CLUSTAL format seed alignment for MF_02131

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MPTE_METTH        --------------------------MEVQVWLRWYTRILDDFGFDRRADEESASYLDAF
Q8TWF9_METKA      ---------------------------MSDPLKGIIEEIRADLGYKESEDLWAASFLCEL
MPTE_METJA        --------------------------MDMKEWEIFYNKIMEDFGFDKDKDVESAVILNNI
Q9HIB0_THEAC      --------------------------MDLPRWLAIYRSIADDFSFDPSADLLSSIILSNL
Q6L1Y2_PICTO      ------------------------MQMRLKRWIPLYREIAADLNIRTFNDYYASKMLQSY
E0SQQ6_IGNAA      ----------------------MNWYIDRDEWNKIYLWIRSVLPLNFDMDQISTDTLSSI
Q97W35_SACS2      -------------------------------------MIRSWFGFKERDDYISASILNYL
F9VN27_SULTO      ------------------------------------------MNMKIKNDYV--------
MPTE_PYRFU        --------------------------MKWEEWKPFYERIVKEMGYSIEEDRRAAELLRDI
Q5JFY2_THEKO      --------------------------MRWEDWKPFYLRIVREMGYSIEEDRKAAQILRAL
A2BLD8_HYPBU      MCPEERTETDSLNELVSRIERRSSNIVSPSLWLELYEDIRRVMGYSRDGDCYAAKLLSTL
A0RZ43_CENSY      ---------------------------MIRGWAARYRGILAEFGYSAAQDRLSAKELDGI
A9A5Y9_NITMS      --------------------------MMISGWKAKYADILKEFKYDEKKDKESAILLDTI
D3TA67_ACIB4      --------------------------MKWKNWMKLYEEIERDFKFRREKEIESRNTLSKI
O29383_ARCFU      --------------------------------MEIYEQILRDFGFSREEDERAARLMKEL
D2RH49_ARCPA      -------------------------MHLEFWLKEVYPRIAKDLKLDVEKDRTATKIMAEL
B1L552_KORCO      -----------------------MREIDLSFWMPIYFKIAERLKLDVEEDRRATRVMDSL
Q3IPH6_NATPD      --------------------------MLHREWQPAYEAILTAFGYDAAGDVAARDVLFGL
Q9HQ39_HALSA      --------------------------MEYDDWQPVYDDVCAAFGYEQAADRRARDVL---
Q2FPI8_METHJ      --------------------------MKYEDWEPVYQEICEYFSFDPAEDDRAAHILAD-
Q8TN63_METAC      -----------------MKNRKGVIYTDFAAWEPIYERILEDFGFDRTGDEEAARLLSSL
                                                            :      :          

MPTE_METTH        LREH-GCLRV-DDIDVP-SSDFIVFGAGPSLRSHLKRFRALDEPMT---VISADGATTAL
Q8TWF9_METKA      LRDHPRVLRP-EDLPV--EEEVVVVGAGPSIAELPKIVGELEDSV----VYAADGACRAL
MPTE_METJA        LENANTIPVD-KLKDIIEGREVFIFGAGPSIKKHINILKELREINYKNPIIVADGACKAF
Q9HIB0_THEAC      VGKPELPDRKGSTAYVIG---------------NGPNIDEAIQSISSGYTIVADSAISAY
Q6L1Y2_PICTO      SFTMKDIKFNERTAYIIG---------------NSPDMEDYLPSISSGIKIVADSAITRY
E0SQQ6_IGNAA      LQKAINVIHPNDISRIISARGVAIVFGAGPSLEKDVDVAEKNDLIRNIPIFVSDGASSYL
Q97W35_SACS2      ITKEYDEAELKELIKGRE-------IAIVGAGPQLDKINK----LKEDVIIAADGAANYL
F9VN27_SULTO      --------EKLNIIRDKR-------VAVVGAGPNLVSVNE----ISEDLIISADGATNFL
MPTE_PYRFU        LMENDNYIIKEELNSIIM-----QKVYVFGAGPNLEEALKKG-DFKDGTKIAADGATSAL
Q5JFY2_THEKO      LLEGDEYILRDELEAIVE-----KKAYVFGAGPSLEKALKEF-DFSDGTLIAADGATSAL
A2BLD8_HYPBU      LHEAATEARYVELREVCRLLASCSTICVTGGSESLEKWVHSL-GSTCECIVAVDGSTSLL
A0RZ43_CENSY      IGRPVPLGRIAGILRGKT-------VLVVGAGPSLHRALKVIPGLD-LPIIASDGALRGL
A9A5Y9_NITMS      LKKSKTIKKIQDLIQGNT-------VLVIGSGPSLSHAIPKLKKLKRVIIIAADSSLKPL
D3TA67_ACIB4      LGDKVLSIGDIGNLIGEE-------VYVVGFSPSLENEIELIPDRA--TIIAADDAAVIL
O29383_ARCFU      AGDR-LLESS-VLEFIRGK-----SVAVIG---GAYEGES----IREEVVITAGKAVNKV
D2RH49_ARCPA      GKGK-FLPAD-VLKFIEGK-----DVVVLG---PLAKSLD----FKWDVLITAGKSILNY
B1L552_KORCO      MIGKKDLSEE-LEDLIKGE-----DVLVVGNGPSLNRGFD----FDGIVITADAASLKYL
Q3IPH6_NATPD      VTDAAPLKSD--SIDLPG------TVAVCGGGPSLAADLDR--ARRADTVVAASTAADVC
Q9HQ39_HALSA      AAHAEPFDMA--RLDCTGQ-----TVAIAGGAPTLADEREV--AAAADRVFAASTAVDVL
Q2FPI8_METHJ      LTIQDATDLL--KSCIAGK-----PVTICGNAPTLSQELE----AITGVIIAADAASGVL
Q8TN63_METAC      LSEKNTVSLSELKDRISGK-----PVLVCGNAPGLRNELLKL-DLSVFTIIAADGAAAVL
                                                                         :    

MPTE_METTH        LEEDVLPDIIVTDLDGKM----EDIIEANRQGAVVVVHAHGNNLPALRRYLPLL-QN-II
Q8TWF9_METKA      LELGIVPDVVVTDLDGPK----EYLLMSSECGSITVVHAHGDNVTELAELVPTL-GR-IL
MPTE_METJA        LEENIIPDIIVSDLDGDL----EALFECNRKGSIIVVHAHGDNIEKIKKYVPKL-KN-VV
Q9HIB0_THEAC      FAVRGCPDMIVTDLDGDV----DTIFSCASKGTSIIIHAHGDNIHRIIGNGHRI-RDDMI
Q6L1Y2_PICTO      LMRRGYPDIIVTDLDGNI----DDIINANKNGVLTFIHAHGDNIIKINSYVKCF-KN-FI
E0SQQ6_IGNAA      LEIGIIPTAIVTDLDGNL----NDIEYLSRFGVYIFVHAHGDNIDRLF-NVLRF-KGYII
Q97W35_SACS2      VDIGIVPDIIVTDLDGLQ----TFP-----KNPIYVVLAHGDNINLLH-KVKE--MDKVI
F9VN27_SULTO      YEHGIIPDIIVTDLDGIS----VFP-----EESIYVVHAHGDNIRKLY-KVNN--MKIVI
MPTE_PYRFU        LEYGITPDVVVTDLDGRI----RDLLEAS-RKAVMVVHAHGDNMDKLP-LVVE--FPLVL
Q5JFY2_THEKO      LENDLVPDIIVTDLDGRI----PDLRIANDRGSFMVVHAHGDNVDKMT-SYVPL-FSRVL
A2BLD8_HYPBU      LGYGIKPDIVIGDLDGSW----QATLEAA-RTAIVVVHGHGDNIAALR-YMVPR-LPAVH
A0RZ43_CENSY      LDEGIMPDIITTDLDGDT----KSLLRAG-RSRIMIVHAHGDNIERLP-MVRS--FGNVL
A9A5Y9_NITMS      LENGIVPDIVVTDLDGDE----KSFKKIA-KRSIFVVHAHGDNIEKLE-FVKK--FKNCV
D3TA67_ACIB4      NDLGIKPTIVMSDLDGDI----DSLIRI--KSSVFGIHAHGDNIPLLP-YAEF--FPKKF
O29383_ARCFU      NFV---PHIHVTDMEEDE----KILASLEERGCILVLHAHGDNVERIKRVVPVV--QRFV
D2RH49_ARCPA      DII---PHIHVTDGEEGW----KILKKLEEKDCIIILHAHGDNIELLREIVPKL--DRFV
B1L552_KORCO      RLFGREPEVIVSDLDGPP----EILSMR----SIKVLHAHGDNIGRILELVPRV--EELV
Q3IPH6_NATPD      RDAGVAVDCMVTDLDKNP----ETAVELAAAGTPVAVHAHGDNVDLIEAYVPAIDVGSVL
Q9HQ39_HALSA      ADAGIEVDLMVTDLDKNP----ETARRLTAQGTPVAVHAHGDNIAAIREHVPTYDTTHVL
Q2FPI8_METHJ      IRHGITPDVIVTDLDGIE----DEAVTLNRKGTILVVHAHGDNIPRLRTWVPRMKGPLVL
Q8TN63_METAC      MDLGCAPEVICTDLDGNSEADIEKEILACQQGSIVLIHAHGDNRDKLEKYVPRF--VRFI
                              * :                     : .**:*   :             

MPTE_METTH        GTTQ-----SIPHGCLHNFGGFTDGDRAVFLAAALGAGRIVLAGMDFGEVVTRYSRPDMD
Q8TWF9_METKA      GTCQV----EPPCDLLHNFGGFTDGDRAVVMAARLGAERVLTVGMDFGNLTTEYSRPGEG
MPTE_METJA        GSCQIPNYKELNLRNVINFGGFTDGDRCCFLAYHFKAKKLILGGMDFGIYITKYSRPNIK
Q9HIB0_THEAC      GTTQGI-----PYRNVANFFGFTDGDRSAYIASRMGFEKIVLVSFDFHHVNRS-------
Q6L1Y2_PICTO      GTTQHI-----PIKNIYNFGGFTDGDRAAYIADYFNFNEIVLIGFDFNRPYIKDYY----
E0SQQ6_IGNAA      GTTQVE-----PRPYVYNFGGFTDGDRAIYIAYGLGVKRFILGGMNFNGPIGKYSAIG--
Q97W35_SACS2      PNSQVM-----PFGRLRLYGGFTDGDRAVVLAKYMKASKIRLYAMDFQSGIVGKFSKPYY
F9VN27_SULTO      GSAQVF-----PFGNIHLFGGFTDGDRAVILAKLFKAKEIVLYGMDFDSGYVGKYSKPYY
MPTE_PYRFU        GTCQTE-----PLDIVYNFGGFTDGDRAAFLAEEMGAKEIVLVGFDF-SGIVGKWSKPWL
Q5JFY2_THEKO      GTTQTE-----PLDIVYNFGGFTDGDRAAFLAEELGAREVVLVGFDF-GNVVGRWSKPHL
A2BLD8_HYPBU      GTVQCE-----PTPYTSLVPGFTDGERALGLALLCGVESIHVYGMNV-RERVGWWSKPWL
A0RZ43_CENSY      GTTQGR-----ELGRLYNFGGFTDGDRAVFLAEALGARKIVLAGMDL-----GSRIGSLS
A9A5Y9_NITMS      GTTQTK-----PFNKIENFGGFTDGDRGVFLASYFEAKKIILFGMDF-----GDRIGKFS
D3TA67_ACIB4      GTTQIE-----PLENVYNFGGFTDGDRCVFLAAHFDAKIHILGFDFE-----NPRIKEGK
O29383_ARCFU      GTTQST-----PFDRIYNFGGFTDGDRAALLAKKFGARRIRLYGFDFEKADNP-------
D2RH49_ARCPA      ATTQVE-----PVNGVYNFCGFTDGDRAAIIAKHFKARSIRLVGFDFERADG--------
B1L552_KORCO      ATTQVE-----PTERVHNFGGFTDGDRSVFLACICGAKSIRLAGMDFDSVSEYDIAAG--
Q3IPH6_NATPD      PTTQAA-----PRPPVVNPGGFTDGDRAAFLADACGADRLVFPGWDFDDTAVSA------
Q9HQ39_HALSA      ATTQAA-----PTGPVVDHGGFTDGDRAAFLADHCGAAALRFPGWAFDDHTVTE------
Q2FPI8_METHJ      -TTQGK-----PFGHVYNFGGFTDGDRAVYLAHEMQASDVTLIGFDLDDPVVTP------
Q8TN63_METAC      ATTQAR-----PFDRVYNFGGFSDGDRCVFVAREFGAKSIRLVGFDFEDPMVNP------
                   . *                **:**:*   :*                            

MPTE_METTH        SELGPADPVKRLKLEYASRLIDWLERNGDVRIERW--------------------
Q8TWF9_METKA      RGVFRADPVKRKKLAWGERVLRLVERELGVEVESLTVRR----------------
MPTE_METJA        EDIAIGDEIKIKKLEYAKTLINYLKDKIEIEFLK---------------------
Q9HIB0_THEAC      --KPGNPAIKARKLKWAQAIISMLAEERGT--ALADGDFAEI-------------
Q6L1Y2_PICTO      --TVNDIIMKRKKLQWALKLIKMLAESRGS--KFTESGVIEI-------------
E0SQQ6_IGNAA      --REKDPRIKMIKLDIAKKLILRLIRKGVEMYSLSDTGINDIKLIPQ--------
Q97W35_SACS2      QRNVPASMIKRKKLEIARMIIEQVLNYNE--------------------------
F9VN27_SULTO      EQNLPANWVKRNKLKIAKQIIEQVLSKDL--------------------------
MPTE_PYRFU        RDHTPAWESKMKKLKFARELLEWLKNNGRAKIIEFSI------------------
Q5JFY2_THEKO      KEHSPVWESKRKKFEFAKELLEWLEKNGRARLVYL--------------------
A2BLD8_HYPBU      NRSVPAWGEKARKLVIAEAVFKAFRVYAERNNIRLVWH-----------------
A0RZ43_CENSY      DTRPADRATKIKKLKRARVLLEWLAGWSRATLYTTSGYIRGFERVRLPGLAP---
A9A5Y9_NITMS      NTKKSERKIKLMKLKKGKLLLEWLSTKTKSELFTTSTSIKGFEKIPYKSLDIIIT
D3TA67_ACIB4      DMIR-----KRKKLRWAKYLIHYLEQSGAKIIWENLNSK----------------
O29383_ARCFU      --------VKLKKLKWAKFILEREGIIWGPVG-----------------------
D2RH49_ARCPA      --------LKLRKLKWAEYILRMEGII----------------------------
B1L552_KORCO      ----KDIRRKMEKLKIARELLKLSIEMGCPLEVGGWS------------------
Q3IPH6_NATPD      --------AKAEKLRWAARLLRWLELRRNEEFGVLDGRRGDIRLPWLA-------
Q9HQ39_HALSA      --------EKRRKLAWAARLLRWLETRRGEAFGVLDGRRAAIDAVT---------
Q2FPI8_METHJ      --------MKKGKLQWARKLLSLCGHEL---------------------------
Q8TN63_METAC      --------IKKKKLNWAKELIGMFGI-----------------------------
                           *  *:  .  ::