CLUSTAL format seed alignment for MF_02202

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B1KIF9_SHEWM          -------------------------------------MEADISFIGLFLQASLLVKFVML
A0KP96_AERHH          -------------------------------------MHAEISFIGLFWQASLLVKLVMM
Q6LP44_PHOPR          -------------------------------------MSAELSILDLFLQASLLVKIVML
Q15RN8_PSEA6          -------------------------------------MSAELSIFGLFWQASLLVQLVML
Q3IIJ3_PSET1          ------------------------------------------------------------
TOLQ_ECOLI            --------------------------------------MTDMNILDLFLKASLLVKLIML
W1HLJ8_KLEPN          ----------------------------------------------------------ML
A0A1V2BTL6_RAOTE      -----------------------------------------MNILDLFLKASLLVKLIML
A0A384L7U6_YERPE      --------------------------------------MADMNILDLFLQASLFVKLIML
Q7N6T9_PHOLL          --------------------------------------MTDMNILDLFLKAGLLVQLIML
D3UZV5_XENBS          -----------------------------------------MNILDLFLKAGFLVQLIML
TOLQ_HAEIN            -------------------------------------MTAELNFLDLFLKASIVVQLVIV
Q06PS0_MANHA          -------------------------------------MQTEFSLLSLFLEASIVVKIVML
Q83BD7_COXBU          -------------------------------------MGAEPTLWSFVAHASLIVKMVIF
E6WQS7_PSEUU          ------MIGSSLALLATVVEALPPDAAAAATEAASTVAHGGINYLDLMLRASLPVKLIVL
D3HSI9_LEGLN          -------------------------------------MGNQANVLMYFMQAGLVVKTVML
Q2Y5G7_NITMU          ---------------------------------MSPTVSQDMSLFQLVGSASLPVQLVML
Q0AJA1_NITEC          ---------------------------------MSKTITQDLSFLHLISGASLPVQLVML
F2LAN3_BURGS          -----------------------------------MNSAQDLSIVSLVLNASVLAQAVMG
A1TPB7_ACIAC          -----------------------------------MNS-QDMSILHLVLNASWVVQLVMA
F5RG00_METUF          -----------------------------------MTATEDLSIISLVMHASLLVKLVMA
B1XTC2_POLNS          -----------------------------------MTSTQDLSFLPLVLNASLLVQLVIL
B7J3G5_ACIF2          -----------------------------MDPHSIANTAQSLSLGHLVMNASWVVQGILA
A4XRS3_PSEMY          ---------------------------------MEANAVDHMSMWSLISNASLLVQLVML
TOLQ_PSEAE            ---------------------------------MEPNVVDHTSMWSLISNASIVVQLVML
R9S5W9_SIMAS          -----------------------------------MANAEPLSIWSLIAEASLLVQLVMA
A0A1T1HCX4_OCELI      -------------------------------MLKGAHVDDKLSLLGLIINASVVVQLVMA
R4YNW6_OLEAN          --------------------------------MEQASVEQSMSIISLIVNASFVVQLVML
S2KR90_HALAF          -----------------------------------------MSIPHLIMNASAVVQLVML
L0E135_THIND          -------------------------------------MSVDLSLYRLIMDASLIVQLVMV
A4VKW9_PSEU5          ----------------------------------MQTTLEHMSVWGLISEASLVVQAVMV
L1LZ34_PSEPU          -----------------------------------MHASEPMSIWGLVSDASLVVQAVMA
Q4KAB8_PSEF5          ----------------------------------MQATLEHMSIWGLISDASLLVKAVML
A5WFR6_PSYWF          --------------------MLTPFYLEFFITASISFMPESINLIALITEASLLVQIVMA
V2UGV9_9GAMM          ---------------------------------MATQLESSLQVSDLILQASPVVQLVML
Q31H82_HYDCU          --------------------------------------MNNHSLMELILDASPVVQAVMV
A0L4V3_MAGMM          --------------------------------------MTKHSVFDLITQAGPLVQLVML
G8PJY3_PSEUV          MNSKVMKLVVAMSAALASTMPLAAMAQDVQSVELGAAPGSGLSYISLFMEADIVVKIVMI
Q92M96_RHIME          ------------------------------MEQVGLAATSDVTLWSLFMQAGLVVKLVML
J7QWC6_METSZ          ------------------------MNPAEIAASPLAAPAADITIWSMFWGAHIVVKIVMV
B2ICP1_BEII9          ------------------------MNPADLASA--AAPVTEVSLFSMFWSAHIIVKIVML
Q3SP18_NITWN          ------------------------MNPADVAQSALPLASADVSLITLFFHAHWIVKAVML
Q130X0_RHOPS          ----------------------------------MPLVSADVSLIALFWQAHWIVKSVML
B6JJ21_OLICO          ------------------------MNPADVAQSALPVASSDVSLIALFWQAHIVVKIVML
E3I2A4_RHOVT          -----------------------------------MTPASDFSFLGLFLQAHPVVKFVMI
G4R981_PELHB          --------------------------MEAMDAVGSAAAHTDFSPIGLFLMADIVVKLVML
A1UR82_BARBK          ------------------------------MTHIDLASPETIGMWALFIQANWVVKAVMI
A1AZV1_PARDP          -----------------------------MEQLAGAGQPVDFSLIALFARASLTVQIVMV
                                                                                  

B1KIF9_SHEWM          TLLALSVVSWAVIIQRRRLLTAARQSSLKFEDKFWSGVDLNKLYKELSARQDSN---AGL
A0KP96_AERHH          TLMGMSVVSWALIIQRSKAIKAANLASEQFEDRFWSGVDLNRLYQESSSRRDDI---EGM
Q6LP44_PHOPR          ILLGMSVASWAMIIKRSQILSNAASKAGRFEDRFWSGVDLSQLYKEVEARKDDL---MGS
Q15RN8_PSEA6          LLLAASVASWTFIFQRSQALSRAKNDMKKFEDKFWSGVDLNRLYQELAAR-ESV---QGM
Q3IIJ3_PSET1          -------MSWAIIFQRKKAISDALSNAKKFEQKFWSGIDLSKLYSEISSRSGQS---KGI
TOLQ_ECOLI            ILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELSRLYQESQGKRDNL---TGS
W1HLJ8_KLEPN          ILIGFSIASWAIIIQRTRILNSAAREAEAFEDKFWSGIELSRLYQESQGRRDNL---TGS
A0A1V2BTL6_RAOTE      ILIGFSIASWAIIIQRTRILNTATREAEAFEDKFWSGIELSRLYQESQGRRDNL---AGS
A0A384L7U6_YERPE      VLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGIELSRLYQESQARRDTL---SGS
Q7N6T9_PHOLL          ILICFSVASWAIIIQRTKILNAATRESEAFEDKFWSGIELSRLYKESQSRRDSL---GGT
D3UZV5_XENBS          ILIGFSIVSWAIIIQRTRILNAATREAEAFEDKFWSGIELSRLYKESQSRRDSL---NGT
TOLQ_HAEIN            ILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSGEDLNKLYEGLSNRRDGL---TGS
Q06PS0_MANHA          ILIVFSILSWAVIIQRSKILTKAKKDSLAFEDRFWSGEDLNRLHQGLENRRDAL---NGS
Q83BD7_COXBU          LLFLASIASWSIIIQRVFFVKRTRREMKKFEHLFWSGVDLTTLYNRLSKKKDKL---IGM
E6WQS7_PSEUU          LLLAGSLISWVIIFRKLGSFKRADQEADEFENRFWSGADLGKLYAAATDRNRVV---GGL
D3HSI9_LEGLN          LLAAASITSWTLIFQRAWFFNQKKQLTDAFNRRFWESADLSRLYADVDSNSDER---QGM
Q2Y5G7_NITMU          LLVIASLMSWWYIFRKLFVIREAERQCDEFENVFWKGTDLNALFQSAAASRHTA---GSM
Q0AJA1_NITEC          LLLLASFISWWFIFRKLFTLRQEIKQTDEFESVFWRGSDLNALYQRAASARHAA---GSM
F2LAN3_BURGS          LLLLLSLMSWTFIFRKWFAIRRARKQTERFERDFWSGGDLQALYQSAANNRHTI---GSL
A1TPB7_ACIAC          LLIGVSIASWAAIFRKLFALKRVRSLNDEFEREFWSGTSLNDLYASAAQNAKNA---GPM
F5RG00_METUF          LLVGVSFMSWYWIFRKSFAIRAARLSSDKFELEFWSGGDLNALFQSAANDRHNA---GGM
B1XTC2_POLNS          LLLSMSVASWTIIFKKTAVLRGVRQDTERFERDFWAGGDLNTLLEAAQRNTRSD---AVL
B7J3G5_ACIF2          ILMIASVISWTIIFQKWAIFAAAQRALERFEKRFWSGGEMSQIYQHVSGNANLE---TGA
A4XRS3_PSEMY          TLVAASVISWVMIFQRSNAIRAAKRALDNFEDRFWSGIDLSKLYRQAGSNPDP---DSGL
TOLQ_PSEAE            TLVAASVTSWIMIFQRGNAMRAAKKALDAFEERFWSGIDLSKLYRQAGSNPDP---DSGV
R9S5W9_SIMAS          LLFLASVVSWIMIVQRGLYQRQAAASLRAFERTFWSGIDLNQLYRQGSGKGGH---TDGV
A0A1T1HCX4_OCELI      SLVLASVLSWMFILQRAAVIGNAKKSMEEFEDRFWSGMDLSQLYLEISQESN----GSGA
R4YNW6_OLEAN          LLVLASVASWVIIVQRWRLLATTRKQLNAFEERFWSGVDLSQLYKECQQNPE----PVGV
S2KR90_HALAF          ILTVGSVLSWIVIFQRSFVIRRARRAHQNFEERFWSGIDLNELYRETPSEQE----TVGA
L0E135_THIND          ILVVASVLSWLAILVKARTIKLAHRAADDFEERFWSGVDLAHLYDGVRRKTD----MSGM
A4VKW9_PSEU5          ILVLASVSSWYLIIRRSAALHRSERLLHSFQQRFRQGGDLAQLYREGQQQPLP--EEAAL
L1LZ34_PSEPU          CLVLASLLSWYLIVQRGWSLGRSEKASDGFLQRFRASGDLAQLYRESQPHTAEGDDQTPL
Q4KAB8_PSEF5          TLLLASLLSWYLIIQRGAVLRGREQRFQAFIQRFRAAPELLPLYREVAKGSDA---EGGV
A5WFR6_PSYWF          ILLLASVICWVLIFRLSARLGTAKRQDQHFENWFWSGEDLSKLYQGIQNSPDR----HGL
V2UGV9_9GAMM          VLLLASLYSWYLIAKLHLSYKKAQADDDHFQKIFWSGAELNTLYNNAQLNSKR----TGL
Q31H82_HYDCU          ILLLMSIMAWAITFAKSYQLRKAQREARDFDELFWSTPELTGLYNQVTRDEDN----TGN
A0L4V3_MAGMM          ALLAASVVSWAIIFDKWRRYRRITQDAEAFEERFWSGGSVASLFQSATKEWPDS----PM
G8PJY3_PSEUV          GLIAASVWSWAIIFDKVVLYGRSRRQMNRFENVFWSGQSLEELYKSLSSRANNG-----M
Q92M96_RHIME          GLIAASVWTWAIVVDKSLNYGRVRRQLDNFEQVFWSGQSLEELYRTLSDRQTSG-----M
J7QWC6_METSZ          GLLAASVWCWAIIIDKTLLFARMRRSMDRFEENFWSGNSLEELYGKLSERPQTG-----T
B2ICP1_BEII9          GLLGSSIWCWAIIVNKVLLFSKVDRDMARFEDIFWSGTSLDELYATLSAKPVSG-----M
Q3SP18_NITWN          GLLACSVWVWAIAIDKTFLYARTKRAMDRFEQAFWSGESIEDLYRALSAKPTQS-----M
Q130X0_RHOPS          GLIGCSVWVWAIAIDKLLLYSRTKRAMDRFEQAFWSGESIDDLYRTLSAKPTHS-----M
B6JJ21_OLICO          GLLACSVWVWAIAIDKTFLYARTRRAMDRFEQAFWSGQSIDELYRALSAKPTHS-----M
E3I2A4_RHOVT          GLILASVWCWSIVIEKTIAFRRAKKQTEEFERVFWSGQSLDELYLAMPQKPTSA-----M
G4R981_PELHB          GLLAASIWCWAIIIDKSLKFTRVRSDMNQFEKTFWSGQSLEELYQTLSQRPTSG-----L
A1UR82_BARBK          GLVLASIWSWTIILHKIFAYRKIRRDIRHFEKFFWSGKSLEELYTAYQNKPLNN-----I
A1AZV1_PARDP          ILILASFWAWAIIIQKFISFNAARREADRFDRAFWSGQPLDDLYDRIGETPSGP-----A
                               *                   *   *     :  :                 

B1KIF9_SHEWM          EALFHSGFKEYARLSKLNNK---VPEAVMDGSYRAMRVSLSREMEKLETHLPLLATIGST
A0KP96_AERHH          EDIFYSGFKEYARLLKAGAR---GQDAVMDGTYRAMRVSLSRAVDELESNLPVLATIGSI
Q6LP44_PHOPR          EQIFYTGFKEYARLHRSNGQ---VPDAVMEGTSRAMRVSLLREVDELETSLPFLATVGSI
Q15RN8_PSEA6          ASLFCAGFKEFVRLRKSSST---PSEAIMDGTYRAMRVSLSREIDELESRLPFLATVGSI
Q3IIJ3_PSET1          EALFTAGFKEFARHKKNTFQ---SAGIVMEGTHRSMRVALSREVEKLESSLSFLATVGSI
TOLQ_ECOLI            EQIFYSGFKEFVRLHRANSH---APEAVVEGASRAMRISMNRELENLETHIPFLGTVGSI
W1HLJ8_KLEPN          EQIFYSGFKEFARLHRANSH---APEAIVEGASRAMRISMNRELETLETHIPFLGTVGSI
A0A1V2BTL6_RAOTE      EQIFYSGFKEFARLHRANNH---APEAVVEGASRAMRISMNRELETLETHIPFLGTVGSI
A0A384L7U6_YERPE      EQIFHSGFKEFARLHRANSH---APEAVIDGASRAMRISMNRELEALETHIPFLGTVGSI
Q7N6T9_PHOLL          EQIFYSGFKEFARLHHANNH---APEAVITGASRAMRISMNRELESLESHIPFLGTVGSI
D3UZV5_XENBS          EQIFHSGFKEFARLHQVNSH---VPEAVITGASRAMRISMNRELETVENHIPFLGTVGSI
TOLQ_HAEIN            EQIFCVGFKEFSRLKQVNPD---APEAIIKGTMRAMNLAMNREIESLENRVPFLATVASV
Q06PS0_MANHA          EQIFYVGFKEFTRLQQANPD---APESIIQGSTRAMNLALNREMESLENYIPFLGTVGSI
Q83BD7_COXBU          SSIFYAGFNEFTRLRQELGS---NPKAILEGTHRAMRIAQSREADLLERNLSFLATVGST
E6WQS7_PSEUU          EAIFEAGFREFTRLRDKRRH---DGRAQLEGAQRAMRVAFSREVGQLERNLELLANIGST
D3HSI9_LEGLN          AAIFHSGFREFIRARKQ-------GNVVIEPIQRVMQITHAKEAEKLERHLPFFASVGSI
Q2Y5G7_NITMU          ERIFEAGFREFMKHRRQPGM---DTGTAMDSTRRAMRATYQREMDRLESHLSFLATVGSV
Q0AJA1_NITEC          ERIFEAGFREFTKY--QSGI---DIGPIMDSTRGAMRAVYQREMDRLESHLSFLATVGSV
F2LAN3_BURGS          ERIFESGMREFLKAKEKRIS---DPSLILDGARRAMRASFQREMDMLEANLAFLASVGSV
A1TPB7_ACIAC          ERIFASGMREFHKLRERRIT---DPGTLLDGARRAMRASFQREMDVVESSLSFLGSVASV
F5RG00_METUF          ERIFEAGYREFTKLRARPNM---DTATVVDGARRAMRATYQRELDELESHTAFLASTGSV
B1XTC2_POLNS          EHIFEAGMQEFTKGR------------EIDAARRAMKAAYQREMDLLEANLPFLASVGSV
B7J3G5_ACIF2          GSIFCAGYEEFQRQRNK--I---RPSDALDAARRAMRVAQMREVGRLENNLAFLASVSSV
A4XRS3_PSEMY          EQIFRAGFKEFSRLRQQQGV---DPDAVMDGVARAMRVAISREEEKLETALPFLATVGST
TOLQ_PSEAE            EQIFRAGFKEFSRLRQQPGV---DPDAVMEGVARAMRVAISREEEKLEASLPFLATVGST
R9S5W9_SIMAS          ENIFRAGFKEFSRLRQQQNV---DPDAVMEGVQRAMRVALAREEKNWKPTCRSWPVWLPS
A0A1T1HCX4_OCELI      ENIFRAGFKEFSRLSQKGPV---DSDALLEGVQRAMRVALAREEERLNENLPFLATVGST
R4YNW6_OLEAN          ENVFTSGLKEFGKIRQQAPD---EPDTIMESTQRAMRITISRETEVLEHHLSFLATVGST
S2KR90_HALAF          EQVFRAGFREFNRLLPKTR----SPQSILDGVQRSMRVAWSREEERLTLHLVFLATVASA
L0E135_THIND          EHVFSSGFKEFLRVRQHPP-------HVVDATHRSMRVAIARESEDLERYLQFLATVGST
A4VKW9_PSEU5          QRIFLAGYGDFAQLQREAGI---APDAVAEGVERSLYVAIAEQEERLEKGLQFLATVGSV
L1LZ34_PSEPU          QRLFVDGYQAFAQLQRQPQI---EHGAVLEGVERSLQVSLAEQDERLDKGLAFLATVGSV
Q4KAB8_PSEF5          EPIFAAGYQEFSHLRGQPGG---AGEGVLEGVERALYVAISEQETRLEKGLQFLATVGSV
A5WFR6_PSYWF          ANIFYVGFSEFLRMNKKRQ----PKDHIIDGVERKLRVGLGRQQQSLESGLAVLASIGSV
V2UGV9_9GAMM          EDIFYQGLGEFLKLKKRHA----PTAQSLEGTERILRVGLSRDQGQLEQGLGALASIGSV
Q31H82_HYDCU          AQIFEAGFKEFMSLKSQGVI---DSADLINGTQRAMRVAFSKQIERLENQTPLLATVGSS
A0L4V3_MAGMM          VVMFSAGFREWKRWESNEPTSEGDGGDLVTNVRRAMTVALNRELENLEKGLTFLATVGST
G8PJY3_PSEUV          SALFVAAMREWKRSHE-GDKPA--IASLQQRIDRVMDLTISREVERLEKRLLFLATIGSA
Q92M96_RHIME          GAIFVSAMREWKKSFE-RGARA--PIGLQMRIDRAMDVTLARESEALEARLGSLATIGSA
J7QWC6_METSZ          ATLFVAAMREWKRSFQAGASAS--FMGLQARIEKVLDVSIAREVEKLESNLLVLATVASA
B2ICP1_BEII9          ASLFVAGMREWKRSMQ-GAAHS--FLGLQARIEKALDVSIAREVEKYESSLLVLATVASA
Q3SP18_NITWN          AACFVAAMREWKRSFE-SQARS--IAGLQMRIEKVMNVSIAREVERLERRLLVLATVGSA
Q130X0_RHOPS          AACFVAAMREWKRSFE-SQSRS--FAGLQMRIEKVMNVSIAREVERLERRLLVLATVGSA
B6JJ21_OLICO          SALFVAAMREWKRSFE-SHSRS--FAGLQTRIDKVMSVSIAREIERLDRRLLVLATVGSA
E3I2A4_RHOVT          AALFQAAMREWRRSID-GTAKP--LPGVQMRIERVMEVTITREMERLEARLLFLATVGAV
G4R981_PELHB          AAVFVAAMKEWKRSHE-QNASS--YLGVQARLDKVLDVAISRESEQLESRLPFLATVGSA
A1UR82_BARBK          SAVFIAAMTEWKKSLT-KGIHT--SPSLQIRIEKAMDLAIGRESKKIESKLGYLATLGSA
A1AZV1_PARDP          ERIFSAGMAEWRRSHR-DDGNL--IAGVTARIDRAMNVTINRENDRLTRGLPFLATVGST
                         *  .   :                        :     .                . 

B1KIF9_SHEWM          SPYIGLFGTVWGIMNSFIALG-AVENATLAMVAPGIAEALIATAMGLFAAIPAVIAYNRF
A0KP96_AERHH          SPYIGLFGTVWGIMNAFIALG-QVQQATLQMVAPGIAEALIATAMGLFAAIPAVIFYNRF
Q6LP44_PHOPR          SPYIGLFGTVWGIMHAFIALG-AVKQATLAMVAPGIAEALVATAMGLFAAIPAVMFYNKL
Q15RN8_PSEA6          SPYIGLFGTVWGIMNAFIALG-EVQQATLAMVAPGIAEALIATAMGLFAAIPSVIAYNRF
Q3IIJ3_PSET1          SPYIGLFGTVWGIMNAFIALG-EVKQATLQMVAPGIAEALIATAMGLFAAIPAVIAYNRF
TOLQ_ECOLI            SPYIGLFGTVWGIMHAFIALG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
W1HLJ8_KLEPN          SPYIGLFGTVWGIMHAFIALG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
A0A1V2BTL6_RAOTE      SPYIGLFGTVWGIMHAFIALG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
A0A384L7U6_YERPE      SPYIGLFGTVWGIMHAFISLG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
Q7N6T9_PHOLL          SPYIGLFGTVWGIMHAFIALG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
D3UZV5_XENBS          SPYIGLFGTVWGIMHAFIALG-AVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
TOLQ_HAEIN            SPYIGLFGTVWGIMHAFMALS-GAKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRL
Q06PS0_MANHA          SPYIGLFGTVWGIMHSFMGLS-AVKQATLQSVAPGIAEALIATAIGLFAAIPAVMAYNRL
Q83BD7_COXBU          SPYVGLFGTVWGIMTSFRALG-AVQQVTIAMVAPGISEALIATAVGLFAAIPAVIAYNRF
E6WQS7_PSEUU          APYVGLVGTVFGIMVTMHDMVSQGQQVGIASVAPGISEALFATAIGLFVAIPAVWAYNRY
D3HSI9_LEGLN          APYVGLFGTVWGIMTSFQALG-HAQQATIAMVAPGISEALVATALGLFTAIPAVIAYNRY
Q2Y5G7_NITMU          SPYVGLFGTVWGIMNSFRGLS-NVAQATIAHVAPGIAEALIATAMGLFAAIPAVIAYNRY
Q0AJA1_NITEC          SPYVGLFGTVWGIMNAFRELS-NVGQATIAHVAPGIAEALIATAMGLFAAIPAVIAYNRY
F2LAN3_BURGS          SPYIGLFGTVWGIMNSFRGLA-NVQQATLANVAPGIAEALVATAIGLFAAIPAVVAYNRY
A1TPB7_ACIAC          SPYVGLFGTVWGIMHAFTGFA-GMEQVTLATVAPGIAEALVATAIGLFAAIPAVVAYNRF
F5RG00_METUF          SPYIGLFGTVWGIMNAFRGLS-NVGQATLAQVAPGIAEALVATAIGLFAAIPAVVAYNRF
B1XTC2_POLNS          SPYIGLFGTVWGIMHSFRGLA-NVQNAILSAVAPGIAEALIATAIGLFAAIPAVVAYNRA
B7J3G5_ACIF2          SPFIGLFGTVWGIMTAFMNIG-MAGQATLATVAPPVAEALIATAAGLFAAIPATAAYNRY
A4XRS3_PSEMY          SPYIGLFGTVWGIMNSFRGLA-QVQQATLATVAPGIAEALIATAIGLFAAIPAVIAYNRF
TOLQ_PSEAE            SPYVGLFGTVWGIMNSFRGLA-TVQQATLATVAPGIAEALIATAIGLFAAIPAVIAYNRF
R9S5W9_SIMAS          APISVCLAPSGASVNSFRGLA-NVHQATLATVAPGISEALVATAMGLFAAIPAVLAYNRY
A0A1T1HCX4_OCELI      SPYIGLFGTVWGIMNSFRDLA-HVQQATLAVVAPSISEALIATAMGLFAAIPAVIAYNRY
R4YNW6_OLEAN          SPYIGLFGTVWGIMHSFQGLA-MMKQATIASVAPGISEALVATAMGLLAAIPAVIFYNRF
S2KR90_HALAF          SPYIGLFGTVWGIMGSFQSLS-MAQQATLSTVAPWIAEALIATAMGLFAAIPAVIFYNRL
L0E135_THIND          SPYIGLFGTVWGIMHAFLGLS-GVQQATLAMVAPGIAEALIATALGLFAAIPAVIAYNRF
A4VKW9_PSEU5          SPYIGLFGTVWGIMNSFLGLS-QVQQATLSTVAPGIAEALIATAIGLFAAIPAVMAYNRF
L1LZ34_PSEPU          SPYIGLFGTVWGIMNAFLGLS-QVQQATLNTVAPGIAEALIATAIGLFAAIPAVMAYNRF
Q4KAB8_PSEF5          SPYIGLFGTVWGIMNSFLGLS-QVQQATLSTVAPGIAEALIATAIGLFAAIPAVIAYNRF
A5WFR6_PSYWF          SPYIGLFGTVWGIMNAFLGLA-QVEQVSLSAVAPGIAEALIATAMGLFAAIPAVLAYNHF
V2UGV9_9GAMM          APYIGLFGTVWGIMNAFIGLA-DVDQVTLATVAPGIAEALIATAIGLFAAIPAVLAFNHY
Q31H82_HYDCU          APYIGLFGTVWGVMHAFSSLG-DIQNATLASVAPGISEALIATAMGLFAAIPAVIAYNRL
A0L4V3_MAGMM          SPFVGLFGTVWGIMNAFLGLT-GAKASTLTMVAPGIAEALIATAMGLVAAIPSVIAYNKY
G8PJY3_PSEUV          APFVGLFGTVWGIMNAFTSIA-ASKNTNLAVVAPGIAEALFATGLGLIAAIPAVIAYNKL
Q92M96_RHIME          APFIGLFGTVVGIMTSFQAIA-GSKSTNLAVVAPGIAEALLATAIGLLAAIPAVIAYNKF
J7QWC6_METSZ          GPFVGLFGTVWGIMTSFRSIA-ASKNTSLAVVAPGIAEALLATAIGLFAAIPALIAYNKM
B2ICP1_BEII9          GPFVGLFGTVWGIMTAFRSIA-ASKNTSLAVVAPGIAEALFATAIGLFAAIPALIAYNKL
Q3SP18_NITWN          GPFVGLFGTVWGIMSSFQSIA-ASKNTSLAVVAPGIAEALFATAIGLIAAIPATIFYNKF
Q130X0_RHOPS          GPFVGLFGTVWGIMSSFQSIA-ASKNTSLAVVAPGIAEALFATAVGLIAAIPATIFYNKF
B6JJ21_OLICO          SPFVGLFGTVWGIMSSFQSIA-ASKNTSLAVVAPGIAEALFATAIGLIAAIPATIFYNKF
E3I2A4_RHOVT          APFIGLFGTVWGIMTAFQGIA-ASKNTNLAVVAPGIAEALFATALGLLAAIPAVIFYNAF
G4R981_PELHB          APFIGLFGTVWGIMNAFSSIA-ASQSASLGVVAGPIAEALFATAIGLVAAIPAVIAYNKL
A1UR82_BARBK          APFIGLFGTVIGIMNSFLSIS-ASQNTSLAIVAPGIAEALLATAIGLMVAIPAVVFYNKF
A1AZV1_PARDP          APFIGLFGTVWGIKTAFEEIA-ISQNTSLAVVAPGIAEALVATALGLLAAIPAVIFYNKL
                      .*    ...  .   ::  :        :  **  ::***.**. **..***:   :*  

B1KIF9_SHEWM          STQVDKIEMSYANFMEEFSSILHRQAYSEKDEA-------------------
A0KP96_AERHH          SNKVERLENAYANFMDEFTTILNRQIAQQQGDQ-------------------
Q6LP44_PHOPR          TNQVSKLEHTYATFMEEFSSILHRQAFAANQE--------------------
Q15RN8_PSEA6          SHQVEKLENNYGNFMEEFSSILHRQSLVTKADTVTNGPAQG-----------
Q3IIJ3_PSET1          ANKVEKLETHYINFMEEFANILHRQAATQIEAQANVSA--------------
TOLQ_ECOLI            NQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG-----------------
W1HLJ8_KLEPN          NQRVNKLELNYDNFMEEFTAILHRQAFTTSESNKG-----------------
A0A1V2BTL6_RAOTE      NQRVNKLELNYDNFMEEFTAILHRQAFTSSESNKG-----------------
A0A384L7U6_YERPE      NQHVNKLEQNYDNFMEEFIAILHRQAFASTESK-------------------
Q7N6T9_PHOLL          NQRVNKLEQNYDNFMEEFLAILHRQAFAAENKAENK----------------
D3UZV5_XENBS          SQRVNKLEQIYDNFMEEFLAILHRQAFTPNTNKS------------------
TOLQ_HAEIN            SLRVNAIEQDYGNFIDEFTTILHRQAFGKAPH--------------------
Q06PS0_MANHA          NLRLGKVEQGYVNFIDEFTTLLHRQAFSKR----------------------
Q83BD7_COXBU          SNELNAITQNYDTFQEEILNILHRRVYKYKLEEANAKATVS-----------
E6WQS7_PSEUU          TSRVDRLSQRYESFADEFSSILQRQTGADE----------------------
D3HSI9_LEGLN          TTRANDLLNRFDLFQEELISLIEQQNNDTVRG--------------------
Q2Y5G7_NITMU          ASSMDRLATRFESFMEEMSNVLQRQAGG------------------------
Q0AJA1_NITEC          ASDTAQLATRYESFIEEVSNVLQRRVAKPRDMANFS----------------
F2LAN3_BURGS          AHDIDRLASRFETFVEEFSNILQRQAQ-------------------------
A1TPB7_ACIAC          ARDIDRVAIHQETFIEEFSNILQRNLGAAPASASGH----------------
F5RG00_METUF          AHDIDRISIRWESFMEEFSNILQRQTR-------------------------
B1XTC2_POLNS          ATDVDRLSIRFETFIEEFTNILQHQTAGR-----------------------
B7J3G5_ACIF2          IHQLDKLDAQYEVFMDEFTNILHRQVPETKP---------------------
A4XRS3_PSEMY          SARGEMLIGRYYTFADEFQAILHRKVHTSED---------------------
TOLQ_PSEAE            SARSEMLIGRYYTFADEFQAILHRKVHTSDD---------------------
R9S5W9_SIMAS          SAKAESLLGAYETFSDEFSAILHRQVHSK-----------------------
A0A1T1HCX4_OCELI      STKTELLMVRYETFADEFSSILHRNVHNQNAG--------------------
R4YNW6_OLEAN          TTKVEQLITGMQTFGEEFSSILYRQTHRAKQPKKDAE---------------
S2KR90_HALAF          SSESSKLLGKYEDFAEEFHSILHRNLQGRGDSSGAA----------------
L0E135_THIND          ATDVDRVIGRFENFSDEFVALLARQTAGRGAADARE----------------
A4VKW9_PSEU5          AAHGQKLVGRYYAFGNELQARLHRRLHAASPSVAAAA---------------
L1LZ34_PSEPU          SARGQMLSARQYAFANELLARLHKRLHC-TPSMAAVA---------------
Q4KAB8_PSEF5          SARSQTLLTRYYAFGNELQVRLHRTLQGTPSHLAVAA---------------
A5WFR6_PSYWF          TAKAAGIYDSRALFCDEMTGMLQRETYETGAAPVASSNDVPTAAQNIQSPLV
V2UGV9_9GAMM          TAKGESLYSDRALFAEEMVALLQRQSLGS-----AREHD-------------
Q31H82_HYDCU          SVNTDKVIGQYENFAEGFLTIIQRQSHMIEKKTQD-----------------
A0L4V3_MAGMM          SSEMRRLHAKMDNFGAEFLNILERRSASRRRGQ-------------------
G8PJY3_PSEUV          QSDSGKLAARMEGFADEFSAILSRRIDERA----------------------
Q92M96_RHIME          TADAGKLTARMEAFADEFSAILSRQIDEKLQPSRQAAQ--------------
J7QWC6_METSZ          QGDVAKAQARMESFADEFSAILSRQIDQHAASSNRDRAA-------------
B2ICP1_BEII9          QNDVARKQAKLESFADEFSSILSRQIDQHNV---QDRAA-------------
Q3SP18_NITWN          TAEVNRQAQRLEGFADEFSAILSRQIDERA----------------------
Q130X0_RHOPS          TSEVNRQTQRLEGFADEFSAILSRQIDERA----------------------
B6JJ21_OLICO          TSEVNRQAQRLEGFADEFSAILSRQIDERA----------------------
E3I2A4_RHOVT          QQSASRLAQRLEGFADEFSAIVSRQLDLKT----------------------
G4R981_PELHB          SGDANKLVGRLEGFADEFAAILGRQLEARSRK--------------------
A1UR82_BARBK          IGESAQIIAQIEDFADEFSTIISRRIDEKVTSNS------------------
A1AZV1_PARDP          SSDADRITGGYETFADEFSTILSRQLDDE-----------------------
                                   *   .   : :