CLUSTAL format seed alignment for MF_02126

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRMC_AQUAE        ----------------------------------------------------MRKVFKLN
PRMC_CLOAB        -----------------------------------------------------MKIKDAL
PRMC_CLOBH        -----------------------------------------------------MILKDLL
PRMC_FUSNN        MSYVLNLDRIALYIHYERELSEDEKTSIKQYLKKMVEENKTFDELKGEKKDFKEENLDIF
PRMC_THEYD        --------------------------------------MKALDKIR-----------EIV
PRMC_MYCTU        -----------------------------------------------------MTLRQAI
PRMC_MYCS2        ----------------------------------------------------MTRLRTAI
C8XIB1_NAKMY      --------------------------------------------------MSRHSLRAAI
PRMC_CORGL        ----------------------------------------------------MLTLGEAL
PRMC_STRCO        ----------------------------------------------------MNLLLAEV
PRMC_BIFLO        -----------------------------------------------------MLITDII
PRMC_DEIRA        -----------------------------------------------------MQLRDLL
PRMC_SYNY3        ---------------------------------------------MNKGFVSGEEFARWY
PRMC_THEEB        --------------------------------------------------MSGEALQRWW
PRMC_GLOVI        ---------------------------------------------------MRQPADGWR
PRMC_PROMA        --------------------------------------------------MSFERFFSAE
D1C517_SPHTD      ------------------------------------------------MTHDPPTLRQLL
PRMC_CHLAA        -----------------------------------------------------MTIQQAI
PRMC_MOOTA        -----------------------------------------------------MTLRQAL
PRMC_RHORT        -------------------------------MSDGDGGGEQGGGGPAEAEESALVLGRLL
PRMC_RHOS4        -------------------------------MRAADA----------------------L
PRMC_AGRFC        -------------------------------MSGGGD----------------ATVSAEL
PRMC_CAUVC        -------------------------------MT--------------------LTLVKAW
PRMC_BRADU        -------------------------------MTPRVSDPFTG-----------QSIESAR
PRMC_CHLTE        --------------------------------MPEEK---------------VWSVVELL
PRMC_RHOBA        -----------------------------MAETSNDT---------------PWTVMRLL
PRMC_GEOSL        -------------------------------MTEKPE---------------IWTIRKVL
PRMC_KORVE        -----------------------------------------------------MTLKQAF
PRMC_SALRD        -----------------------MEHPPGSDAETAEA---------------SPTRLELI
PRMC_DESVH        ------------------------------MNPASTS---------------HATLQGLL
PRMC_ECOLI        ----------------------------------------------------MEYQHWLR
PRMC_SHIDS        ----------------------------------------------------MEYQHWLR
PRMC_SALTY        ----------------------------------------------------MDFQHWLH
PRMC_YERPE        ----------------------------------------------------MNYQHWLS
PRMC_HAEIN        ----------------------------------------------------MNYKEWLA
PRMC_VIBCH        --------------------------------------------------MSVTIEAALK
PRMC_ALIF1        --------------------------------------------------MSLSIEALLK
PRMC_PSEAE        ---------------------------------------------------MTTICTLLK
PRMC_SHEON        ------------------------------------------------MADQSCIAEALQ
PRMC_XANCP        -----------------------------------------------------MSEAPAV
PRMC_COXBU        ---------------------------------------------------MLSIKEATK
PRMC_BORPE        ----------------------------------------------------MTLLK---
PRMC_BURPS        ----------------------------------------------------MNTTKPSP
PRMC_NEIG1        ------------------------------------------------MFKPHRRQTGRK
PRMC_BACAN        -------------------------------------------------------MRVYE
PRMC_BACCR        -------------------------------------------------------MRVYE
PRMC_BACSU        ------------------------------------------------------MKTIFE
PRMC_STAA8        ------------------------------------------------------MVNYKE
PRMC_ENTFA        -----------------------------------------------------MAKRYFE
PRMC_LISMO        ------------------------------------------------------MTQISQ
PRMC_BACTN        ------------------------------------------------------MNRITA
PRMC_FLAPJ        ----------------------------------------------------MLIKNYRT
PRMC_LACLA        -----------------------------------------------------------M
PRMC_STRR6        -------------------------------------------------------MKLAQ
PRMC_BUCAI        ------------------------------------------------------MNIKKW
PRMC_FRATT        ---------------------------------------------------MSNITISQL
PRMC_MESFL        -----------------------------------------MMNNVRKLKHNYKIMNNAN
PRMC_MYCMS        -------------------------------------------------------MNNTI
PRMC_LEPIN        -------------------------------------------------MQHPDSILTLL
PRMC_CHLTR        -------------------------------------------------------MKKLL
PRMC_DICTD        ---------------------------------------------------MAQPLREVL
PRMC_THEMA        -------------------------------------------MDTRKNVSGAERKIWSL
O83091_TREPA      -----------------------------------MYCVSRECNLVQELCTIRQARMYAR
PRMC_BORBU        -----------------------------------------------------------M
                                                                              

PRMC_AQUAE        KVKVKELLKKVESEYRRDAEIILSYLLKVSPSQIPLMYAREIPEEIVK----RFFKQMKE
PRMC_CLOAB        IKAYSVLKETNDEFYMEDSQILLSYVLKKDRIFLITNREYEIEENSLK----QYFDYINM
PRMC_CLOBH        IEGYGVLKKASIGSYQIDAQLLLGKVLKKDRLFILTNPDYHIKEEEKE----KYFQLIDL
PRMC_FUSNN        NKSVEYLKKNGVPNPLLDTEYIFSDVLKVNKNTLKYSMSREIKEEDKN----KIREMLVL
PRMC_THEYD        NKFSFNIR---------EAQEIICHVLKIDKIQL-YTENPEITSEQAH----TIKSLIER
PRMC_MYCTU        DLAAALLAEAGVDSARCDAEQLAAHLAGTDRGRLPLFEPPGDEF-------FGRYRDIVT
PRMC_MYCS2        EAATATLAAAGVATPRIDAELLAAHSLGVDRGRLMFVDDPDPEA-------LAAFEHLVA
C8XIB1_NAKMY      LDATRTLEAAGVASADVDAQELAAHLMGVPRTRLGLTPLVEQSF-------LTDYQALVE
PRMC_CORGL        RDATATLERAGVASPLVDARLIAAHLLGC--GPLDIALRMRDEV-------PAGFAAAVE
PRMC_STRCO        AQATQRLADAGVPSPRTDAEELAAYLHGVKRGELHTV--PDADF-------DARYWEVVA
PRMC_BIFLO        NQASSQLREAGIETPEHDAKLLLAEAAGVELRDVDRALLMGEELGTTGQ--LAVFRAMLD
PRMC_DEIRA        TQATARLTRAGVPSPEVDARLLLEHVLGLNRTAFLLRGGEEIGPDA-----EARAWDSIE
PRMC_SYNY3        ATARQMAIAHGIETG--ELNWLLQGWTDLDRLTL-RLQDFAHREIALQETWENIQRGWRR
PRMC_THEEB        HWAQGIIPAPERESGLRELKQFLRAFTGLSPLEI-TLRRFPP-QIHLKLPLTELQERWQR
PRMC_GLOVI        EQALAEARVHDIDAA--EIDYLIEAVTGLDRLRV-RLG----GPQALEAHREKLAALWRR
PRMC_PROMA        EILIWRKQELSKGGRAVDLDWLLDIGGGLGWSTLQELKIFQSSFHKLDLSLEELSLIWMR
D1C517_SPHTD      HDGRQQLEQAGDETARLDAEVLLRHLLSIDRATLYARLPDPAPPDT-----VERYRDLIA
PRMC_CHLAA        QHAITQLRTI-SPTARLDAELLLAHILGWSRAKVVAERDHVLTPEQ-----EMAFNALIE
PRMC_MOOTA        GEAVRRLAAGGVERPRLEAEVLLGWACSLTRPRLLARLEEELAPAA-----AGRFWQAID
PRMC_RHORT        DRGAWRLKVAGVEKPRRDARLLAGHVLGLSPGAVLLADDRVVTPEE-----AQALEAVIA
PRMC_RHOS4        RAAVPRLAAAGIDEAARDARRLLAHAMAIDPARLTLHLPDPLPPEA-----AARFEAALA
PRMC_AGRFC        IAARKRLQAAGVADPLVDARLLIADVTGFSLTDFVMKPEHPVTQDE-----SARIAAMIE
PRMC_CAUVC        TAAKDRLKDAGIDQPSIDARLMLEVAAGVTRTEIVTDPYRELSAEQ-----IATLNDYLE
PRMC_BRADU        RTLAARLRSAQLEEAELDARILLGAALGLDLTGLIAQAARLLTEAE-----ASRIAQHAQ
PRMC_CHLTE        KTTIAFFAEKKIDEPRLSAELLLGHVLGLQRLQLYLDHERPLTLKE-----LEAFRAACR
PRMC_RHOBA        EWTTDFFRKKGSESPRLDAEILLAHARGCQRIELYTSFDKVPEEEQ-----RVAFRELVR
PRMC_GEOSL        DWTRGYLAEKGVENARLETEWLLSAALGLDRVGLYVNFDKPLNPEE-----LAACRGLVA
PRMC_KORVE        DSALKHLEAADTPSPRLSAELLLMFSLNCDRAYLFTYPERELTADE-----QARYDEAIA
PRMC_SALRD        DRAARRLGAADRSAPRRTAEWLLAELLDCDRAHLYAHPDRTVAAAA-----AEQFHRMVG
PRMC_DESVH        RHARQRLEAAEVDAPRLSAEIILCHALSLRRIDIMLTPDRIVEEAD-----CILFSELVA
PRMC_ECOLI        EAISQLQA---SESPRRDAEILLEHVTGRGRTFILAFGETQLTDEQ-----CQQLDALLT
PRMC_SHIDS        EAISQLQA---SESPRRDAEILLEHVTGKGRTFILAFGETQLTDEQ-----CQQLDALLT
PRMC_SALTY        EAVNQLRD---SDSPRRDAEILLEYVTGKGRTYIMAFGETPLTDVQ-----QQQLADLLQ
PRMC_YERPE        LAAARFTH---SDSPKRDAEILLSFVTGKARTYLLAFGETEITAEQ-----LLWLETLAN
PRMC_HAEIN        QAIADLAKKNPTENSKIDALVLLQHATGKSRTQILAFDDTEIDEKV-----RLKLTALLD
PRMC_VIBCH        AATEQLQQSG-SDSPALDAAVLLCHVLAKPRSYLLTWPDKILEKPT-----LASLELLLA
PRMC_ALIF1        RSIQSLTLEG-SDSPQVDAAVLLCHVLDKPRSYLLTWPEKIVSDEE-----LGNFNALLE
PRMC_PSEAE        DS--QLPD--SP-SARLDTELLLAAAMGKPRSFLRTWPERIVPREA-----NERFDDWIA
PRMC_SHEON        WAYVQLAA--SSESAHLDAEVLLLYCLNKNRAYLYTWPEKALSVEQ-----WKRFQQMVQ
PRMC_XANCP        MSAEQLLREAVIRIARSDAEPLLLHALGRDRAWLFAHGRDPVPAEQ-----AQRFGALVE
PRMC_COXBU        NISQQLTT--VSKTPRLDAELLLECVLKKSRADLFAYPEIQLNSSQ-----QKTLSAYVK
PRMC_BORPE        ----DLLAD--PGLPRLEARMLAEHVLGRSRAWLLAHDTDPVEPAH-----EAAWRQLAA
PRMC_BURPS        ATAAELLRA--SPLDALDARILLAHALGWSRTQLITRADEPLDAAA-----RARYLALQA
PRMC_NEIG1        MTFDEWLGL--SKLPKIEARMLLQYVSEYTRVQLLTRGGEEMPDEI-----RQRADRLAQ
PRMC_BACAN        ALKWASSFLQENGRDENAGEIVLCHVLKTNRTGLLMNMREEITAEQET-----SFTEFIH
PRMC_BACCR        ALKWASSFLQENGRDENAGEIVLCHVLKVNRTGLLMNMREEITEEQEK-----SFTEFIH
PRMC_BACSU        ALKWASSYLTEAGREENAAELLLLYDTGMERSKLLASLQEPIGEDELY-----RFKRHVE
PRMC_STAA8        KLDEAIHLTQQKGFEQTRAEWLMLDVFQWTRTDFVVHMHDDMPKAMIM-----KFDLALQ
PRMC_ENTFA        VLNWASSFLEAQGKEGYAIHYVFLERKGWDKTQWLLHMQEEMPQEEEE-----QLKTDLA
PRMC_LISMO        LLKKAEAILFEKGLDQNAAEILLETRMGLSRSELWMEISRELEPNHEK-----QFEEDFA
PRMC_BACTN        YIRQSLQDIYPPEEVKALSMLICCDMLGVDALDIYMGKDIILSACKQR-----ELENIIF
PRMC_FLAPJ        QFVQALASIFDEKEIESFFYIILEAFHQLKRVDLVLSPDLKLDNIQLL-----QWETVLL
PRMC_LACLA        LWIEAVRTLSADLEDPFELEFVWRNLHELNKLSWLNLMREKITDQELK-----LLTEVSK
PRMC_STRR6        LFSNFEEELIRQGEEAESLSFVYRSLKNLSFTDFIFALQQEVTTEEEKQ----FVEDIYQ
PRMC_BUCAI        IKKSIQKLSHVD-NPKFESELLLSYVTKHTRSFIISSDEIQLTEKQ-----YKYLNHLIH
PRMC_FRATT        LALSLAKFNQCDISTKHDLQMIICDVLGVDKTYLYINLDKQLDKNT-----LKKIDEKIL
PRMC_MESFL        IKIALDFLLENSKIGKSDAIEIISFITKIEYSEVLFSQEKVLNKKQ-----FKKIIKISK
PRMC_MYCMS        FNVLNKIKNTNISLNKADVYHILEHIINKDYQWIISNLDHKLTKKQ-----IYKIDQILD
PRMC_LEPIN        KKSEEFLKKKEIPSARLDAEILLADLLNLQRVKLYVNFERLLNETE-----KNAYRERIL
PRMC_CHLTR        REASEYLLSRGIRFPQREAEDILMDLLEISSRSALHQAKLSSEEQS-------LYWKRLR
PRMC_DICTD        VWLNNKIKEINPESAWLEAELLVAFVLNKDRAFIYTIDFLTDEEVE-------KLKKLLD
PRMC_THEMA        IRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEE------KRILELVE
O83091_TREPA      ALFQDAPCLRGQNTPLLDADLILSKLLAKPRAWILAHQQDEIASVA------HEFKRLVH
PRMC_BORBU        NINEVINYAKGXNLDTIEALLILELILKTKKELIIANIKKSLTKKE-----KKLFFDQID
                                       .                                      

PRMC_AQUAE        RKKG-IPTAYVIGEWECMGRVFKVKKGVLVPRPETEILIERTLELIPQD-----------
PRMC_CLOAB        RKKK-MPIRYITEKCEFMGLDFHVEKGVLIPRPDTEILVEAVLEYIELN-----------
PRMC_CLOBH        RKNK-MPIKYILGTTEFMGLNFNIKKGVLIPRPDTEILVETVLEEIKNK-----------
PRMC_FUSNN        RAKKRKPLQYILGEWEFYGLPFKMSEGVLIPRADTEILVEQCIQLMREVEE---------
PRMC_THEYD        RLKK-EPLQYIIGECYFYNIKIKVGRGVLIPRPETEILVEQVLERQKLISN---------
PRMC_MYCTU        ARARRVPLQHLIGTVSFGPVVLHVGPGVFVPRPETEAILAWAT-----AQSLP-------
PRMC_MYCS2        ARAKRIPLQHLVGTAAFGPLTLEVGPGVFIPRPETESLLEWAV-----AQQLP-------
C8XIB1_NAKMY      RRAQRIPLQHLTGSVQLGRATVAVGPGVFVPRPETESLLVWALH----AIAAV-------
PRMC_CORGL        RRARREPLQHILGTAPMGPLDLHVGPGVFIPRPETEVLADWAVRQ---VAGDV-------
PRMC_STRCO        RREAREPLQHITGRAYFRYLELQVGPGVFVPRPETESVVGWAIDA--VRAMDV-------
PRMC_BIFLO        RRAKREPLQYITGHAPFRYLDLKVGPGVFIPRPETETVVQAGLDW--LTKNGM-------
PRMC_DEIRA        RRAARVPLQHLTGEVEWGGVRLTSDARALVPRPETEWLLHLALE----ELRRV-------
PRMC_SYNY3        RVEEKYPVQYLLGQTQWRDFVIKVTDDVLIPRPETELIIDIVQHEHSALSPSN-------
PRMC_THEEB        RWQERVPLQYLIGVAHWHDLELVVTPSVLIPRPETEELLAVVA---ATVPPWQ-------
PRMC_GLOVI        RIEEAMPLQYLLGTAHWRDLQLQVNPAVLIPRPESEALVDVAV----DFCRSC-------
PRMC_PROMA        HLSDQIPLQHLVGKCPWRDFELKVNSSALIPRQETEILIDIALK--KVDAGLM-------
D1C517_SPHTD      RRAAGEPVAYITGHREFMGLDFLVDRRVLIPRPETEYLVEWALAWLRERGG---------
PRMC_CHLAA        RRANREPVAYLIGHREFFGLDLFVDRRVLIPRPETELLVELTLKEAQRFNH---------
PRMC_MOOTA        RRAAGYPLQYLTGHQEFMSLDFKVTPAVLIPRQDTEVVVEAVLERLDPC-----------
PRMC_RHORT        RRETREPVSRILGHRGFWRFDLALGADTLDPRPDTETLVEAGLAVLEGCG----------
PRMC_RHOS4        ARAARQPVGQIVGERLFWGRRFRVTRDTLDPRPETEGLIEAALAEPFA------------
PRMC_AGRFC        RRAEGEPVHRILGHREFHGLDLLLSKETLEPRPDTEVLVDTLLPALKEAVSRKG------
PRMC_CAUVC        RRARREPVSHIIGRKGFWKILLQVNKNVLTPRPETEVIVDEVLKAFPEHM----------
PRMC_BRADU        RRIAGEPVARILGTREFWGLPFRLSDATLVPRPDTETVVERALELFREQKATQ-------
PRMC_CHLTE        ERLQGRPVQYIAGEAFFYGYQFFVDERVLIPRPETELVLEHAMERLAASGLDSA------
PRMC_RHOBA        RRGEGAPVAQLVGYREFYSISIRVDENVLVPRPETEHLVIEAIDQIKGRLSDRP------
PRMC_GEOSL        RRAKREPLQYILGTQEFCGLDFVVTPSVLIPRHDTEVIVEEALRRAPHAA----------
PRMC_KORVE        RRCHGEPAQYITGHQEFYGRDFLVSPAVLIPRPETEHLIEAVLELAPREVR---------
PRMC_SALRD        RRVQGEPLQHILGYASFYGLRLRVSPDVMVPRPETETVVDRALTCIEEVSR---------
PRMC_DESVH        RRATGEPLAYIVGEKEFFGRDFAVNPSTLIPRPETEHLIETALESLRSGP----------
PRMC_ECOLI        RRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL----ARLPEQP------
PRMC_SHIDS        RRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL----ARLPEQP------
PRMC_SALTY        RRKQGEPIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQAL----ARLPVKT------
PRMC_YERPE        RREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQAL----ARLPAMP------
PRMC_HAEIN        RRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEILVEKALQIALEKLEENP------
PRMC_VIBCH        RRRAGEPMAYILGEREFWSLPLKVSPSTLIPRPDTERLVELAL----DKAALID------
PRMC_ALIF1        RRLAGEPIAYIVGYREFWSLPLKVSPTTLIPRPDTERLVEVAL----DHLTPNA------
PRMC_PSEAE        RRRNGEPVAYILGHQGFWSLDLEVAPHTLIPRPDTELLVETAL----ATLAADT------
PRMC_SHEON        RRQQGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVESAL----NLPLESN------
PRMC_XANCP        RRHQGEPVAYLTGSRGFWTLDLAVSTATLIPRADTETLVELAL----ERLELTA------
PRMC_COXBU        RRLKGEPIAYILGQKEFWSLNLKVTPDVLIPRPETEMLVEWIL----KNLPKDE------
PRMC_BORPE        RRLAGEPMAYLLGGREFMGHWYALTPDVLIPRPDTELLVETAL-----HWLQGR------
PRMC_BURPS        RRAAGEPIAQLTGAREFFGLEFDITPDVLIPRPETELLVETAL-----DAIDGI------
PRMC_NEIG1        RRLNGEPVAYILGVREFYGRRFTVNPNVLIPRPETEHLVEAVL-----ARLP--------
PRMC_BACAN        KHVEGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDE-------
PRMC_BACCR        KHVEGIPIQYMIGYEIFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDE-------
PRMC_BACSU        MHKEGVPVQYIIGKEFFYGREFMVNDDVLIPRPETEEVVFHLLEKYRSVFSED-------
PRMC_STAA8        RMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLED------------
PRMC_ENTFA        QLLTDYPAQYLLGQAEFYGHSFIVNEHTLIPRPETEELVERCLKANPDT-----------
PRMC_LISMO        RYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEAFLKKHP----------
PRMC_BACTN        RLQKNEPIQYIRGYAEFCGRNFRVAPGVLIPRPETAELVDLIVKENPD------------
PRMC_FLAPJ        QLKEQKPIQYILGETQFFGLPFYVNENTLIPRPETEELVEWIIKENLKISSL--------
PRMC_LACLA        RLHQNEPPQYIVGWAEFRDLKLKVDERVLIPRPETEELVEMILAENEK------------
PRMC_STRR6        QLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTENLE------------
PRMC_BUCAI        RRSLGEPIAYIIKEKEFWSLSLCVSYDTLIPRPDTEILVERALSKIKSN-----------
PRMC_FRATT        RLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDA---------
PRMC_MESFL        KLAKGKPLAYILGYKIFRTHKILVNKNTLIPRMETELIVDYVNEFINSQNE---------
PRMC_MYCMS        LLKQNYPLAYILKSKYFYSNIFFVNKDVLIPRNESELIIDHVSEFVKNNND---------
PRMC_LEPIN        ERSKNKPTAYITSQKAFYNSIFFVNENVLIPRPETEELVEKVLSDFKGNIG---------
PRMC_CHLTR        KRGDRCPTAYIHGKVHFLGVELQVTPQVLIPRQETEIFVEQIIGYLQMHKE---------
PRMC_DICTD        LRKKGIPLNYIIEKKQFYDIELFVERGVLIPRSETEILIEVAKDTILKEGY---------
PRMC_THEMA        KRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGI---------
O83091_TREPA      LRCRGRALAYLTREKEFFGLRFRVTRATLIPKPDTELLVESVLAHVASQMMKPRSVSVHK
PRMC_BORBU        KIEKGIPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLAEEALIQIQQNG----------
                        .   :                 : *: ::  .                      

PRMC_AQUAE        -----REMVGFELGSGTGCISINLLIERPK--------LVMYATDVNPDAVELTKENAKL
PRMC_CLOAB        -----NYKKVCDVCTGSGAIGLSIAKYAKD--------VEVLCSDISPDAIRVSKINRQG
PRMC_CLOBH        -----NYKQICDVCCGSGIIGITIGYTLNN--------TEIICYDIEDIPYNTTKENILK
PRMC_FUSNN        -----PN--ILDIGSGSGAISIAVANELKS--------SSVTGIDINEKAIKLAIENKIL
PRMC_THEYD        -----TGNRILDLCTGSGCIALAIGKNAPE--------FQIFGIDKSEKAVKYATENKAL
PRMC_MYCTU        -----ARPLIVDACTGSGALAVALAQHRANLG----LKARIIGIDDSDCALDYARRN---
PRMC_MYCS2        -----RDAVIVDLCTGTGALALALAQHRP--------QARVIAVEDSPAALEYARCN---
C8XIB1_NAKMY      -----ERPVVVDLCTGSGVLALAIAAERP--------DARVIGVERSSAALAWARRNVTN
PRMC_CORGL        -----EKRKIVDLCTGSGALAAYIGHALI--------DATLYAVELDPGAATWAQRNFD-
PRMC_STRCO        -----VEPCIVDLCTGSGAIALALAQEVP--------RSRVHAVELSEDALKWTRRNME-
PRMC_BIFLO        -----IHPCVVDLCAGSGAIGLSVVSEVP--------GSQVWAVELSPNTAEWTRRNLSE
PRMC_DEIRA        -----EKPRVLDVGTGTGALALGLKAAIP--------QAEVTATDLSPEALSLAREN---
PRMC_SYNY3        -----CADHWVDLGTGSGAIALGLAATFP--------QALVHAVDCSGSALAIARENAQ-
PRMC_THEEB        -----QQGHWLDLGTGSGAIAIGLARLFP--------AALIHAVDCSSEALEVAQVNIQ-
PRMC_GLOVI        -----AGARVVDLGTGSGAIAVAVARALP--------GATVWAVDASEAALVVAGANIE-
PRMC_PROMA        -----KYGRWADLGTGSGALAVALARALP--------LWEGHAADCCNDALALAESNIN-
D1C517_SPHTD      -----DRLVV-DVGTGSGAIAVSLAAHADD------PALRVVGSDRSLDALRVAAINRDR
PRMC_CHLAA        -----TPLIIADIGTGSGAIAIALAMHL--------PHALIYGVDISPDALAVAAINVTR
PRMC_MOOTA        -----ESYTIADCGTGSGAIALSLAHYL--------PRARVYATDISPAALTVAQENARK
PRMC_RHORT        -------GRILDLGTGSGCILLALLADR--------PGAIGLGIDIAPGAVRVALRNARA
PRMC_RHOS4        --------TVLDLGTGTGCIAVTLLAER--------PAAHGIATDLSPAALAVAAENAAA
PRMC_AGRFC        ------SARILDLGTGTGAICLALLKEC--------AQASGIGSDISADALETAAKNAAR
PRMC_CAUVC        ------AFSMLDLGVGSGTILLAVLAER--------PAAKGLGIDASSEALAVARENAAN
PRMC_BRADU        ------QPRIADIGTGSGAILLALLHDI--------PGAFGVGTDLSLNALETARGNAVT
PRMC_CHLTE        -----DSPSILDVGTGSGCIAITLALRL--------PGARVTAADVSADALDVARRNADA
PRMC_RHOBA        ------SPTVLDIGTGSGAIAVAIAKSL--------PKTQVTAVDISLTALDIAKWNVEN
PRMC_GEOSL        --------AVLDIGVGSGCIAVALAKQL--------PHAQVVGVEQSPGAIALAQRNAER
PRMC_KORVE        -------WEVLDVGTGSGCIAATLAKEF--------PRMKVTAVDISPEALQIAQANAAR
PRMC_SALRD        -------PRVLDAGTGSGCIALALKHER--------PDAEVHACDVSTDALAVARANAQD
PRMC_DESVH        -------ARFVDAGTGSGCIAVTLCAER--------ADLSGLALDMSAPALATASHNARR
PRMC_ECOLI        -------CRILDLGTGTGAIALALASERPD--------CEIIAVDRMPDAVSLAQRNAQH
PRMC_SHIDS        -------CRILDLGTGTGAIALALARERPD--------CEITAVDRMPDAVALAQRNAQH
PRMC_SALTY        -------CRILDLGTGTGAIALALACERPD--------CEVTAVDRMPDAVALAIRNAEH
PRMC_YERPE        -------CRILDLGTGTGAIALALATERRD--------CAVIAVDINADAVALARHNAEK
PRMC_HAEIN        -----PHFRILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMSDVVALAQSNAER
PRMC_VIBCH        -------GELLDLGTGTGAIALALASELPT--------RQVTGIDLRPEAAELARENATR
PRMC_ALIF1        -------QSILDLGTGTGAIALAIASEMPT--------LNVIGVDYQDDAVELAKGNAKI
PRMC_PSEAE        -------ATVLDLGTGTGAIALALASERPL--------WTVTAVDRVEEAVALAERNRQR
PRMC_SHEON        -------AKVLDLGTGTGAIALALASERAA--------WQITAVDKVEDAVALAKANRTN
PRMC_XANCP        -----G-VRVVDLGTGSGAIALAIASERPQ--------AQLIATDASADALAIARHNAHA
PRMC_COXBU        -----K-LRIADLGTGSGAVALAIAVERPH--------WTIDATDNSQAALKIAEINAKQ
PRMC_BORPE        -----AAPRVLDLGTGSGAIAVSVALGCPQ--------AEVTATDLSAAALAVAEGNAQR
PRMC_BURPS        -----ASPCVLDLGTGSGAIAVSIASERPD--------ARVWALERSVAALDVARRNARK
PRMC_NEIG1        -----ENGRVWDLGTGSGAVAVTVALERPD--------AFVRASDISTPALETARKNAAD
PRMC_BACAN        ------KLHVADIGTGSGAISITLALENKN--------LHVYTVDIAQESIEVAKENAKT
PRMC_BACCR        ------KLHVADIGTGSGAISITLALENKN--------LHVYTVDIAQESIEVAKENAKA
PRMC_BACSU        -----GKLEVVDVGTGSGAIAVTLALENQS--------FSVSAVDISKEALQVASANAEK
PRMC_STAA8        ------DATIVDIGTGSGVLAITLKCEKPD--------LNVIATDISLEAMNMARNNAEK
PRMC_ENTFA        ------PLTVVDVGTGTGAIAVSLKLARPN--------WRVIAIDLSEEALTVAKQNAQA
PRMC_LISMO        ------VKNVLDVCTGSGIIAIALKKAFPE--------ISVTASDISAPALVVARKNALL
PRMC_BACTN        ------ARRLLDIGTGSGCIAISLDKNLPD--------AKVDAWDISEEALAIARKNNEE
PRMC_FLAPJ        -----KNLKILDIGTGSGCIAISLAKNLPN--------ASVFAIDVSDKALATAQKNAVL
PRMC_LACLA        -----DSLKILDIGTGSGAIAISLAQAREN--------WSVKASDISKEALTLAAENAEI
PRMC_STRR6        -----TNLSVLDIGTGSGAIALALAKNRPD--------WSVTAADISQEALDLARENAKN
PRMC_BUCAI        ------SACILDLGTGCGAIALALASINSN--------WNIIGIDKSENALAIARINASK
PRMC_FRATT        ------QLKILDLGTGTGAIALALAAELAN--------SQVVAVDLYQQSLDVAKKNAQA
PRMC_MESFL        ------KISVLDLCCGSGCIGISIAIENKDKM------ENVTFSDISKKALNITSKNIEN
PRMC_MYCMS        -------LLIVDLCTGSGCLGISCALLNDQ--------NKVILTDISYKSLKVANKNIKK
PRMC_LEPIN        ------EQNVLDLCTGSGCIGISLKLARKD--------WNITLSDISKEALEVATKNAIQ
PRMC_CHLTR        ------KTTFYDVCCGSGCIGLAVRKHCPH--------VRVTLSDISPEALAIAESNARS
PRMC_DICTD        -------KKIVEIGVGSGNISITLAKEFKD--------IKIYACDISPEAIKVARFNAKK
PRMC_THEMA        -------KTVADIGTGSGAIGVSVAKFSDA---------IVFATDVSSKAVEIARKNAER
O83091_TREPA      DTSALPVLKIFEACTGCGCIAIALMHMLRARG---TPPLYVIASDICMRALAVARYNARR
PRMC_BORBU        ------FKKILDLCCGSGCIGLSIAYYIRK---------KVILSDISTKALQIVEKNTKK
                             :   * * :                        :           *   

PRMC_AQUAE        H-------KVDDRLFVFLG--NAFEPVK------------GMKFDFIVSNPPYIPENFWE
PRMC_CLOAB        L-------NLEDRVKIENGDLLEKPIER------------GEKFDIVVSNPPYIREDEIP
PRMC_CLOBH        H-------NLQDRVKALKSDLLTEAIKE------------KRRFDLIVSNPPYIREDVIE
PRMC_FUSNN        N-------KIENVNFIESN--LFGKLDK------------DFKYDLIVSNPPYISKDEYE
PRMC_THEYD        N-------NIKNVIFLVGD--MFNPF-K------------EKIFACITANPPYVKTDEIS
PRMC_MYCTU        ------AAGTPVELVRADVTTPRLLPEL------------DGQVDLMVSNPPYIP--DAA
PRMC_MYCS2        ------AAGTSVEVLAADVTAPDLLPEL------------DGAVDLVVSNPPYIP--EGA
C8XIB1_NAKMY      AG----AGRTKVELRGGDIFDERLLVDL------------EGLADLVTANPPYVP--EGT
PRMC_CORGL        ------EFAPQVKLIHGDVTDPTLLAEV------------HGTIDLVVSNPPYVP--ESD
PRMC_STRCO        --------GSRVDLRQGD--ALTAFPDL------------DGQVDLVVSNPPYIPLTEWE
PRMC_BIFLO        TAKKYPSIASNYHLEIADATSFATLAQL------------DGTVDIVITNPPYVP-QTDI
PRMC_DEIRA        ---------AALSGLDVKFVEGSLLAGL------------SGPFNLIVSNPPYLPTADRA
PRMC_SYNY3        ------LNQFGDRIQFHQGYWWEPLEHL------------KGQVQGMVSNPPYIPQRELA
PRMC_THEEB        ------KYALGDRVRCYVGNWFDPIVPL------------QGQVQGIVSNPPYIPTSVVA
PRMC_GLOVI        ------RYGLSEQVHLLRGNWFVPLP--------------TQPFDAVLSNPPYIPSAEIA
PRMC_PROMA        ------TLTENANVSLHLGDWWEPLKPW------------WGNFDLVVANPPYIPKTHLS
D1C517_SPHTD      ------LAPGRVALVAGDLLSWCRP-----------------GIDLVLANLPYLRPDQAH
PRMC_CHLAA        Y-----RLDDRIRLLEGDLCTPLPA-----------------PVDILVSNPPYTILTEID
PRMC_MOOTA        L-----GLAARVTLLQGDFLAPLRGL----------------KLDALVANPPYI-PTAAL
PRMC_RHORT        L-----GLERRALFAVGDWAAAV-----------------AGPFDLIVSNPPYIPSADIA
PRMC_RHOS4        L-----GVASRLELRLSDWFAAV-----------------PERVDLILSNPPYIAADEMA
PRMC_AGRFC        N-----GLDSRFETIRSNWFEKI-----------------SGRFDIIVSNPPYIRTDIVA
PRMC_CAUVC        L-----DLNTRAALLHGDWTTGLG----------------SDSFDLVVSNPPYIPTEVID
PRMC_BRADU        L-----GLADRSAFVACSYLAAL-----------------RGPFDLIVSNPPYIPSAEIP
PRMC_CHLTE        H-----GVSERIRFVEADALSASFADAV------------GGPFDLLVSNPPYIPEAEWA
PRMC_RHOBA        L-----KLSDRVTLLQSDLFDGLEPDQ---------------TFDVICSNPPYISQSEYD
PRMC_GEOSL        H-----G--ARVTLFEGSLFEPLGDQR----------------FDLIVSNPPYIPTADLE
PRMC_KORVE        L-----EAQVEFRVSDLLSAIEPG--RQ---------------FDMIVSNPPYVGECEAD
PRMC_SALRD        L-----GLDVRFFEGDLCAEVPAATPRD---------------VDLLVSNPPYIPDAEAE
PRMC_DESVH        H-----GVAQRLAFVRGDFTTSLLRSGS---------------LDLYASNPPYISEAEYT
PRMC_ECOLI        L------AIKNIHILQSDWFSALA----------------GQQFAMIVSNPPYID-EQDP
PRMC_SHIDS        L------AIKNIHILQSDWFSELA----------------GQQFAMIVSNPPYID-EQDP
PRMC_SALTY        L------AIRNVRILQSCWFSALS----------------GQQFDMIVSNPPYID-AQDP
PRMC_YERPE        L------TIDNVCFLQGSWFEPVS----------------GR-FALIASNPPYID-ANDP
PRMC_HAEIN        N------QL-NVEFLQSRWFDNIT----------------GK-FDLIVSNPPYID-AQDE
PRMC_VIBCH        L------AIHNAQFFQGSWFSPLAD---------------GTKFALIVSNPPYIE-ENDP
PRMC_ALIF1        N------HINNVEFRQGSWFEPISL---------------SDKFDIIVSNPPYID-GNDP
PRMC_PSEAE        L------LLENVEVRRSHWFSALD----------------GRRFRMIVGNPPYIP-ASDP
PRMC_SHEON        L------KLEQVEILQSDWFSAVT----------------SHDFDLIVSNPPYID-EADE
PRMC_XANCP        H------GLHNVECRLGHWLQPLA----------------GERFDLIASNPPYIA-AADP
PRMC_COXBU        H------EIKNCNFYHGEWCQALP----------------RRDYHAIVGNPPYIP-DKDQ
PRMC_BORPE        L-------GARVRCLAGDWYEA-LPA--------------QDRYDLIVSNPPYIA-REDA
PRMC_BURPS        LLDPA-RAGGPLRFLESDWYAA-LDP--------------GLRFHVVVSNPPYIA-RHDP
PRMC_NEIG1        L-------GARVEFAHGSWFDTDMPS--------------ERQWDIIVSNPPYIE-NGDK
PRMC_BACAN        L-------GAEVTFYHGDLLSPFYETG--------------QKLDVVVSNPPYIPEEDWR
PRMC_BACCR        L-------GAEVTFYHGDLLSPFHKTG--------------QKLDVVVSNPPYIPEEDWR
PRMC_BACSU        L-------GANVRFYQGDLLEPFIKAG--------------KKADIIVSNPPYISEEEMA
PRMC_STAA8        H-------QSQIQFLTGDALKPLINEG--------------IKLNGLISNPPYIDEKDMV
PRMC_ENTFA        L-------GAGIEFYHGNGLQPV--AS--------------EKIDLLISNPPYISEQEWY
PRMC_LISMO        L-------NADVRFVETDLLEAFKQNE--------------ERFDMIVANPPYISEAEKA
PRMC_BACTN        L-------DAQVTFRRQDVFSADGIQG--------------TSYDIIVSNPPYVTETEKT
PRMC_FLAPJ        N-------EVDITFIEKNILQTEDLN---------------QEFDIIVSNPPYVRNLEKK
PRMC_LACLA        N-------QANLEFIQSDVLDKITDS-----------------FDIIVSNPPYIAFDETY
PRMC_STRR6        Q-------NLQIFLKKSDCFTEISEK-----------------YDIIVSNPPYISREDES
PRMC_BUCAI        L------NFKNVTFFFSDWFLNIKK-----------------KFNIIVSNPPYVS-KKEI
PRMC_FRATT        N------NITNVKFIQSSWYTNLDTD----------------KFDIIVSNPPYID-LADT
PRMC_MESFL        N------NLVNWTKVVKSDFLNSIIKQ-------------QNKFNILVCNPPYID-FNDV
PRMC_MYCMS        F------NLIN-TSCLNGNFIDVLIKN-------------NLKANLIICNPPYID-INDQ
PRMC_LEPIN        ILG----EEKHIQFLESDLFLSIPKES---------------KFNLIVTNPPYIPISDKA
PRMC_CHLTR        N-------ALAVDFLLGDLFDPFSFP-----------------ADVLVCNPPYLSYKEFF
PRMC_DICTD        H-----KVSDKIEFFFGFLLYPMVHRN--------------VDFELIISNPPYIASWEFP
PRMC_THEMA        H-------GVSDRFFVRKGEFLEPFKEK------------FASIEMILSNPPYVK---SS
O83091_TREPA      LLD--VSANSRVRFVHADVRAPIPFFSPSEGTDVVQERGVCVPYDVICANPPYVPSAQAR
PRMC_BORBU        L-----KLEKFVEIIHSNLLKCIK-----------------GKLDIIITNPPYLN--KEE
                                                                   * **       

PRMC_AQUAE        ILPEEVKK-EGYTSLIGGK-KGWEFYELIAEEGTKHLKENGFIAL--EIGHDQGKVVKEL
PRMC_CLOAB        KLMDDVKDYEPIIALVGGE-DGLDFYRRITSMSKKVLKPGGLIAY--EIGSDEANEVSNI
PRMC_CLOBH        TLMDDVKKYEPFEALCGGK-DGLFFYEGIIKQSLEVLNDGGTIAF--EIGYDQKIQVSHI
PRMC_FUSNN        TLMPEVKNYEPQNALTDLG-DGLHFYKEISKLAGEYLKDTGYLAF--EIGYNQAKDVSKI
PRMC_THEYD        KLQPEIKNYEPLEALNGGE-DGLNFYRKIIENAEKYLLNSGLIFL--EIGQGQAKAVQNI
PRMC_MYCTU        VLEPEVAQHDPHHALFGGP-DGMTVISAVVGLAGRWLRPGGLFAV--EHDDTTSSSTVDL
PRMC_MYCS2        ELDPEVADHDPAHALFGGP-DGMAVIRPIVALAARWLRDGGKCAV--EHDDTTSARTVEA
C8XIB1_NAKMY      AVEPEVADHDPPEAVFAGP-DGLAVIRPLLSVAASLLKLGGVLAI--EHDDSHGETVPAL
PRMC_CORGL        DLDPEVYQ-DPHMAVFSGA-DGMDVINKMVHLIFNLLKSGGAVGI--EHDDTTSDAVRQV
PRMC_STRCO        YVAPEARDHDPELALFSGE-DGLDLIRGLERTAHRLLRPGGVVVV--EHADTQGGQVPWI
PRMC_BIFLO        PEQPEVRDWDPELALYGGSMDGTLIPERIIERACRLLKPGGVLVM--EHDVTQGD-RLVA
PRMC_DEIRA        TADPEVRH-DPDLALYAGE-DGLDVARPLVAEAAAALVPGGALLL--ELDPRNAPTLAAE
PRMC_SYNY3        QLQPEVIKHEPLLALDGGP-DGLQAVEQLIRRSPTYLKPGGFWLV--EIMTGQAPMVAEL
PRMC_THEEB        TLQPEVQYHEPLLALDGGT-DGLQAIRQILETAPEYLQPQGWLFI--ELMATQGKAVAAL
PRMC_GLOVI        ALMPEVRLHEPLSALDGGS-DGLDAVRQIIADAARHLRPGGILAL--EVMAGQGPTVVQL
PRMC_PROMA        ELDPVVRDHEPILALSGGD-DGMDSCRKVIKGAMKGLRSGGWLLL--EHNFDQSEQALNL
D1C517_SPHTD      AGI----AWEPAVALYAGE-TGFGLYEQLLPQVAQRLRPRGAVGC--EIDPSQRAIALAT
PRMC_CHLAA        EGVY---RHEPHLALDGGS-DGLDCYRRLIAAAPTYLKPNGAILL--EIGSTQAASVVHL
PRMC_MOOTA        PGLPADVRSEPRLALDGGP-DGLDAYRFLLPGAAGLLRPGGLLAL--EIGSDQGQAVKDL
PRMC_RHORT        ALEPEVARFDPSRALDGGA-DGLDPYRILAAQVPALLAPAGVLAV--EFGQGQARDVAGL
PRMC_RHOS4        ALAPEVRLWEPHLALSPGG-DGLDAYRAIARGAPAHLRPGGRLLL--EIGAAQGRAVAGL
PRMC_AGRFC        TLDPEVRNHDPMAALDGGQ-DGLAPYRLIAADAGRFLVENGTVGV--EIGFDQRLDVSAI
PRMC_CAUVC        TLEPEVRIHEPRLALDGGP-DGLAAYRELAPEILRVLKPGGLFAV--EIGYDQSQAVEAL
PRMC_BRADU        KLSLEVREHDPHLALDGGN-DGYDAYRALIPQAAERLAPGGALIV--EAGQGQARNIETL
PRMC_CHLTE        TLQEEVRRYEPRLALVA-P-TGFEYYQSIAVAAPSLLRKGGVLCF--ELHADGAAEVRNL
PRMC_RHOBA        ELPTTVREFEPRGALLSGP-DGTEIIARLLNDSVQRLNDGGQLII--ELSPMIAGVSKTL
PRMC_GEOSL        ALQPEVREYEPRAALDGGS-DGLDFYRLIVPAAPEYLNPGGWLMV--ELGIGQAETVLGM
PRMC_KORVE        KVQRQVKDFEPHCAVFGGE-RGMDIIKRLAPQVWEHLKPGGWFLM--EIGYSIADPVHEI
PRMC_SALRD        SLPPVVREYDPDRSLFAGR-DPLRFYRALVRWVSACCVPGGSFVL--EVHAEHAAEVERL
PRMC_DESVH        GLSREVRDFEPRSALVPGD-TGLEHAAAIIAEATRVLRPHGILLM--EFGCMQGADMASL
PRMC_ECOLI        HLQQGDVRFEPLTALVAAD-SGMADIVHIIEQSRNALVSGGFLLL--EHGWQQGEAVRQA
PRMC_SHIDS        HLQQGDVRFEPLTALVAAD-SGMADIVHIIEQSRNALVSGGFLLL--EHGWQQGEAVRQA
PRMC_SALTY        HLSEGDVRFEPRSALVADE-NGMADLTHIIDNARQMLTPGGFLLL--EHGWQQGEAVRAV
PRMC_YERPE        HLNEGDVRYEPHSALVAAA-EGMADLAAIVSQAPGYLDPGGWLML--EHGWQQANAVQEL
PRMC_HAEIN        HLHQGDVRFEPLSALVAND-EGYADLRHIIELASSYLNSNGVLLL--EHGWQQGEKVRSI
PRMC_VIBCH        HLSLGDVRFEPKSALVAAE-NGLADIRHISTHAPHFLLDGGWLLF--EHGYDQGVAVRTI
PRMC_ALIF1        HLSEGDVRFEPQTALVAEQ-NGFSDLIHIMQHGREYLLNGGWLMM--EHGFEQGEQLRHF
PRMC_PSEAE        HLSEGDVRFEPKSALVAGS-DGLDDIRQIVAQAPRHLLDEGWLLL--EHGYDQGAAVREL
PRMC_SHEON        HLHQGDVRFEPQSALTAAD-EGFADLYYIAKTARDYLKPNGYILL--EHGFEQAVKLRAK
PRMC_XANCP        HLQQGDLRYEPASALASGS-DGLDDIRLIVADTPAHLLAGGWLLL--EHGWDQGEAVAAL
PRMC_COXBU        HLQQ--LKHEPREALAAGS-DGLSAIKIIIHEAKSYLVNGGWLLL--EHGYDQAEKIMTL
PRMC_BORPE        HLAQGDLRFEPRGALTDEN-DGLAALARIAGGAPGRLLPGGAIWM--EHGWDQAEAARAL
PRMC_BURPS        HLAEGDLRFEPRGALTDEN-DGLAAIRTIVAGAHAFVAPGGALWL--EHGYDQAAAVRTL
PRMC_NEIG1        HLSQGDLRFEPQIALTDFS-DGLSCIRTLAQGAPDRLAEGGFLLL--EHGFDQGAAVRGV
PRMC_BACAN        GLSPVVKEHEPKRALVGG-EDGLDFYRRFMEELPNVLQKKAIVAF--EIGVGQGEDVKGL
PRMC_BACCR        GLSPVVKEHEPKRALVGG-EDGLDFYRRFMEELPNVLQKKAIVAF--EIGVGQGEDVKRL
PRMC_BACSU        DLSEIVRFHEPLHALTDG-GDGLKFYKRFMEDIPLVMKDKVFVVF--EIGWKQGAAVKDL
PRMC_STAA8        TMSPTVTRFEPHQALFAD-NHGYAIYESIIEDLPHVMEKGSPVVF--EIGYNQGEALKSI
PRMC_ENTFA        LMDASVRTYEPKTALFAE-NNGLALYQQLIHESQTMLKADGKIYF--EIGFQQGAALQEL
PRMC_LISMO        EMSDYVLKNEPSLALFAE-NDGLAIYERFVDNLKYVLNSSFWVGV--EIGYTQGERVKQL
PRMC_BACTN        EMEANVLDWEPELALFVPDEDPLRFYRRIAELGRELLRPGGKLYF--EINQAYGQDMIRM
PRMC_FLAPJ        EIHKNVLEYEPHLALFVEDNDSLLFYRKITELATRNLSNNGQLYF--EINQYLGKETVEL
PRMC_LACLA        EMDNSVIKYEPDLALFAE-NQGLAIYQKIADQAVNHLTDNGKIYL--EIGYKQGQAVQAI
PRMC_STRR6        EVGLNVLYSEPHLALFAD-EDGLAIYRRIAEDATDYLKDSGKIYL--EIGYKQGQCVPEL
PRMC_BUCAI        KFFKKDIFFEPLSALISDN-NGLSDIENIIKNSKHYLFYGGWLMI--EHGWRQKVKVQYL
PRMC_FRATT        NIDQSVKDYEPARALFAAD-NGLADIRIIISQAKDFLNLGGFIYI--EHGFTQADAITAL
PRMC_MESFL        DVDKMTKKYEPKLALFAKD-NGLFFYKEAIKNIDKFMDITKNILIVFEIGWKQEKELDVF
PRMC_MYCMS        NIDKNVIDFEPSIALFAPN-KGLYFYEILIKNIDKIVDTNKNFLIVLEFGWLQKDSIEQL
PRMC_LEPIN        EMMKDVIDYEPHLALFLEN--PKDFLSTLIAQAYERLVEGGKLYM----EILPSLSETII
PRMC_CHLTR        ESDPEVRCHEPWKALVGGV-SGLEFYHRIATHIHKILVSGGVGWL--EIGSTQGEDIKQI
PRMC_DICTD        FLQKEVKK-EPWKALYGGW-DGCEFYRKLFTLLK---KRGKNFTAILEISPYIYHKVLNI
PRMC_THEMA        AHLPKDVLFEPPEALFGGE-DGLDFYREFF---GRYDTSGKIVLM--EIGEDQVEELKKI
O83091_TREPA      ALLQDGRG-EPLGALDGGA-DGLDLVRAFAHHSAAALKEGGCVFC--EVGSNHAQRAARI
PRMC_BORBU        LEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIII--ESAPWQIKSLKDF
                           :   ::                                             

PRMC_AQUAE        LE--KKCFK-VNIFKDYAGFDRVVIAQRWS-----------------------
PRMC_CLOAB        LE--NEGFVSIETRKDFARMDRVVLAVRGGL----------------------
PRMC_CLOBH        LN--EYGFKDVLCIKDLAGKDRVIKARKY------------------------
PRMC_FUSNN        LQ--DNNFAILSIVKDYGGNDRVIIAKKAIKAENFEEIEEEEDVNLSE-----
PRMC_THEYD        AL--MSGFNVIEVVKDIAGIDRVMILQKSKSL---------------------
PRMC_MYCTU        VSSTKL-FVDVQARKDLAGRPRFVTAMRWGHLPLAGENGAIDPRQRRCRAKR-
PRMC_MYCS2        FTHDGN-FTDVTARHDLTGRPRFVTATRIARS---------------------
C8XIB1_NAKMY      LRSRRV-LTDVEDHSDLAGRPRFVTATRVRMTTGAGKTGTP------------
PRMC_CORGL        FSQHGG-FGTIEVLHDLTGRARFVTARKL------------------------
PRMC_STRCO        FTEERG-WADAADHPDLNNRPRFATARKALP----------------------
PRMC_BIFLO        FARATG-FAAASTGQDWTGRDRYLFAVS-------------------------
PRMC_DEIRA        LRTAG---WQAEVRPDLTGRERFVRARRAGG----------------------
PRMC_SYNY3        LRASGA-YQDIQIHRDLASIERFVSARTLS-----------------------
PRMC_THEEB        AMATQA-YERVEILRDLSGHDRFLLAQTP------------------------
PRMC_GLOVI        LARDSR-YGCIRTVRDWAGIERIVVTYAWARGS--------------------
PRMC_PROMA        MV-DSG-FLEVDFENDLEGVRRFGLALRP------------------------
D1C517_SPHTD      ARSHFPTARIT-VRPDLAGLDRYLIIETD------------------------
PRMC_CHLAA        LRQALPMAETG-IERDLAGHDRIVWARNRYVIH--------------------
PRMC_MOOTA        ARAVGAYRNEQ-VLPDYAGRDRCFLAYRREE----------------------
PRMC_RHORT        LEVGGLCPYEI--KKDLSGEERCLLARRRAAGPLPPIHIDAKPSAPGNGPTKA
PRMC_RHOS4        VEAAGLARVSV--LPDLDGRDRLVSARLPAA----------------------
PRMC_AGRFC        FASHGFSLLDA--VKDYGGNDRVLTFRR-------------------------
PRMC_CAUVC        FRAAGATEVRT--VKDLSTHDRVVLGVKNPLESPA------------------
PRMC_BRADU        LTAAALVVDRPP-KADLAGIPRAVSARKMPP----------------------
PRMC_CHLTE        L---GSSFADVQVMQDYNKLDRGLSCMAQ------------------------
PRMC_RHOBA        AE-QNGGYKEIHLIKDLAGHERILSMQKA------------------------
PRMC_GEOSL        F--SRTGFCDCFTAQDPNGIDRVVGGRIG------------------------
PRMC_KORVE        MRDWTN-FKVV---PDLRGIPRVVVGRKPTS----------------------
PRMC_SALRD        FRGEEG-VGAVHTEEDLSGRPRIVWGRTERATAS-------------------
PRMC_DESVH        FTPYSTLWEMVEVRRDLAGLDRFIFARRNLLQP--------------------
PRMC_ECOLI        FILAG--YHDVETCRDYGDNERVTLGRYYQ-----------------------
PRMC_SHIDS        FILAG--YHDVETCRDYGDNERVTLGRYYQ-----------------------
PRMC_SALTY        FRRSG--YSDVETCRDYGGNERVTCGRFTP-----------------------
PRMC_YERPE        LKNSG--FSAVMTCKDYGNNDRVTLGQWAV-----------------------
PRMC_HAEIN        FQENH--WEMVETVRDYSDNERVTLGFWKK-----------------------
PRMC_VIBCH        LRDLG--YQNIITEQDYAGHDRVTLGQYKTEREA-------------------
PRMC_ALIF1        FEEHG--YINVKTEQDYAGNDRVTLGQWVVDN---------------------
PRMC_PSEAE        LGARG--FAGVHTLRDLGGNERITLGQWAC-----------------------
PRMC_SHEON        LIELG--YQNVATVRDFGSNDRCTMGKWMGLIGI-------------------
PRMC_XANCP        LIARG--FAAVATHQDLEQRDRVTLGQWPHAAG--------------------
PRMC_COXBU        MQADG--YREITDRRDLAGLSRMMVARRG------------------------
PRMC_BORPE        LRQAG--LREVHSRRDLAGIERISGGYL-------------------------
PRMC_BURPS        LDAAG--FADVESRADLASIERASGGRLPG-----------------------
PRMC_NEIG1        LAENG--FSGVEILPDLAGLDRVTLGKYMKHLK--------------------
PRMC_BACAN        LQQAFPH-AHVEVVFDINGKDRMVFAEIE------------------------
PRMC_BACCR        LQQAFPH-AHVEVVFDINGKDRMVFAEME------------------------
PRMC_BACSU        ILKAFKG-AEVEVLKDINGKDRTICALIHKNK---------------------
PRMC_STAA8        ILNKFPD-KKIDIIKDINGHDRIVSFKW-------------------------
PRMC_ENTFA        LSAAYPQ-KTIKIEKDLSGNDRLAIAE--------------------------
PRMC_LISMO        FEKSYPH-TTVVIHKDINSKDRYVTCSNILV----------------------
PRMC_BACTN        IEMNQY--RDVRVIKDIFGKDRILTANR-------------------------
PRMC_FLAPJ        LEKYNF--KNTTLKKDIYGNDRMIKVNFR------------------------
PRMC_LACLA        FQEKFTD-KLVSIHQDIFGKDRMISVK--------------------------
PRMC_STRR6        FRKHLPE-KRVRTLKDQFGQNRMVVVDDGQD----------------------
PRMC_BUCAI        FKKYNFHEIESYQDYGGNDRVTIGKKYDK------------------------
PRMC_FRATT        FSQCNFTDIKIVKDLNNNDRCTKAQLGYL------------------------
PRMC_MESFL        LKQELGLKYKWKFEKDYFNNLRYLILTK-------------------------
PRMC_MYCMS        LINNC-LKYKWEFKKDYNDYWRNLIIKNF------------------------
PRMC_LEPIN        SDSIAKGWENGKIEKDLSGKERFVILTR-------------------------
PRMC_CHLTR        FHAKGI---RGRVLKDYAQLDRFFFLENQANDAVSSGEVSGFSER--------
PRMC_DICTD        LKNFFD-SVIIESFRDYLGHERVIKVIWH------------------------
PRMC_THEMA        VS-------DTVFLKDSAGKYRFLLLNRRSS----------------------
O83091_TREPA      FQAAG--FATVKISKDLSGKERLISGILRSQSRAVTAPSG-------------
PRMC_BORBU        AIKKGFSHLKTIYDLEKRARALILGQRDDTSIRNCTFNQDK------------