE-SEDWQNLWIALREVFLFWIGKGVKIFRV
GLGE_METI4       PAWFKWRPDGTVQYAENPPKKYEDIVPFDFE-TEDWQALWEELKSIFVFWINQGVKIFRV
GLGE_PSEAE       PGWFAWRPDGSLRYAENPPKKYEDIVNVDFYAEQALPSLWEALRDVVLGWVEQGVTLFRV
GLGE_XANCP       KDWFTWRADGSIPYAENPPKKYQDIVNVDFYASGAVPDLWNTLRDAVLFWVNEGVTLFRV
GLGE_BURPS       PGWFAWRPDGSLRYAENPPKRYQDIVNPDFYARDAMPALWIALRDVVLFWIDAGVRIFRV
GLGE_RHOS4       PEWFDWRPDGTIKFAENPPKKYEDIVNVHFY-RGALPELWYALRDVVLFWVEKGVKIFRV
GLGE_RHORT       PEWFEFRPDGTIKYAENPPKKYQDIVNLAFW-GPHRQELWLALLEVFTFWAEQGVRVFRV
GLGE_MYXXD       PEWFQHRPDGTIKTAENPPKRYEDIVNFDWM-GPARESLWAELESVVLHWVKQGVNTFRV
GLGE_PICTO       PEWFYHRPDGSIRYAENPPKKYYDIYPLNFE-TKNKMALWNEMKNIFLYWISNGVKIFRV
GLGE_SALRD       PEWFYHRPDGSLRYAENPPKKYKDVHPINFE-TEAWPALWAELKSVFEYWIDHGVTTFRV
GLGE1_STRCO      PEWFHHRPDGTIAHAENPPKKYQDIYPIAFD--ADPDGLATETVRILRHWMDHGVRIFRV
GLGE2_STRCO      PEWFHHRPDGTIAHAENPPKKYQDIYPIAFD--ADPDGLATETVRILRHWMDHGVRIFRV
GLGE_BIFLO       PNWFRHKPDGSIAFAENPPKKYQDIYPIDFN--ADMPGIEKEVERIMNLWIEAGVTIFRI
GLGE_BIFLB       PNWFRTKPDGSIAYAENPPKKYQDIYPIDFD--NDLEGIEREVERIMNLWIDAGVTIFRV
GLGE_ARCHD       PEWFTARPDGTIAYAENPPKKYQDIYPLNFD--NDPEGIYKEIKRVVELWVAHGVTIFRV
GLGE_MYCTU       RQWFTELPDGTIAYAENPPKKYQDIYPLNFD--NDPEGLYDEVLRVVQHWVNHGVKFFRV
GLGE_MYCBO       RQWFTELPDGTIAYAENPPKKYQDIYPLNFD--NDPEGLYDEVLRVVQHWVNHGVKFFRV
GLGE_MYCS2       PEWFTVLPDGTIAYAENPPKKYQDIYPLNFD--NDPDGLFHEVLRVVKFWISHGVKVFRV
GLGE_CORGL       REFFTVLADGTIAYAENPPKKYQDIYPINFD--NDAPKIYEEVYRVVKFWVDLGVTTFRV
GLGE_CORP1       QDFFTVLADGTIAYAENPPKKYQDIYPLNFD--NNKSAIYAELKRIVLFWIAQGVTVFRV
                   :*   .**::  ******:* *:    :        :       .  *   **  **:

GLGE_CHLTE       DNPHTKAFGFWEWALGSIREQYPETMFLAEAFTRPKLMARLAKGGYTHSYTYFTWRNTKH
GLGE_METI4       DNPHTKPLAFWRWVIWEIKRDYPDTLFLSEAFTRPKLLYGLAKRGFSQSYTYFTWRSEAS
GLGE_PSEAE       DNPHTKPLPFWEWLIAEVRGRHPQVIFLSEAFTRPAMMARLGKVGFSQSYTYFTWRNDKQ
GLGE_XANCP       DNPHTKPFPFWEWLIADVRGRRPDVVFLSEAFTRPKMMYRLAKCGFSQSYTYFTWRNHKH
GLGE_BURPS       DNPHTKPLPFWAWMIADVRARHPDTVFLSEAFTRPSMMYRLAKLGFSQSYTYFTWRESKR
GLGE_RHOS4       DNPHTKPFPFWEWMIGEVQSQHPDVIFLAEAFTRPKVMKRLGKVGYGQSYSYFTWRNTKA
GLGE_RHORT       DNPHTKPVPFWEWLIATVKARYPDCIFLAEAFTRPPMMKMLAKIGFTQSYSYFTWRTTKA
GLGE_MYXXD       DNPHTKPTQFWAWLIRRVQEAHPQVLFLSEAFTRPKVMKALGKVGFTQSYTYFTWRNFKG
GLGE_PICTO       DNPHTKPLDFWEWLINDIKRDHPDVVFLSEAFTRENLMFELSKRGFTMSYTYFTWKLTKG
GLGE_SALRD       DNPHTKPFAFWQWCLRELREDTPELVVLSEAFTRPKTMYHLAKLGFNNSYTYFTWRNTPD
GLGE1_STRCO      DNPHTKPVAFWERVIADINGTDPDVIFLAEAFTRPAMMATLAQIGFQQSYTYFTWRNTKQ
GLGE2_STRCO      DNPHTKPVAFWERVIADINGTDPDVIFLAEAFTRPAMMATLAQIGFQQSYTYFTWRNTKQ
GLGE_BIFLO       DNPHTKPVRFWQDVIAAVTKKHPEILFLAEAFTRPGMMRALSYVGFTQSHCYFPWRNTKD
GLGE_BIFLB       DNPHTKPVRFWQDVIAAVTKKHPEVLFLAEAFTRPAMVRALSYAGFTQSHCYFPWRNTKP
GLGE_ARCHD       DNPHTKPVGFWQRLLAEFRVEHPEVIFLAEAFTNPPMMQTLGTVGFHQSYTYFTWRNERQ
GLGE_MYCTU       DNPHTKPPNFWAWLIAQVKTVDPDVLFLSEAFTPPARQYGLAKLGFTQSYSYFTWRTTKW
GLGE_MYCBO       DNPHTKPPNFWAWLIAQVKTVDPDVLFLSEAFTPPARQYGLAKLGFTQSYSYFTWRTTKW
GLGE_MYCS2       DNPHTKPPNFWAWLIAEVKNEDPDILFLSEAFTRPARLYGLAKLGFTQSYTYFTWRTAKW
GLGE_CORGL       DNPHTKPANFWQWLISAIHKSNPEVIFLAEAFTRPARLYGLAKIGFSQSYTYFTWKVTKE
GLGE_CORP1       DNPHTKPANFWEWLISTIHETHPEVIFLAEAFTRPARLYGLGKVGFSQSYTYFTWRTTKS
                 ******.  **   :  .    *: :.*:****       *.  *:  *: **.*:    

GLGE_CHLTE       ELQEYLTELTQTELREYMRPNFWPNTPDILHEELQGGSRARFIIRFVLAATLSSNYGIYG
GLGE_METI4       EIKAYMEELTSPPVVEFFRPNFWPNTPDILAGYLQYAPPSVFKMRHVLAATLSSNYGIYG
GLGE_PSEAE       ELAEYFAELNQPPWRDCYRPNFFVNTPDINPWFLQRSGRPGFLIRAALATMGSGLWGMYS
GLGE_XANCP       ELREYIEELNDGVPRECFRPHFFVNTPDINPLFLQTSGRNGHLIRAALATTLSGLWGMYQ
GLGE_BURPS       EFIDYLTELADGPAREYFRPNFFVNTPDINPRHLQQAPRTQFVIRAALAATLSGLWGMYS
GLGE_RHOS4       ELIDYLTELTTEECRHYMRPNFFANTPDINPVYLQHSGRAGFRVRLALAATLGGNYGLYN
GLGE_RHORT       ELTSYMEELVEDDPADYMRVNFFANTPDILPFHLQTGGRPAFMQRLVLAATLSSVYGIHN
GLGE_MYXXD       ELQEYLEEITQPPVSDYFRGNLWPNTPDILPEFLQNAGPGAFRLRAALAGTLSSVWGMYC
GLGE_PICTO       EITEYFKKLYSYPYNFFFRPMLFTNTPDILGRDLSMG-RNEFIIRSVLASTLSSLWGIYS
GLGE_SALRD       ALEAYGEELFHTEAAEYFRPNFWPNTPDILHDELVDGGRPAHKSRFVLAATMSSTYGVYG
GLGE1_STRCO      ELTEYLTELSG-EAASYMRPNFFANTPDILHAYLQHGGRPAFEVRAVLAATLSPTWGIYS
GLGE2_STRCO      ELTEYLEELSG-EAAAYMRPNFFANTPDILHAYLQHGGRPAFEVRAVLAATLSPTWGIYS
GLGE_BIFLO       ELEEYLPVTNG-DDGYYQHNTFWPTTPDILTAYVRDNGVAGHCVRAVLAAMGSPSWGIYN
GLGE_BIFLB       QLEEFLQETNG-KGGYYQHNTFWPTTPDILTAYVRDGGVAAHAIRAVLAALGSPSWGIYN
GLGE_ARCHD       EIEEYLMEVSH-ESSHRMRPAFWPTTHDILTPYIQRGGISAAAIRAILAATGSPTWGIYN
GLGE_MYCTU       ELTEFGNQIA--ELADYRRPNLFVNTPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYC
GLGE_MYCBO       ELTEFGNQIA--ELADYRRPNLFVNTPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYC
GLGE_MYCS2       ELTEFGEEIA--KYADHARPNLWVNTPDILHESLQHGGPGMFAIRAVLASTMSSSWGVYS
GLGE_CORGL       ELTEFATEIA--RMADISRPNLFVNTPDILHASLQHGGRAMFAIRAALAATMSPVWGVYS
GLGE_CORP1       ELEEFGTEIA--AMADVSRPNLFVNTPDILHESLQHGGRAMFAIRAALAATLSPLWGVYS
                  :  :             :  :: .* **    :          *  **   .  :*:: 

GLGE_CHLTE       PAYELCEHVPY-PGKEEYLDSEKYEIKQWDLDRP----GNIRSEIAMVNRIRHNNPALQQ
GLGE_METI4       PAFELCVNIPLEPGKEEYKDSEKYEIKTWDWNAP----GNIKEFIAKVNHIRKLHPALQR
GLGE_PSEAE       -GFELCEAAALP-GKEEYLDSEKYQLRPRDYQAP----GNIVAEIARLNRIRRENPALQT
GLGE_XANCP       -GFELCEATPLAPGKEEYLDSEKYQLRAWPERAP----GDIVDEITRFNQLRRMHPELQS
GLGE_BURPS       -GFELCESDALP-DSEEYRDAEKYELRARDWRRP----GHIGDEIARLNRARRDNPALQT
GLGE_RHOS4       -GYEICEATPVP-GKEEYFNSEKYQLRAWDFDQP----GHIQDDIRLMNHIRRTHPAMRD
GLGE_RHORT       -GFELCENAAIP-GKEEYADSEKYDFKPRDWNAE----GNIKDLIAKVNWIRNENPALQA
GLGE_MYXXD       -GYELCEGRPIP-GKEEYTDSEKYQLVAWDLDRP----GNIRDWIARLNAARRTHPALHQ
GLGE_PICTO       -GFELCENDRLD-DTEEYLNSEKYEIKRRNFNSD----NNIKDIIARLNSIRDEMPALRS
GLGE_SALRD       PPFEHVDTQQRD-HKEEYARNEKYEIRTWDWNDP----TSLQPFMARVNRLRNENPALQQ
GLGE1_STRCO      -GYELCENTPLREGSEEYLDSEKYQLKPRDWTRAAREGTTIAPLVTRLNTIRRENPALRQ
GLGE2_STRCO      -GYELCENTPLREGSEEYLDSEKYQLKPRDWTRAAREGTTIAPLVTRLNTIRREHPALHR
GLGE_BIFLO       -GYELIENKQ-RPGFEEQIDNEKYEVKVRDWSKAKQYG--VAEMLTALNKIRRAHPAALS
GLGE_BIFLB       -GYELIENRQ-RADAEEQSSNEKFEIKVRDWSAANRIG--ISKLLTSLNEIRSKHAATTS
GLGE_ARCHD       -GYELIENIA-RPGAEEHIDNEKYEFKPRNYALAEQNG--MATLLTMLNSIRSKHKALQR
GLGE_MYCTU       -GYELFEHRAVREGSEEYLDSEKYELRPRDFASALDQGRSLQPFITRLNIIRRLHPAFQQ
GLGE_MYCBO       -GYELFEHRAVREGSEEYLDSEKYELRPRDFASALDQGRSLQPFITRLNIIRRLHPAFQQ
GLGE_MYCS2       -GYELFEHRSVREGSEEYLDSEKYELRPRDFDGALARGESLEPFLTRLNEIRRLHPALRQ
GLGE_CORGL       -GYELFEHEAVKPGSEEYLDSEKYELRPRDFEGALERGDSLEDYIALLNQIRRANPALQQ
GLGE_CORP1       -GFELYENEAVSANSEEYLDSEKYELRPRDFTAALEQGDSLEPYLGTLNAIRRAHPALQQ
                   :*           **    **::.              :   :  .*  *        

GLGE_CHLTE       TSDITFVKIEVSQGQEHDQLMGYVK------CSPDGANIILTVVTLDDRNTQGGWLRFP-
GLGE_METI4       TENIRFIQ------GDNPRLLAYVK------ELPGHGDPLLIVVNMS-RNTEMGWIHFQ-
GLGE_PSEAE       HLGFQAYN------AWNDRILYFGK------RTADLANFVLVAVCLDPHEAQEAHFELP-
GLGE_XANCP       HLGTRFYQ------AHNDQVLYFGKFLDAG-YLSRSRSMVLVAINLDPQAGQDAEVEIP-
GLGE_BURPS       HLGIRFAH------APNDAVLVFSK------ATPAHDNVVVVAISLDPWHPQATDFTLDA
GLGE_RHOS4       FTRLRFYD------AHNDSVLAYGK------STEDKQDFLLFHVNLDPHAAQTFEFEVP-
GLGE_RHORT       FRTLRFFR------ADNDQILFYGK------MTGDRANIILVAVNLDPHAGQGGLLWLP-
GLGE_MYXXD       YGTLRFFS------SNNDRVLFYGK------RTPDGGSLVLMAVSLDPYAAQEALLHVP-
GLGE_PICTO       -GKIKFCE------TDNDKIIAYAR--------YNNENKILVVLNLDTMNVQSGFIRVP-
GLGE_SALRD       TRSIRFLD------TQHPDLIAYSK--------AAGDNLIVVVVSLDPHSECEGQLVLP-
GLGE1_STRCO      LRDLHFHP------TDKEEVIAYSKRQG--------SNTVLVVVNLDPRHTQEATVSLD-
GLGE2_STRCO      LRNLRFHH------TDNDALIAYSKRVG--------SDVVLVVANLDPHRTQEATISLD-
GLGE_BIFLO       YHNLTVLP------TSDPNILAFARHTPAELTGTGQADTLIVVVNLDGHNAHQSMIHLE-
GLGE_BIFLB       YHNLTILP------SANENIIAFARQTEGRFTKDGRTDTLIVVVNLDPYNEQQSSIHVD-
GLGE_ARCHD       LRNVTINP------TSNDKIVSFTKVARPEETADGVMDAVIVVVNLDPYASRDATVYLD-
GLGE_MYCTU       LRTIHFHH------VDNDALLAYSKFDPA------TGDCVLVVVTLNAFGPEEATLWLD-
GLGE_MYCBO       LRTIHFHH------VDNDALLAYSKFDPA------TGDCVLVVVTLNAFGPEEATLWLD-
GLGE_MYCS2       LRTIKFHH------LDNDALLAYSKFDPV------TGDTVLVVVTLNPFGPEESTLWLD-
GLGE_CORGL       LRNIHFHE------ADNDQIIAYSKVDAL------TGNTVLIVVNLDPRSAREATVRLD-
GLGE_CORP1       LRVIDFHS------TDNENIIAYSKVDPV------SGDAILVVINLDPTHAHSATVDLT-
                                 .  :: : :            . ::    :.        . .  

GLGE_CHLTE       --LEKFGRPHTER----FTVEDLISGRTFEWNGEWNYVELNPHQMPAHIFRVNLPS----
GLGE_METI4       --PESVGLDPSKP----YQLTDLLADVTYTWHGEWNFVKLDPEACPAHLFQLSQDGSFSP
GLGE_PSEAE       --LWEFGLPDDAS----LQGEDLMNGHRWVWHGKVQWMRIEPWHLPFGIWRVRRVDA---
GLGE_XANCP       --LWELGLPDHAS----VAVEDLWDGHRFTWHGKTQHIRLEA-TRPFALWRIRAGEVA--
GLGE_BURPS       ALYRGWGIADGER----LVAVDQTADHVETWHGRRHYVALDPHVRPFAIWRVAPAAGVAR
GLGE_RHOS4       --LWEFGLPDDAS----VEVEDLLNGNRFTWHGKWQWLELDPQTRPYAVWRLYAPGMPR-
GLGE_RHORT       --LAEMGLSDGQP----FIVEELLSGTRLEWTGSPHHYWFDPATNPAAIFRITP------
GLGE_MYXXD       --LEWLGARPDET----YQVHELMSDQRSLWQGPDVQVRLTP-EQPAALWAVHRFRRTEN
GLGE_PICTO       --LNDFSMDLNSI----YDVHDVLNNNHYKWSGEYNYVRLIPGKRQAHIMVIKNA-----
GLGE_SALRD       --IHDLGLPADEA----FSAHDLLHDAHYTWQGTHHYLRLSP-DRPAHIFRLEPAGTSEQ
GLGE1_STRCO      --MPQLGLDWHES----VPVRDELTGETYHWG-RANYVRLEPGRTPAHVCTVLRP---SH
GLGE2_STRCO      --MPQLGLDWHDS----VPVHDELTGRTYHWG-RANYVRLEPGRAPAHVFHVRRPSAAAA
GLGE_BIFLO       --LSELGLPTDRP----LNVRDELTGREFQWG-WDNYVSLAPWADVAHILSVQ-------
GLGE_BIFLB       --AKALGLPTEHP----YRVKDQLTGREYDWS-WDNFVSLAPWADVAHVFHVETGEQPLD
GLGE_ARCHD       --LSPFGISPRWDGGPIIEVTDEMSGETYLWN-EAPYVHLDPHGQVAHVLSVKVLS----
GLGE_MYCTU       --MAALGMEDYDR----FWVRDEITGEEYQWG-QANYIRIDPARAVAHIINMPAVPYESR
GLGE_MYCBO       --MAALGMEDYDR----FWVRDEITGEEYQWG-QANYIRIDPARAVAHIINMPAVPYESR
GLGE_MYCS2       --MEALGMEPYDR----FWVRDEITGEEYQWG-QSNYVRIEPAKAVAHVLNMPLIPYEKR
GLGE_CORGL       --LGALGLEAGAQ----FEVRDAITGSRYLWS-ETNFVRLEPLRDVAHIFVLPELPASRR
GLGE_CORP1       --MNAIGCEDVDH----FTVTDLVTGAQFPWN-KRTYVRLDPCADVAHILELPVVEESKR
                       .              :   .    *        : .      :  :        

GLGE_CHLTE       -----------------
GLGE_METI4       -----------------
GLGE_PSEAE       -----------------
GLGE_XANCP       -----------------
GLGE_BURPS       GARDDARDVPAQEVHER
GLGE_RHOS4       -----------------
GLGE_RHORT       -----------------
GLGE_MYXXD       AFDYYE-----------
GLGE_PICTO       -----------------
GLGE_SALRD       THAAYDRLVHA------
GLGE1_STRCO      PQIGGSHTT--------
GLGE2_STRCO      PQNGGSGAS--------
GLGE_BIFLO       -----------------
GLGE_BIFLB       -----------------
GLGE_ARCHD       -----------------
GLGE_MYCTU       NTLLRRR----------
GLGE_MYCBO       NTLLRRR----------
GLGE_MYCS2       LDLLRRE----------
GLGE_CORGL       ERLAWREIKTYRA----
GLGE_CORP1       KALSWRTPTDYSN----