CLUSTAL format seed alignment for MF_02204

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q6MA24_PARUW          -------------MRIYS---FYLVALLGSACLLQSCARNGSDVWEDTKSAGRHMNRGVR
M1PQI7_DESSD          -----------MTRGRKI---SSGIFLLSVIFVLSACSSK--------------------
Q6AJ87_DESPS          ----------MTLNVKLL---FPALVGLSVLTLA-GCTCV--------------------
W0JCY2_DESAE          -------------MKKSV---ISLAAICCASFLAYGCSTA--------------------
B9KES9_CAMLR          --------------MKKI---IFASITAFAVIVS-GCATK--------------------
E0UQV0_SULAO          --------------MKSI---VLSSVVTALLVFS-GCSTK--------------------
Q30QQ7_SULDN          --------------MKSI---VLASAVAALLVLS-GCGDK--------------------
Q479Q8_DECAR          ---------------MRA---SLPATLLLSTLLA-ACASK--------------------
E3FE35_STIAD          ---------------MRS---SLLPWILIALSAS-ACATK--------------------
Q2IEU5_ANADE          -------------MRRVL---LLALTVSGALVLG-GCPSK--------------PKNGEC
Q83F58_COXBU          MSRKFTDKIKGIVMNNLVKNSGLAVIALATLNLS-GCKHH--------------------
B5YJ11_THEYD          ---------------MKI---KIILLAIFCLFLIIACAER--------------------
Q31H78_HYDCU          --------------MNKL---KLLVALGVVSTLA-ACTSA--------------------
A1BET5_CHLPD          ---------------------------MFSLMVTAGCSSK--------------------
B2KE81_ELUMP          -------------MKNLI---KIAMVACLVLSIA-ACRKN--------------------
Q5H298_XANOR          ----MAQSLHRYPMNKST---RVLLVSLLSVAVLAGCSKK--------------------
Q8P6F3_XANCP          -------------MNKST---RVLLVSLLSVAVLAGCSKK--------------------
A5FVF6_ACICJ          ---------------MNI---KALGALAAVALLA-ACSNA--------------------
Q0ALY6_MARMM          ---------------MKI---KLFAIAALGAFAT-ACAST--------------------
Q9A3H5_CAUVC          ----MRRNWMSFDTQRAA---RLALVGLAAASLA-ACASR--------------------
Q9ZCH2_RICPR          ---------------MKT---KITLAFLALFMLA-GCNTT--------------------
Q3J042_RHOS4          --------------MTHL---PKALILLAALGLA-ACNNP--------------------
Q2RVE9_RHORT          --------------MMKF---GFLGAVAATMLLA-ACSST--------------------
PAL_AGRFC             MSRTNISALSPMQKLARN---PAVIAMTLALALA-GCANK--------------------
Q89ED8_BRADU          ----------MKHPMRILQGLKLAAVLAVALSMG-ACANK--------------------
C9RJU7_FIBSS          -------------MGKVF---KLALMGTAVALFAWGCSKE--------------------
Q74AP7_GEOSL          -------------MKYVH---ATLLVAFSIACAA-GCAKK--------------------
Q1IU54_KORVE          -----------MKW-------AMMVVVLAMMIVGSACSNKKPTPPPAAPPPPPAPAPTAT
I4BZU1_DESTA          -----------MPSRHVK---RGIFLLLAVLFLASGCSRP--------------------
Q726K3_DESVH          -----------MNMFKRV---GLVLTLALVLAAGFGCAKK--------------------
Q74H68_GEOSL          ------------MYSRTL---GVVALACFALSLVGGCAKK--------------------
PAL_BUCBP             -----------MKSKKIF---KILTLLLPMITTF-SCSFP--------------------
PAL_LEGPN             -----------MKAGSFY---KLGLLVASAVLVA-ACSKT--------------------
D7DMU0_METV0          -------------MNKSTWNTKLLSSLLLALVLS-ACKST--------------------
PAL_PSEAE             -----------MEMLKFG---KFAALALAMAVAV-GCSSK--------------------
A1VNY0_POLNA          -------------MKRFL---SSVISSLVLAATLVACGSN--------------------
A1WGN2_VEREI          ----------------MI---KRISLALTIAALVAGCSSG--------------------
Q63RA7_BURPS          ------------MMSKKL---RLAFAMLMIGALA-ACKSG--------------------
Q7VU04_BORPE          ------------MKSRIA---KSLTIAALAATLA-ACSSV--------------------
Q7VR83_BLOFL          ----------MKNNKLIFTSSAYLISIMYTIFFCVSCKHM--------------------
Q8EDJ9_SHEON          -----------MDLNKLL---KAMLVALPIMAIS-ACSST--------------------
PAL_HAEIN             -------------MNKFV---KSLLVAGSVAALA-ACSSS--------------------
E3G3S0_ENTLS          -----------MQLNKVL---KGLMIALPVMAIA-ACSSN--------------------
PAL_ECOLI             -----------MQLNKVL---KGLMIALPVMAIA-ACSSN--------------------
A8AJ53_CITK8          -----------MQLNKVL---KGLMIALPVMAIA-ACSSN--------------------
A0A384KAK0_YERPE      -----------MQLNKVL---KGLMLALPVLAVA-ACSSN--------------------
B2VBT7_ERWT9          -----------MQLNKVL---KGLMLALPVIAVA-ACSSH--------------------
Q6LP48_PHOPR          -----------MQLNKIL---KGLAIALPMMTLA-ACSST--------------------
Q9KR12_VIBCH          -----------MQLNKVL---KSLLIALPVLAVT-ACSSS--------------------
Q5E688_ALIF1          -----------MQLNKLL---KSLLIALPVVALS-ACSSS--------------------
                                                         .*                       

Q6MA24_PARUW          ALGGKHGDSRQVHSKNDFECVDDEYSHQEGGFQDCDYSRADFIPLQDQANNEFAMADIL-
M1PQI7_DESSD          ---------------------------------------------------KPEDTAEL-
Q6AJ87_DESPS          ----------------------------------------------KPGEECADPVLMT-
W0JCY2_DESAE          --------------------------------------------PKKPLAEKPAPQKQE-
B9KES9_CAMLR          ------------------------------------------------NTSVSSSSSVD-
E0UQV0_SULAO          -------------------------------------EPAVQKKTEEVASPVVQEVEAV-
Q30QQ7_SULDN          ----------------------------------------------DPQVDANDGAVAE-
Q479Q8_DECAR          -------------------------------------GDIPPSKHISQSGPLKVHPGLL-
E3FE35_STIAD          -----------------------------------------------SAATVSNEGLSG-
Q2IEU5_ANADE          KTSQDCAEQEGYGKVCVEGRCQECGQDSDCKEGFVCRANACVPKPQCAADTDCPAGQTCQ
Q83F58_COXBU          --------------------------------------------------PAGANAATG-
B5YJ11_THEYD          ----------------------------------------------KIYMPDGKETTGI-
Q31H78_HYDCU          ---------------PKKGENADMNVEPVSQEEMDYAEKARLELEKANSGEVNEVEVLG-
A1BET5_CHLPD          ---------------------------------------------NAVNTQDGNAGLSS-
B2KE81_ELUMP          ----------------------------------------------VQNDDMLADENLS-
Q5H298_XANOR          ---------------------------------------------VKETPPPATNTTAG-
Q8P6F3_XANCP          ---------------------------------------------VKETPPPATDTTAG-
A5FVF6_ACICJ          ----------------------------------------------------PKTTAMA-
Q0ALY6_MARMM          ----------------------------------------------PVEDTAPVRDTRP-
Q9A3H5_CAUVC          ------------------------------------------PKPQPVTPPPAQPQPTQ-
Q9ZCH2_RICPR          ---------------------------------------------------KKTTQMAG-
Q3J042_RHOS4          ----------------------------------------------DRYGAGGAGGAGGT
Q2RVE9_RHORT          ----------------------------------------------------PDTGAGG-
PAL_AGRFC             ---------------------------------------------KNMPNSAGELGLGG-
Q89ED8_BRADU          --------------------------------------------------NSAADAMAN-
C9RJU7_FIBSS          -------------------------------------KPETDPQPQTAPEAPADSTLNL-
Q74AP7_GEOSL          --------------------------------------ELVVPEPAVVSAPAQLPATET-
Q1IU54_KORVE          ITANPNTVNAGQPTTLTWQTTNATDVTIDVLGSVDPNGSKQVTPVESTTYHLVAKGSGG-
I4BZU1_DESTA          --------------------------------------------------IVRQPGPIP-
Q726K3_DESVH          -----------------------------------------------------QVAATP-
Q74H68_GEOSL          ----------------------------------------EMVKPDQAAPTTAAAPVSP-
PAL_BUCBP             ----------------------------------------------KNKLNSNNVDTFY-
PAL_LEGPN             -----------------------------------------------PGSADGGAAVGD-
D7DMU0_METV0          ------------------------------------PMNTKPVTVEDKSPAQVTKPAEN-
PAL_PSEAE             ------------------------------------------------GGDASGEGANG-
A1VNY0_POLNA          ------------------------------------------VKLQDVPVEDRSASSSQ-
A1WGN2_VEREI          ------------------------------------VKLDEVPIEDKTASTLSGEANAG-
Q63RA7_BURPS          ----------------------------------------------VKLDEHANQGDAV-
Q7VU04_BORPE          ----------------------------------------------PLDDKAGQAGGSG-
Q7VR83_BLOFL          -----------------------------------------------INDNKSNENMYL-
Q8EDJ9_SHEON          ----------------------------------------SESETDAMGSTSGSGSELN-
PAL_HAEIN             ---------------------------------------------------NNDAAGNG-
E3G3S0_ENTLS          ---------------------------------------------KNASNDQSGEGMMG-
PAL_ECOLI             ----------------------------------------------KNASNDGSEGMLG-
A8AJ53_CITK8          ----------------------------------------------KNASNDGSEGMLG-
A0A384KAK0_YERPE      --------------------------------------------------KSANNDQSG-
B2VBT7_ERWT9          ----------------------------------------------KNNNNDQTNGMGL-
Q6LP48_PHOPR          ---------------------------------------------DSTDSSAASETTDG-
Q9KR12_VIBCH          ----------------------------------------------DDAANSGSQTNQS-
Q5E688_ALIF1          -------------------------------------DSATDSTAGQESTNAAETQTTN-
                                                                                  

Q6MA24_PARUW          -----ARQPRETP------------GEIGSSIPSIESFQDPCMIPQLAAIFK--------
M1PQI7_DESSD          -----SRQDSTAI----------------GQEESLDSRSIGIMEGRTTGPML--------
Q6AJ87_DESPS          -----EVVEEVVV-------------IEEPLDTVVVPLGIGEARTTEGML----------
W0JCY2_DESAE          -----VQKPVSTP--------------AVSPTTTPSVSEEERLKEIFQ------------
B9KES9_CAMLR          -----GSKGSGGS----------------------DRFENLESLNSVA------------
E0UQV0_SULAO          -----TTETVASE--------------NSTINSSTNELSMNAIESKLP------------
Q30QQ7_SULDN          -----QAAPAKSA-------------SSVKAPTSSNTETAAEYMARIEKELK--------
Q479Q8_DECAR          -----GQPVPPEL-------QQETRTSPTTTGTADSAIKIDPVGLRTQ---R--------
E3FE35_STIAD          -----PTTPRPPP-------------APVAEKPSVPDEDADGASLAFG------------
Q2IEU5_ANADE          GERCVAREPGSCASDRDCGAGEKCQAGRCAAAAPEASVPPECADVTAF------------
Q83F58_COXBU          -----LSDGTGAQ----AYALAEGKGYQGQLKKDSEGRIINPLVAPAN---Q--------
B5YJ11_THEYD          -----VKKEEGNE---------IEKTKPSEEETSFTTSQMAELIKKLQEEIG--------
Q31H78_HYDCU          -----AGATGSDV--------------SSESLASQDLNAMSQDVPALGQTFEP-------
A1BET5_CHLPD          -----GQSGWGTT-------------SSSVAQSPSGYGFDEWQKGPLG------------
B2KE81_ELUMP          -----APTTVDVV-----------------VEETPVIIDVQNTEIALR------------
Q5H298_XANOR          -----SSVPTGPS--------------TSGLYGPGDLDTDACLRQR--------------
Q8P6F3_XANCP          -----STAPTGPS--------------TSGLYGPGDLDTDACLRQR--------------
A5FVF6_ACICJ          -----TGSGATAA------------------QSGPAPGSEQQLVADVG---D--------
Q0ALY6_MARMM          -----VDPPIEDT---------------RPIETGPMAGSPDHFVATAG---D--------
Q9A3H5_CAUVC          -----PTPYTPPA--------------PPPVTSGILPGSVQDFVVNIG---D--------
Q9ZCH2_RICPR          -----------------------------MVHQCEETSLIKDFEKHAG---N--------
Q3J042_RHOS4          GGYGSGGYGAGGI-------------DSQGLGGPNDPRSIAYFQQTLG---D--------
Q2RVE9_RHORT          -----AGAGGASS-----------------STSGPTAGSVAEFQQVVG---D--------
PAL_AGRFC             -----AGSATP--------------------------GSQQDFTVNVG---D--------
Q89ED8_BRADU          -----AATPGSQQ----------------------------DFVVNVG---D--------
C9RJU7_FIBSS          -----DALVADTL--------------DADSLARLEAERLEAERARLE---ELINRIMLE
Q74AP7_GEOSL          -----VAPPATTI-------------DAHESIAATDIAEDRITPAGNA---T--QASPLK
Q1IU54_KORVE          -----TQDATARVTVSG----------GGASQPDEISLSDQQAFAKYV---K--------
I4BZU1_DESTA          -----GGPGAPTV-------------------GGPVEQDLQVVQTTLK------------
Q726K3_DESVH          -----EAAPVSDM--------------GDSKSADMAALARAQQIITDA------------
Q74H68_GEOSL          -----APQPAQPKEEPVKAQTITEAPVAVASQASDTAGRAEAAETSLE------------
PAL_BUCBP             -----EQETNKSK--------------QQLTNFSEDNFDETLEKLKKG---N--------
PAL_LEGPN             -----GDATAQGL-------------GQMTHFAGQEPGESYTTQAPHN------------
D7DMU0_METV0          -----TGADTSAV--------KEVAIDGNATDSGNNPLKDPNNILSKR------------
PAL_PSEAE             -----GVDPNAGY--------------GANSGAVDGSLSDEAALRAIT------------
A1VNY0_POLNA          -----ADADAAAA--------------ASRGVAPVQIGASDASVAGPANTAK--------
A1WGN2_VEREI          -----GNTGNAAQ--------------GSGGVAGVDLTQPARDTAGPVGIAR--------
Q63RA7_BURPS          -----STQPNPEN----------------VAQVTVDPLNDPNSPLAKR------------
Q7VU04_BORPE          -----QGSASGQI---------------------LDPFNPQSILAQQR------------
Q7VR83_BLOFL          -----NFVPSDNL--------------KDNDIPISKTNHIQNLKLKN-------------
Q8EDJ9_SHEON          -----GGVQTGGI---------------GGMLSPEEQQRQELEQLRKE---H--------
PAL_HAEIN             -----AAQTFGGY-------------------------SVADLQQRYN------------
E3G3S0_ENTLS          -----AGTGMDAN--------------GNGNMSSEEQARLQMQQLQQN---N--------
PAL_ECOLI             -----AGTGMDAN-------------GGNGNMSSEEQARLQMQQLQQN---N--------
A8AJ53_CITK8          -----AGTGMDAN--------------GSGNMSSEEQARLQMQQLQQN---N--------
A0A384KAK0_YERPE      -----MGAGTGTE--------------NGSNLSSEEQARLQMQELQKN---N--------
B2VBT7_ERWT9          -----DGSANGGM--------------NSGNMSSDEQARLQMQELQKN---N--------
Q6LP48_PHOPR          -----STQTVVTT-------------PVDGGSAALSEQELRSQELRQE---Q--------
Q9KR12_VIBCH          -----AVSTVDSN--------------GLNAQGQLTEQELKEQALREN---Q--------
Q5E688_ALIF1          -----GAEGQTDT-------AVLSSIEADEAMNEAEVRAQAEQELRKV---Q--------
                                                                                  

Q6MA24_PARUW          TIY-FDYDSSM--------IKGQANLQTIHQIAD-FMRR---HPNVYIFIEGHTDERGPQ
M1PQI7_DESSD          PVY-FGYDRSS--------IRPDQV-PRMKVNSD-FLKD---NEGIRIRIEGNCDPRGTR
Q6AJ87_DESPS          PVY-FNFDSSA--------VGEDQK-PRVQVNAD-FMDA---NVDYMVRIEGNTDSRGTD
W0JCY2_DESAE          RIH-FNFDKYNLTHIDKWGINQDVP-KVLDGIAD-YMAK---HPDIKIKIEGNCDERGTE
B9KES9_CAMLR          NVY-FDFDKFN--------VRSDMQ-KVIANNAEIFNKE---AANAAIVVEGNCDEWGTD
E0UQV0_SULAO          TIY-FDFDKYN--------IKPEMQ-ERIDAAAELGKTG---AKAFSVKLEGNCDEWGSD
Q30QQ7_SULDN          TIY-FDFDKFN--------IKADMQ-ANLSTDASVAKSS---ASKFQLKLEGNCDEWGSD
Q479Q8_DECAR          SVY-FDLNSAD--------IKADYD-PALRAHAR-YLAE---HPNARVRVEGNADERGSS
E3FE35_STIAD          PIY-YELDSTT--------LRPESR-ETLERLAE-ALRR---RPGARVTISGHTCELGTT
Q2IEU5_ANADE          SVH-FAFDRSN--------LTADSQ-QNLQKLAD-CLKQ---APAKRVLVQGNCDERGTA
Q83F58_COXBU          TYY-FDFDSTQ--------LRSLDL-GAIRVQAN-YLAT---HSTAKVRLEGNTDNRGSR
B5YJ11_THEYD          DIH-FDYDKYD--------VRQDDL-PTLKKVAS-YLQK---YPKLRVIIEGHCDERGTN
Q31H78_HYDCU          VIY-FDYDQYI--------VDDTSL-ETVKHYAT-ILID---NPSEKIQLVGHTDERGTP
A1BET5_CHLPD          DVF-YDFDSSL--------LSSEAQ-EQLTRNSG-WMKS---NVQAAIIIQGHCDDRGTS
B2KE81_ELUMP          QVN-FALDKYN--------LSDAAK-KVLADNAA-LIKTKTANAAFNIVVEGHCDERGTI
Q5H298_XANOR          VVY-FDLDQDS--------LKPEFQ-AIMACHAK-YLRD---RPSSRITLQGNADERGSR
Q8P6F3_XANCP          VVY-FDLDQDS--------LKPEFQ-AIMACHAK-YLRD---RPSSRITLQGNADERGSR
A5FVF6_ACICJ          RAF-FGFNKSN--------LTGADK-ATLDRQAS-WLAK---YPNVDVLIAGNADPRGTE
Q0ALY6_MARMM          RVF-YGLDRHD--------LSDEAR-ATLRRQAA-WLAS---YPGTRILVAGNCDERGTR
Q9A3H5_CAUVC          RVY-FDTDEYV--------IRADAQ-PVLAGQAQ-WLNR---YSSVRIRIEGNADERGTR
Q9ZCH2_RICPR          AVW-FAFDSSS--------LSPKAK-EELERQAC-WLSK---HPEVKVTVEGHCDERGTR
Q3J042_RHOS4          RVF-FTVDQST--------LNDAAR-ATLDTQSQ-WLMS---NADYAIIIEGHADEQGTR
Q2RVE9_RHORT          RVF-FGYDQYN--------LAPDAR-ATLQRQAQ-WLNQ---YGNFSLTVEGHADERGTR
PAL_AGRFC             RIF-FDTDSTS--------IRADAQ-QTLQRQAQ-WLSR---YPNYAITVEGHADERGTR
Q89ED8_BRADU          RVF-FESDQTD--------LTPQAI-VTLEKQAQ-WLQT---YPRYSFTIEGHADERGTR
C9RJU7_FIBSS          DVY-FDYDRSE--------LTENAK-RLLAQVAE-ILVN---ENRFIVTVEGHTDARGTE
Q74AP7_GEOSL          IVY-FDFDAWV--------LNGEAR-EILAGNAE-WLRK---NPGVAVILEGHTDERGSD
Q1IU54_KORVE          DIY-YDYDAYT--------VRAADQ-AVLQANAN-FFKQ---HPNIHFTIEGHCDERGST
I4BZU1_DESTA          PIY-FAYDSFT--------LSPEAQ-SAAQYNAE-ILKR---APQFGTVSEGHCDERGTA
Q726K3_DESVH          KVY-FEFDKFD--------LKAESK-EVLKQKAE-VMKK---FPSIRVLVEGHCDERGTQ
Q74H68_GEOSL          RIY-FDFDAFV--------LSQTAR-DTLSRNAEALLKK---MPNAKVSIEGHCDERGSD
PAL_BUCBP             TIY-FPFNNHQ--------VNSKYA-KNLNDLAQ-FLCH---HSNQKIMIEGHTDSRGTN
PAL_LEGPN             QLYLFAYDDST--------LASKYL-PSVNAQAE-YLKT---HPGARVMIAGHTDERGSR
D7DMU0_METV0          NVY-FDFDSDA--------VKAEFR-PLIEAHAK-YLLA---HTSAKVILQGNTDERGTR
PAL_PSEAE             TFY-FEYDSSD--------LKPEAM-RALDVHAK-DLKG----SGQRVVLEGHTDERGTR
A1VNY0_POLNA          IVY-FDFDSYV--------VKPEFQ-SVIEAHAR-YLTA---NKARKMAIEGHTDEIGGR
A1WGN2_VEREI          IVY-FDYDSYV--------IKPEFQ-TLIEAHSR-FIKT---DTKRKLMLEGHTDERGGR
Q63RA7_BURPS          SVY-FDFDSYS--------VQDQYQ-ALLQQHAQ-YLKS---HPQRHILIQGNTDERGTS
Q7VU04_BORPE          SVY-FDFDSYT--------VSEQYR-GLVETHAR-YLAS---NNQQRIKIEGNTDERGGA
Q7VR83_BLOFL          TIY-FSLDQYC--------VLPIFF-EILDLHAD-FLCN---NPLYKIIIEGHTDERGTP
Q8EDJ9_SHEON          IIY-FDFDRSE--------VQTEYA-AVLEAHGT-YLVE---HPSVRVLIEGHADERGTP
PAL_HAEIN             TVY-FGFDKYD--------ITGEYV-QILDAHAA-YLNA---TPAAKVLVEGNTDERGTP
E3G3S0_ENTLS          IVY-FDLDKYD--------IRSDFA-AMLDAHAN-FLRS---NPSYKVTVEGHADERGTP
PAL_ECOLI             IVY-FDLDKYD--------IRSDFA-QMLDAHAN-FLRS---NPSYKVTVEGHADERGTP
A8AJ53_CITK8          IVY-FDLDKYD--------IRSDFA-AMLDAHAN-FLRS---NPSYKVTVEGHADERGTP
A0A384KAK0_YERPE      IVY-FGFDKYD--------IGSDFA-QMLDAHAA-FLRS---NPSDKVVVEGHADERGTP
B2VBT7_ERWT9          IVY-FGLDKYD--------IQSDFA-QMLDAHAT-FLRS---NPSYKVTVEGHADERGTP
Q6LP48_PHOPR          TVY-FKFDTAE--------IQADYQ-AMLEAHAE-FLSN---SSDVKVIVEGHADERGTP
Q9KR12_VIBCH          TIY-FAFDNAT--------IASDYE-AMLAAHAA-YLVK---NPSLRVTIEGHADERGTP
Q5E688_ALIF1          TVY-FAFDNST--------ISSEYE-DMLAAHAA-FLSA---DPSIKVTVEGHADERGTP
                          :  :           :            .                  *:    *  

Q6MA24_PARUW          AYNLALGSRRSNAVRNLLISEDVNPDNLFTISYGKERPVVLEKHEEGWSRNRRVEFKIYE
M1PQI7_DESSD          EYNLALGEKRALVAKKYLVNVGIAADRISTVSLGEEKILLHGHDELSWAQNRRDDFIVEK
Q6AJ87_DESPS          EYNMALGERRALSAQQYLMDLGVEEARLTTVSYGKERLLLNGQSEDAWSQNRRCDFVVAK
W0JCY2_DESAE          AYNLALGQKRADAAKNYLVMHGISPDRIETLSNGKLKPVDPAHNEYAWAKNRNDQFVILN
B9KES9_CAMLR          EYNQALGLKRAKAVKESLVAQGVSADRISVKSYGETNPVCTERTKACDAQNRRAEFKLSK
E0UQV0_SULAO          EYNFALGLKRANAVKKALVADGIDPSRISMVSYGESNPVCTEHTRACWAKNRRVNFKLLP
Q30QQ7_SULDN          EYNFALGLKRAESVKKALVAEGVDANRISMVSFGESNPTCTDKTKECWAENRRVDFKLLP
Q479Q8_DECAR          EHNRRLGLKRAENVRSAMLSNGAAEKQIAIKTLGEARPKLVGHDEASWSENRRADVIYER
E3FE35_STIAD          EYNLALGQRRAAMAKDYLVKLGVGPGNVAVVSYGEESPAVLGSGEEVWSRNRRSEFNLSV
Q2IEU5_ANADE          QYNVALGNRRAEAAKKYLTDLGVGST-VDTVSYGEEKPVCSEATEACWAKNRRDDFQIER
Q83F58_COXBU          EYNIGLGWRRDQAVARILEQEGVAPKQIDMVSYGKERPAVMGNNENAWRLNRRVNLIYEA
B5YJ11_THEYD          EYNFALGQKRADSAKQYLITLGIISSRIDIISYGEEKPLCTEQNESCWQKNRRAHFVFIE
Q31H78_HYDCU          EYNLALGEKRAKAVAEAFMLYGVHKDRIEVISLGEELPVMEGHNEEAWAKNRRVEIKAQ-
A1BET5_CHLPD          EYNLALGDRRAVSAREFLIRTGIASSRIETITFGEERPFSTSQSEEGLAKNRRAHFVIK-
B2KE81_ELUMP          SYNIALGEKRANEVKNYYTRLGVPAKNIVTVSYGEEKPLCYDATENCYAKNRRAETVLTV
Q5H298_XANOR          EYNMGLGERRGNAVSSSLQAAGGSASQLTVVSYGEERPVCTESNESCWSQNRRVEIVYTA
Q8P6F3_XANCP          EYNMGLGERRGNAVSSALQAAGGSASQLTVVSYGEERPVCTETSESCWSQNRRVEIVYTA
A5FVF6_ACICJ          AYNLALGARRAHAARDYLVAKGVAASRIQTVSYGKSCLVSPGNTEQDYAQDRVAITSVQG
Q0ALY6_MARMM          EYNLALGARRASAARTYLISQGVDPSRISTTSYGKERPSCSQSSETCWAVNRNATTTLLS
Q9A3H5_CAUVC          EYNLALGARRANAVRDFLIAQGVSSARIETISFGKERPIDPGSSEEAWAKNRNGRTAITD
Q9ZCH2_RICPR          EYNLALGERRAAAAKQFLANKGIAHNRLNTISYGKDKPAMIGNTEEAFSYNRRAVTVLHK
Q3J042_RHOS4          EYNLALGARRASAVQDYLISKGIAPSRMKTVSYGKERPVEVCSTEACYSKNRRAVTVLSM
Q2RVE9_RHORT          EYNLALGERRANSVREFLISQGVSANRLRVVSYGKERPVCTETAESCYARNRRGVSVPQ-
PAL_AGRFC             EYNLALGARRAAATRDFLASQGVPASRMKTISYGKEKPVAVCDDISCWSQNRRAVTVLGG
Q89ED8_BRADU          EYNIALGARRAQSVRSFLASRGIDANRMRTISYGKERPVAVCNDISCWSQNRRAVTVLNA
C9RJU7_FIBSS          DYNISLGARRSTVVREFLIAYGVDANRLVSVSYGKERPKVQGTDETAYSKNRRAHFRVSI
Q74AP7_GEOSL          AYNLALGEQRAKSAMKYLQTLGIDAGRMTVVSYGEEKPAVEGHDESAWAGNRRVEFIPKR
Q1IU54_KORVE          EYNLALGDNRASAAKNAIVQAGIPASSVRTISYGKEKPFCTESNEQCWQQNRRAHFVISK
I4BZU1_DESTA          EYNLALGDRRARAVVEYMVTLGIPPNKFSTVSYGSELPVDTAHNEEAWSKNRRVYLRVSR
Q726K3_DESVH          EYNLALGERRARAAYEYLVMLGVNAGQLEMISYGKERPAVEGHGEAAWSKNRRDEFKVIK
Q74H68_GEOSL          EYNLALGEKRAKTAMNYLITLGVPAARLSIISYGEEKPLDPGHTEEAWAKNRRDEFVIVK
PAL_BUCBP             KYNMYLGQKRADSVKLYLESKGVSNQQITTVSYGSSKPVAHGNKENSYSKNRRSVIIYQ-
PAL_LEGPN             EYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEA
D7DMU0_METV0          EYNLSLGQRRSVAVKKSLNLLGVQDAQIETVSFGEEKATEGCADDACSKQNRRVDVVYEN
PAL_PSEAE             EYNMALGERRAKAVQRYLVLQGVSPAQLELVSYGKERPVATGHDEQSWAQNRRVELKK--
A1VNY0_POLNA          EYNLALGQKRAEAVRRALGLLGVTDSQVEAVSFGKEKPAVPGLDEASMAKNRRAEINYR-
A1WGN2_VEREI          EYNLSLGQKRAEAVRRALGLLGVPDSQMEAVSFGKEKLAVQGHTEEAHAQNRRVEMTYR-
Q63RA7_BURPS          EYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ
Q7VU04_BORPE          EYNLALGQRRADAVRRMMTLLGVSDNQIETISFGKEKPKATGSSEADFAENRRADIVYQR
Q7VR83_BLOFL          EYNIGLGERRAYAVKKYLQSKGVLSNQIDTVSYGKEKPIAFGQNEESYSKNRRVVLLY--
Q8EDJ9_SHEON          EYNIALGERRAKAVAKYLQGMGVQPSQMSIVSYGEEKPLDFTRTDEGFAKNRRAVLVY--
PAL_HAEIN             EYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY--
E3G3S0_ENTLS          EYNIALGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY--
PAL_ECOLI             EYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY--
A8AJ53_CITK8          EYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYAKNRRAVLVY--
A0A384KAK0_YERPE      EYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY--
B2VBT7_ERWT9          EYNIALGERRSSAVKMYLQGKGVAEDQISIVSYGKEKPAVLGHDESAYAKNRRAVLVY--
Q6LP48_PHOPR          EYNIALGERRANAVVQYLQALGVSASQISIVSYGEEKPLVLGHTDADYAKNRRAVLVY--
Q9KR12_VIBCH          EYNIALGERRAQAVAKYLEALGVQAGQLSIVSYGEEKPLVLGQSEEAYAKNRRAVLVY--
Q5E688_ALIF1          EYNIALGERRAKAVSKYLQALGVSADQISIVSYGEEKPLVLGQTAEDYAKNRRAVLVY--
                       :*  ** .*   .       .     .   : *.               :*        

Q6MA24_PARUW          R-------
M1PQI7_DESSD          --------
Q6AJ87_DESPS          --------
W0JCY2_DESAE          K-------
B9KES9_CAMLR          --------
E0UQV0_SULAO          --------
Q30QQ7_SULDN          --------
Q479Q8_DECAR          ED------
E3FE35_STIAD          AQARMDAR
Q2IEU5_ANADE          --------
Q83F58_COXBU          Y-------
B5YJ11_THEYD          EGK-----
Q31H78_HYDCU          --------
A1BET5_CHLPD          --------
B2KE81_ELUMP          K-------
Q5H298_XANOR          Q-------
Q8P6F3_XANCP          Q-------
A5FVF6_ACICJ          FNPQHCH-
Q0ALY6_MARMM          GYTN----
Q9A3H5_CAUVC          GAR-----
Q9ZCH2_RICPR          --------
Q3J042_RHOS4          GAGV----
Q2RVE9_RHORT          --------
PAL_AGRFC             AGM-----
Q89ED8_BRADU          SS------
C9RJU7_FIBSS          DQ------
Q74AP7_GEOSL          --------
Q1IU54_KORVE          --------
I4BZU1_DESTA          --------
Q726K3_DESVH          --------
Q74H68_GEOSL          --------
PAL_BUCBP             --------
PAL_LEGPN             TR------
D7DMU0_METV0          E-------
PAL_PSEAE             --------
A1VNY0_POLNA          --------
A1WGN2_VEREI          --------
Q63RA7_BURPS          --------
Q7VU04_BORPE          --------
Q7VR83_BLOFL          --------
Q8EDJ9_SHEON          --------
PAL_HAEIN             --------
E3G3S0_ENTLS          --------
PAL_ECOLI             --------
A8AJ53_CITK8          --------
A0A384KAK0_YERPE      --------
B2VBT7_ERWT9          --------
Q6LP48_PHOPR          --------
Q9KR12_VIBCH          --------
Q5E688_ALIF1          --------