CLUSTAL format seed alignment for MF_02207

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MREB_BACSU            ---------------------------MFGIGARDLGIDLGTANTLVFVK-GKGIVVRE-
Q38XC7_LACSS          ---------------------------MFGLGTRNIGIDLGTANTLVYMD-GKDIVLRE-
B0KAD9_THEP3          ----------------------------MRGFSRDIGIDLGTATTLVYVQ-GKGIVLRE-
K4LRY7_THEPS          -----------------------------MLFTRDLGIDLGTANTLVHLK-GKGIILME-
A0A222TBA9_9ACTN      ----------------------------MSFIGRDMAVDLGTANTLVYVR-GRGIVLNE-
MREB_ECOLI            -----------------------MLKKFRGMFSNDLSIDLGTANTLIYVK-GQGIVLNE-
J7U1C3_MORMO          -----------------------MFKKIRGMFSNDLSIDLGTANTLIYVK-GQGIVLDE-
G4QFF8_GLANF          -----------------------MFKKLRGMFSNDLSIDLGTANTLIYIK-DQGIVLNE-
E1SN04_FERBD          -----------------------MFKKVRGLFSNDLSIDLGTANTLIYVK-DQGIVLNE-
A0A0Q2RJE1_VIBFU      -----------------------MFKKLRGMFSNDLSIDLGTANTLIYVK-GQGIVLDE-
D4G7J1_RIEPU          -----------------------MFKKIRGIFSNDLSIDLGTANTLIYVK-GQGIVLDE-
MREB_PASMU            ----------------------MLFKKIRGLFSNDLSIDLGTANTLIYVK-GQGIVLDE-
F6AF11_PSEF1          -----------------------MFKKLRGMFSSDLSIDLGTANTLIYVR-ERGIVLNE-
Q7CLP3_XANCP          -----------------------MFKKLRGMFSNDLSIDLGTANTLIYVR-GQGIVLNE-
Q8Y3C1_RALSO          -----------------------MFGFLRSYFSNDLAIDLGTANTLIYVR-DKGIVLDE-
Q2KU74_BORA1          -----------------------MFGFLRSYFSSDMAIDLGTANTLIYVR-GKGIVLDE-
A1W2L8_ACISJ          -----------------------MFGAFRRYFSTDLAIDLGTANTLIFAR-DKGIVLDE-
Q7NPY5_CHRVO          -----------------------MFRSLTGYFSNDLAIDLGTANTLIYMR-SKGIVLDE-
MREB_CAUVN            -----------------------MFSSLFGVISNDIAIDLGTANTLIYQK-GKGIVLNE-
B8DRC1_DESVM          --------------------MAKILDFVLGMFSNDLAIDLGTANTCVYVK-GQGIVLRE-
F0JDA7_DESDE          --------------------MGNLLNRIIGSFSNDLAIDLGTANTLVYVK-GKGVMLSE-
C0Q988_DESAH          --------------------MNLIIDSLLGIFSSDLALDLGTANTLVYVK-GKGIVLSE-
Q9Z756_CHLPN          MSPHRNLFKLKNFSNRLYNRALGRFDKVFNFFSGNVGIDLGTANTLVYVR-GRGIVLSE-
F8KYQ5_PARAV          MS-KKNQSGLKESFDTMYRSAFGQLNKFRGAFSNDIGIDLGTANTLVFVR-GKGIVLAE-
Q1PZZ1_KUEST          ---------------------MHPLDFILGFVSTDMGIDLGTANTLVCIP-GHGIVLSE-
B2A3F3_NATTJ          ----------------------------MLGLNTDIGVDLGTATVLIYRR-KKGVVLQE-
B1MWY9_LEUCK          -------------------------------MAKDIGIDLGTANVLIYVE-GKGIVLNE-
B8IZZ9_DESDA          ----------------------MFLRRLFRFLSKDIAMDLGTANTLLYTR-AHGIVVNE-
Q1MP88_LAWIP          ------------------------------MKRKYIAMDLGTANTLVFIQ-SQGIVLNE-
R5FDM5_9BACT          -------------------------MGFFSF-IQEIAMDLGTANTIIISD-DK-IVVDE-
F9D0U9_PREDD          -------------------------MGFFSF-IQEIAMDLGTANTIIISD-DK-IVVDE-
E6SSP3_BACT6          -------------------------MGLFSF-TQEIAMDLGTANTIITTN-GK-IVVDE-
A6LD55_PARD8          -------------------------MGLFSF-TQEVAIDLGTANTIITCN-DK-MVVDE-
H8KXT1_SOLCM          -------------------------MGLFNFFTQEIAIDLGTANTLIIHN-DK-VVVDE-
Q26G04_FLABB          -------------------------MGFFDFLTEDIAIDLGTANTLIVHN-GK-VVVDS-
E3H9T1_ILYPC          -----------------MKKIKLKIKWPGMKIQKSIGIDLGTANTLVYHKQKEEIVLNE-
D1AWM7_STRM9          --------------------MIFNKIINFFRIKKQISIDLGTSNVLFYDKQAKKIVLNE-
D4LEE4_RUMC1          -------------------------------MNVDIGIDLGTANIVMTMG-KRGVVLNE-
Q65K55_BACLD          -----------------------------MFQTTEIGIDLGTANILVYSK-NKGIILNE-
G2TLR6_BACCO          -----------------------------MFSGNEIGIDLGTANVLVYSK-KEGVILDE-
A4IKA1_GEOTN          -----------------------------MFASSELGIDLGTMNVRLFSQ-TKGLLFDE-
H2J3E5_MARPK          ------------------------------MAKHDLGIDLGTATFIVYKK-NEGVIINE-
H9UD07_FERPD          ------------------------------MAKNDLGIDLGTANFIVYQQ-GKGIVLNE-
C5CED5_KOSOT          ------------------------------MRKGDLGIDLGTSSLLVYQK-DKGIVIDE-
G9PYA6_9BACT          -----------------------MFSFRPNLFNHEIGIDIGTVNTVIYVK-SKGVVINE-
F7V628_CLOSS          -------------------------------MANMFGVDLGTMNLKVYNR-HNKSITKT-
C4ZA48_AGARV          ------------------------------MSNNVYGIDLGTNNFKVYSK-ATGKTMLE-
E0RWC5_BUTPB          -------------------------------MGNIFGIDLGTSNIKIYNR-DEDSLTVE-
B0S3Y5_FINM2          -------------------------MKLFKFQQEGLGIDLGTSNSIISDE-NGKIIINE-
V5RK33_SPIAP          -------------------------MAIGNKKPTFVSMDLGTANTLVYIA-GQGIVYNE-
V5RHX5_SPIAP          ---------------------------MAGKKPIFVSMDLGTASTLVYIS-GQGIVYNE-
F0RUT9_SPHGB          ------------------------MSAVIANDRLGLGIDLGTANLLVFLE-KKGIIFDE-
E8N4P5_ANATU          ----------------------------MALFTRELGIDLGTTNTIIVEG--NQILINE-
A8ZNP8_ACAM1          --------------------------------------------MIYSPI--EGVVLNE-
O27103_METTH          --------------MFSFGKKSEEKPEKKSAITNTLGIDLGTLNTVVAKPAGDKFDIYKI
F0T6K9_METLA          --------------MFDFLKKNDEVDVKKKALTDTLGIDLGTLNTVVAKPSGDKFDLYKI
D3DZK8_METRM          --------------MSIFGNEDAIEIEPTRVVKNSLGIDLGTLNTVIAKPSGDKFDLYQI
F6EJS9_HOYSD          --------------------------------MDGLGIDLGTANTVVGSPSDG--IILNE
C5AJR5_BURGB          ----------------------MSTPMLGRLFSNDVAIDPGTASTLIYTS-ERGVVLNQ-
A5VGL2_SPHWW          ------------------------MTTFLPQRRPEIAIDFGTANIRVLRR-GDGLVFDE-
F2R0Z7_STRVP          -----------------------MTVSLDQLRRCHVAVDLGAARTRVFVK-GAGLVVDE-
B5GQK5_STRCL          ------------MPSGTAPGRTAVTVSLDQLRRCHIAVDLGAARTRVYVK-GVGLVVDE-
C9ZCF8_STRSW          --------------------MTAMTASLEQLRRCHFGVDLGAARTRVYVK-GAGLVVDQ-
B5G8B1_STRSH          -----------------------MTVSLEQLRRCHIAVDLGAARTRVFVK-GQGIVVDE-
M3CC37_STRMB          -----------------------MTLSLAQLSRCTIAVDLGASRTRVYAR-DTGLIVDE-
T0BS21_ALIAG          ---------------------------------MSMVIDFGTSRLRISTA-PGADIVSE-
                                                                                  

MREB_BACSU            PSVVALQTDTK-----SIVAVGNDAKNMIGRTPGN-VVALRPMKDGVIADYETTATMMKY
Q38XC7_LACSS          PSVVAKNTQTG-----EVIAVGSEARDMIGRTPGN-IVAIRPMKDGVIADYDTTAAMLKY
B0KAD9_THEP3          PSVVAMRTDSK-----AILAVGEEAKKMVGRTPGN-IIAIRPMRDGVIADFDITKAMLDH
K4LRY7_THEPS          PSVVAIRRDTG-----EILAVGEEAKQMIGRTPGN-IVAIRPMKDGVIADFDVTQSMLRY
A0A222TBA9_9ACTN      PSVVAINTNTG-----GILAVGAEAKKMIGRTPGN-IVAVRPLKDGVIADFEITERMLRY
MREB_ECOLI            PSVVAIRQDRA-GSPKSVAAVGHDAKQMLGRTPGN-IAAIRPMKDGVIADFFVTEKMLQH
J7U1C3_MORMO          PSVVAIRQDRP-GSTKSVAAVGHEAKRMLGRTPGN-IAAIRPMKDGVIADFFVTEKMLQH
G4QFF8_GLANF          PSVVAIRQERA-GGPKSVAAVGHEAKQMLGRTPGN-IKAIRPMKDGVIADFYVTEKMLQH
E1SN04_FERBD          PSVVAIRQERA-SGPKSVAAVGHEAKQMLGRTPGN-ITAIRPMKDGVIADFYVTEKMLQH
A0A0Q2RJE1_VIBFU      PSVVAIRQDKG-RGGKTVAAVGHAAKQMLGRTPGN-ISAIRPMKDGVIADFYVTEKMLQH
D4G7J1_RIEPU          PSVVAIRQDRS-GSYKSVAAVGRSAKQMLGRTPGN-IVTIRPMKDGVIADFYITEKMLQY
MREB_PASMU            PSVVAIRQERS-GALKSIAAVGRDAKLMLGRTPKS-IAAIRPMKDGVIADFFVTEKMLQY
F6AF11_PSEF1          PSVVAIRTH---GNQKSVVAVGTDAKRMLGRTPGN-IAAIRPMKDGVIADFSVCEKMLQY
Q7CLP3_XANCP          PSVVAVRQDRAIGGTRSVAAVGAEAKQMLGRTPGH-ITTIRPMKDGVIADFTYTEAMLKH
Q8Y3C1_RALSO          PSVVAIRQEGGPNAKKTIQAVGKEAKQMLGKVPGN-IEAIRPMKDGVIADFTVTEQMLKQ
Q2KU74_BORA1          PSVVAIRHEGGPNGKKVIQAVGQEAKQMLGRVPGN-IEAIRPMKDGVIADFTVTEQMLKQ
A1W2L8_ACISJ          PSVVAIRHEGGPHGKKVIQAVGHEAKAMLGKVPGN-IEAIRPMKDGVIADFVITEQMIKQ
Q7NPY5_CHRVO          PSVVAI-HNDAPTNKKSILAVGLEAKRMLGRTPGS-IQAIRPMKDGVIADFTVTEQMLKQ
MREB_CAUVN            PSVVALRNVGG---RKVVHAVGIEAKQMLGRTPGH-MEAIRPMRDGVIADFEVAEEMIKY
B8DRC1_DESVM          PSVVAVKKDTR--GNNVVLAVGHDAKRMLGRTPGN-IQAIRPMKDGVIADFEITEAMLRH
F0JDA7_DESDE          PSVVAVKKDSR--GGKTVLAVGGEAKKMLGRTPGN-IVAIRPMKDGVIADFEVTEAMLRH
C0Q988_DESAH          PSVVAVRTDKR--AKNRVLAVGAEAKRMLGRTPGN-IQAIRPMRDGVIADFEVTEAMLKH
Q9Z756_CHLPN          PSVVAVDAQTH-AVL----AVGHKAKAMLGKTPRK-IMAVRPMKDGVIADFEIAEGMLKA
F8KYQ5_PARAV          PSVVAVDSSTN-EVL----AVGHKAKDMLGRTPRR-IHAVRPMKDGVIADFEIAEGMLKA
Q1PZZ1_KUEST          PSVVAVKPGTN-KVLLNGRAVGIVAKSMLEKAPSS-ISVIRPLKNGVIADFDITEAMLKY
B2A3F3_NATTJ          PSVVAVNNDLG-----KVLAVGEEAYNMIGRTPGN-IVAIRPMKDGVIADFSVTEIMLKN
B1MWY9_LEUCK          PSVVAVDDKTD-----RVLAVGSEAYRMVGRTPGN-IRAVRPLKDGVISDFDVTEAMLTY
B8IZZ9_DESDA          PSVVALDANTG-----KILAVGAAAKEYIGRTPRS-IRAVRPMKDGVIADFDVTRAMISY
Q1MP88_LAWIP          PSTVAIDTLSG-----KVLAVGKEAHAYIGKVPHN-IEVIRPLKDGCIADFDMAQTLIAN
R5FDM5_9BACT          PSVVALDRRTD-----KMIAVGAKAKMMYEKTHDN-IRTIRPLHDGVIADFSACEQMMRG
F9D0U9_PREDD          PSVVALDRRTD-----KMIAVGEKAKMMYEKTHDN-IRTIRPLRDGVIADFTACEQMMRG
E6SSP3_BACT6          PSVVALDRRTD-----KMIAVGEKAKLMHEKTHEN-IRTIRPLRDGVIADFYACEQMIRG
A6LD55_PARD8          PSVIALDARSD-----KVLAVGKVAREMYEKTHPN-IRTVRPLREGVIADFYAAEQMIRG
H8KXT1_SOLCM          PSIVALDRKSG-----KMIAIGRQAMQMDGKTHEN-IKTVRPLKDGVIADFDAAEHMIRG
Q26G04_FLABB          PSIVARDRSTG-----KIIAVGKEAAMMQGKTHEN-IKTIRPLKDGVIADFDASEKMISM
E3H9T1_ILYPC          PSVVAVDKETK-----KVLAVGQEAKDMLGKTPDH-IIAVRPLSEGVIADYDITEAMIKY
D1AWM7_STRM9          PSVIVKDKKTD-----RVVAVGREAREMLGKNPKS-IEVIKPLKDGVISDIDLTRKMLSE
D4LEE4_RUMC1          PSVIAFHKRTE-----RVVAIGRKAYSMIGRAPDY-LAVVRPLKDGVISDDELTQCMIRE
Q65K55_BACLD          PSVVAVDTETK-----SVLAVGTEAKNMIGKTPGK-IVAVRPMKDGVIADYDMTTDLLKQ
G2TLR6_BACCO          PSVVAIDHSTR-----QVLAFGQEAKAMIGKTPEK-ITVIRPLKGGVIADFDMTTEMLKQ
A4IKA1_GEOTN          PAAIAYNRQAD-----KLMAIGQKAKQMIGKAPAH-VEVTYPLRNGVIADFDQAKALLQQ
H2J3E5_MARPK          PSVVAVDKLTNT-----ITGFGSEVKAMVGKTPYG-IEIIRPMQDGVIAYPSLIEQLLRY
H9UD07_FERPD          PSVVAIERKTGK-----ILAIGTEAKEMFGKTPEDKILAVKPMRDGVIADYTIIAEVLKY
C5CED5_KOSOT          PSVIAVDRKTKK-----IIAIGLQAKEMIGKTPKD-IMAVRPVRDGVIADYHIIEQALKE
G9PYA6_9BACT          PSVIAVRNLGRKGQK-EIIAFGAAAKKMVGRTPQG-ITTVRPLSHGVIADFEMTQHMIRH
F7V628_CLOSS          KNTISL-INKKQ-----IYAFGDEAYQMYEKAPEN-IEVTFPIVNGVIADFNNMQNMILA
C4ZA48_AGARV          KNTIAV-IDKNQ-----IYAYGDSAYAMYEKAPET-INVIFPVVEGVIADYNLLQTMIFD
E0RWC5_BUTPB          KNMIAI-ENKTN-----VFAYGNSAYEMYEKAPDK-IKISYPLNSGVIADIEHMETLVRL
B0S3Y5_FINM2          PSVVAIDINNYD-----IVAVGTEAKSMIGKTPDN-IVAISPIENGVIADFESTVSMLSY
V5RK33_SPIAP          PSIVAYRIKENK-----IIAVGEEAYKMIGKGNKT-IRVVRPMVDGVITDIRATEAQLRY
V5RHX5_SPIAP          PSIVAYKIKENK-----IVAVGDEAYKLIGKGNKN-LRIVRPMVDGVITDIRATQAQLKY
F0RUT9_SPHGB          PSVIAFDRESGK-----IVAAGEDAHKMLGKVHSK-ISVVKPLRNGVISDMRAAKALLSY
E8N4P5_ANATU          PTVVAVVVAEQ-----KMVESGRAARDMYGRVSDA-IEVVWPLQHGVIAEYEKTENFLKF
A8ZNP8_ACAM1          ASIIAINQLTQ-----TPVSVGNTARQLLGRTSTP-VAVLRPVRNGVIADLKLTQIMLQS
O27103_METTH          PSVVAVKKDDP----SYVLAVGEEAKMMLGRTPED-IIAVRPLRKGVIESVAQAEALLVY
F0T6K9_METLA          PSVVAVKKEDP----AYVLAVGEEAKSMLGRTPED-IIAVRPLRKGVIESIAQAEALLVY
D3DZK8_METRM          PSVVAVKRDDP----TAVLAVGEEAKKMLGRTPED-IIAVRPLKKGVIENIAQAQALLIR
F6EJS9_HOYSD          PSVMLVKSKDP----YRAMLVGAEARELVGRTPAG-LSTVRPMRDGVIVDLDSARAFLKA
C5AJR5_BURGB          PSVVCFRKSAAHVEKARVEAVGELAKALLGRVPEH-LEAVRPLRHGVIAHYPAAEQMIRQ
A5VGL2_SPHWW          PSLCCVAGKHN---MTSLFAAGREAYAMIDRTPAA-LRIARPLCRGVLQDIDAAKRVLRY
F2R0Z7_STRVP          PSVAAVNTRTGA-----LIAVGALAEKMTGRTPDY-IRVVRPVSGGTVVDIEMAQRMLRH
B5GQK5_STRCL          PSVAAVNIRSGA-----LIAVGALAEKMTGRTPEY-IRVVRPISGGTVVDIEMAQRMIRH
C9ZCF8_STRSW          PSVAAVNIRTGA-----LIAVGEFAERMMGRTPDY-IRVVRPVSGGTVVDIEMAQRMLRQ
B5G8B1_STRSH          PSVAAVNTRTGG-----LIAVGAFAQQMTGRTPEY-IRVVRPVSGGTVVDVDMAQRMLRH
M3CC37_STRMB          PSIAAVNTRTGS-----LIAVGALAEGMAGRTPAH-IRVVRPVSGGTVVDIDMAQRMLRH
T0BS21_ALIAG          ASVLAR--REDD-----TIVVGDEALKMVGRTPPS-VEIVWPVVGGAIKDSQAAVLLLQK
                                           *  .     :     :    *:  * :         :  

MREB_BACSU            YINQAIK-NKGMFARKPYVMVCVPSGITAVEERAVIDATRQAGARD--AYPIEEPFAAAI
Q38XC7_LACSS          FIEKTIG-HS---SSKPFVMVCVPSGVTEVEKRAVIDATKVAGARD--AYVIEEPFAAAI
B0KAD9_THEP3          FISKVNP-RKG--LFRPRVIVGIPSGVTEVEKRAVIEAALQAGAKE--AHTVEEPMAAAI
K4LRY7_THEPS          FIRRALQ-KNNL-LVRPRVVISVPSGVTAVEERAVREASLQAGAKE--AYLIEEPMAAAI
A0A222TBA9_9ACTN      FILKIHK-RRY--LARPRVVVCVPSGITGVERRAVIEASTQAGARQ--VHIIEEPMAAAI
MREB_ECOLI            FIKQVHS-NSFM-RPSPRVLVCVPVGATQVERRAIRESAQGAGARE--VFLIEEPMAAAI
J7U1C3_MORMO          FIKQVHS-NSFM-RPSPRVLVCVPVGATQVERRAIRESALSAGARE--VYLIEEPVSAAI
G4QFF8_GLANF          FIKQVHD-NNFL-RPSPRVLVCVPCGSTQVERRAIRESALGAGARE--VYLIDEPMAAAI
E1SN04_FERBD          FIKQVHN-NGVF-RPSPRVLVCVPCGSTQVERRAIRESAMGAGARE--VYLIDEPMAAAI
A0A0Q2RJE1_VIBFU      FIRSVHD-NSIL-KPSPRVLVCVPCGSTQVERRAIRESALGAGARE--VYLIDEPMAAAI
D4G7J1_RIEPU          FIDQVHS-NSFI-RPSPRVLICVPFGATQVERRAIRESALSAGARE--VFLIEEPISAAI
MREB_PASMU            FIKQVHS-SNFM-RPSPRVLVCVPAGATQVERRAIKESAIGAGARE--VYLIEEPMAAAI
F6AF11_PSEF1          FINKVHE-NSFL-QPSPRVLICVPCKSTQVERRAIRESALGAGARE--VFLIEEPMAAAI
Q7CLP3_XANCP          FIKKVHK-SRFL-RPSPRVLVCVPAGSTQVERRAIKESAEEAGARD--VYLIEEPMAAAI
Q8Y3C1_RALSO          FIKMVHD-SKLL-RPSPRIIICVPCGSTQVERRAIRESALGAGASQ--VYLIEEPMAAAI
Q2KU74_BORA1          FIRMVHP-RNML-APSPRIIVCVPCGSTQVERRAIRESALGAGASH--VYLIEEPMAAAI
A1W2L8_ACISJ          FIKMVHP-RSVL-TPSPRIIICVPCGSTQVERRAIKDAAEAAGATA--VYLIEEPMAAGI
Q7NPY5_CHRVO          FIKKVNP-NRFF-AASPRIVICVPCGSTQVERKAIRDSALAAGARR--VELIEEPMAAAI
MREB_CAUVN            FIRKVHN-RKGF-V-NPKVIVCVPSGATAVERRAINDSCLNAGARR--VGLIDEPMAAAI
B8DRC1_DESVM          FISKVHN-SRR--LVRPRIMICVPTGITQVEKRAVKESAQSAGARE--VYLIEEPMAAAI
F0JDA7_DESDE          FISKVHN-SRR--LVRPRIMICVPTGITQVEKRAVKESAQSAGARE--VYLIEEPMAAAI
C0Q988_DESAH          FIRKVHN-NRRT-LVRPRIVIAVPSGITQVEKRAVRESAELAGARE--VFLIEEPMAAAI
Q9Z756_CHLPN          LIKRVTP-SRS--VFRPRILIAVPSGITGVEKRAVEDSALHAGAQE--VILIEEPMAAAI
F8KYQ5_PARAV          LIKRVTP-SRS--LFRPKILIAVPSGITGVEKRAVEDAALHAGAQE--VILIEEPMAAAI
Q1PZZ1_KUEST          FITKVHK-RKW--GVRPRILIAIPSGITAVEKRAVVNSAERAGARE--VYLVSEPKAAAI
B2A3F3_NATTJ          FIERACK-RKMF--LKPRIMVCVPAGITSVEQRAVLEAATRAGAKQ--TFLIEEPRAAAL
B1MWY9_LEUCK          FVDKLNV-KGFM--SKPNIMICAPTNITEIERKAIIQAAEKAGGAK--VYLEYEPKVAAV
B8IZZ9_DESDA          FVQKAIS---GLRLVRPSMAICIPTGITQVEKRAVIDSAMLAGAVD--IFMIEEPMAAAI
Q1MP88_LAWIP          LLQKIIG---KWLVRKPHMIICVPINITGVERRAVIDTAKRAGAHE--VRLIEEPIAAAI
R5FDM5_9BACT          LIKMVHT-GSRLFSPSLRMVIGVPSGSTEVELRAVRDSAEHADGRD--VYLIFEPMAAAI
F9D0U9_PREDD          LIKMVHT-GSRLFSPSLRMVIGVPSGSTEVELRAVRDSAEHADGRD--VYLIFEPMAAAI
E6SSP3_BACT6          LIKMVNN-RNRLFSPSLRMVIGVPSGSTEVELRAVRDSAEHAGGRD--VYLIFEPMAAAI
A6LD55_PARD8          FIKMASG-RKRWFAPSLRMVIGIPSGSTEVEIRAVRDSAEHAGGRD--VYMVFEPMAAAI
H8KXT1_SOLCM          FIKMINGGKGWLF-PSLRMVICIPSGITEVEKRAVRDSAEIAGAKE--VYLIHEPMAAAI
Q26G04_FLABB          FIKEIPALKKKLFTPSLRMVICIPSGITEVEMRAVKDSAERVNGKE--VYLIHEPMAAAI
E3H9T1_ILYPC          FIKKVFG---KYNFVLPEVMICVPIEVTGVEKRAVLEAAISAGAKR--AYLIEEARAAAL
D1AWM7_STRM9          FMRQVYG---ISPFK-PEVIICVPIEVTKVERRALFDAL--DDVKR--IFLIEEGRAAIM
D4LEE4_RUMC1          FILKVSG---RQLLK-PRIIICVPSFITDVERRAVMEAARSAGSRK--VNLIQEPLAAML
Q65K55_BACLD          IMKKAGK-NIGFTFRKPSVVVCTPSGSTAVERRAISDAVKNCGAKQ--VHLIEEPVAAAI
G2TLR6_BACCO          IMKKINQ-QSGISIRKPNVVVCVPSGATSVERRAIEDVVKNSGAKT--VHLIEEPVAAAI
A4IKA1_GEOTN          VFKQSSR-QLGLSFKKPSIVMSVPFHATSVERRSFYEIAKHCGAKH--IHFIEEPVAAAI
H2J3E5_MARPK          FIKQAK---TGFFPSKPNLVIGIPARTTDVERRAVKDAAEKVGANK--AYLVLEPIIAAI
H9UD07_FERPD          FMKKLN---KGLF-FKCNMVIGIPTKTTSVEQRAVYDAALKAGAKR--VHIVLEPTAAAI
C5CED5_KOSOT          LLGRTK---PRFSFYRPSVIVGVPAKVTSVERRAVIEAATSAGAGR--VYLVLEPVAAAI
G9PYA6_9BACT          YMSQATA--SGGMFSHPRVAVCVPASVTEVEKRAVVEVTLAAGAKE--AFVVEEPLAAAV
F7V628_CLOSS          YLETISK-G-RVKGSD--FIVAVPTDITEVEKKAFFDLFYRSKAKPKNVLLCEKPIADAV
C4ZA48_AGARV          FLEHKTK-A-RIKNAE--FIIAVPTDITDVEKRAFYELFYKSKSKPKKVMLCEKPIADAV
E0RWC5_BUTPB          FLTDQMK-G-SVKPCE--VYIAVPKDVTEVERRAFHDLINDAGIKAKKIMMVKKPLADGL
B0S3Y5_FINM2          FIKKARP-NFSVFQPE--VCVSVSASLTDVERRSVEDLALNAGARS--VKLVEENIASLK
V5RK33_SPIAP          IFTKLR---ITKQLKHSIMLLACPSVITELEKTALKKIAVNLGADQ--VFVEEEVKMAAL
V5RHX5_SPIAP          IFSRLR---LDKILKGSVMLLACPSVITDLEKSALIKIATSFGAQT--VFVEEEVKMAAL
F0RUT9_SPHGB          VLGKVEN-LTEKDISKTTCVICCPSEVTKIERDVMTDLATKMNITD--VFIEEEIKSGAL
E8N4P5_ANATU          LVRKVSG---PMQLFPPRIMLTVPYGVTSVESRAVHEAGLGAG-RE--VFLIPQPIAAAL
A8ZNP8_ACAM1          FIRKAQQ---GTRIFRPRLVLGCSCGATSVEREALTEAALEAGARD--VVLIDEPIAAAL
O27103_METTH          AMEMGAG--D-SDSID-RIVIGIPGDASEVERNAVEEIGRKAGANY--VLVISEGLAAAI
F0T6K9_METLA          AIDKGSG--EKNASID-RIVVGIPGDASEVEKRAVEEIGIKAGANY--VLVISEGLSAAI
D3DZK8_METRM          AMEIGIN--E-GETVE-RIVIGIPGDSSEVEKNAAEEIGRKAGAEY--VLVISEGLAAAI
F6EJS9_HOYSD          IIRKVVP--PWQLALRPKGVIAVPAGATPLERRALLEVGQEAGLRK--VALVPEPVAGAL
C5AJR5_BURGB          FVDMSHA--RSLFGRRIAFTMCVPSSATAVERRALREAAVAAGASR--VSLIGQSLAAAL
A5VGL2_SPHWW          ALSKARG---RSRWRTPAAIIGVPADATQAERGAMLTAAADAGLGP--ITLLTEPLAAAI
F2R0Z7_STRVP          LLGEKLR-RQLRRKPRLRAAACTPHDSDPLAQRAAVETLVGLGARR--VELVDTLIAAAV
B5GQK5_STRCL          LLGEKLR-RQLRRKPRLRAAACTPHLSDPLAQRASVETLVGLGARR--VELVDTLIAAAV
C9ZCF8_STRSW          LLGDRVR-RTLRRKPVLRAAACTPHGADPLAQRATIETLVGLGARR--VELVDTLIAAAV
B5G8B1_STRSH          LLGDKLR-RALRRKPRLRAAACTPHESDPLARRATVETLVGLGARR--VELVDTLIAGAV
M3CC37_STRMB          LISDKLR-RAWRRRPLLRAAVCLPHDAEPIAQRAAIETLTGLGARR--VELVDTLVAAAV
T0BS21_ALIAG          LVAKRFT-RGLGLR--MPITMALPAGLTSVERRGLEEVARAAGAKQ--VQFVDALVAAAL
                       .                     .                                    

MREB_BACSU            GANLPVWEPTGSMVVDIGGGTTEVAIISLGGIVTSQSIRVAGDEMDDAIINYIRKTYNLM
Q38XC7_LACSS          GAGLPVMDPTGSMVVDIGGGTTDVATISLGGIVSSRSIRMAGDKFDDAIISYIRQNSNLL
B0KAD9_THEP3          GAGLPVEEPTGSMVVDIGGGTTDVAVISLGGIVTSKSLRVGGDEMDEAIINYIKREYNLM
K4LRY7_THEPS          GAGLPVYEPTGNMIVDIGGGTTEVAVISLGGIVTSKSIRIAGDEMDEAIVQHIKRVYNLM
A0A222TBA9_9ACTN      GSGLPVHEATGNMVVDIGGGTTEVAVISLGGIVTAQSIRVAGDELDNAIIQHIKKEYSLL
MREB_ECOLI            GAGLPVSEATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSL
J7U1C3_MORMO          GAGLPVSEATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSL
G4QFF8_GLANF          GAGLPVSEATGSMVVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDEAIINYIRRNFGSL
E1SN04_FERBD          GAGLPVSEATGSMVVDIGGGTTEVAIISLNGVVYSSSVRVGGDKFDEAIINYVRRNYGSL
A0A0Q2RJE1_VIBFU      GAGLRVSEPTGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSL
D4G7J1_RIEPU          GAGLPVSEATGSMVIDIGGGTTEVAVISLNGVVYSSSVRIGGDKLDEAIINYVRRNYGSL
MREB_PASMU            GAKLPVSTATGSMVIDIGGGTTEVAVISLNGIVYSSSVRIGGDRFDEAIISYVRKTFGSI
F6AF11_PSEF1          GAGLPVEEARGSMVVDIGGGTTEIALISLNGVVYAESVRVGGDRFDEAIITYVRRNYGSL
Q7CLP3_XANCP          GAGMPVTEARGSMVIDIGGGTTEVAVISLNGIVYSQSVRVGGDRFDESITNYVRRNHGML
Q8Y3C1_RALSO          GAGLPVSEPSGSMVVDIGGGTTEVGIISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGML
Q2KU74_BORA1          GAGLAVSDASGSMVVDIGGGTTEVAVISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGML
A1W2L8_ACISJ          GAGLPVSEASGSMVVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDESIINYIRRNYGML
Q7NPY5_CHRVO          GAGLPVEEPTGSMVVDIGGGTTEVGVISLGGVVYSNSVRVGGDKFDEAIINYIRRNYGML
MREB_CAUVN            GAGLPIHEPTGSMVVDIGGGTTEVAVLSLSGIVYSRSVRVGGDKMDEAIISYMRRHHNLL
B8DRC1_DESVM          GANLPIQEPTSNMVVDIGGGTTEVAVISLSGIVYSRSVRVGGDKMDEAIMTHVKRKYNML
F0JDA7_DESDE          GANLPITEPTSNMIVDIGGGTTEIAVISLSGIVYARSVRIGGDKMDEAIMQHVKRKYNML
C0Q988_DESAH          GAGLPITEPTCNMVVDIGGGTTEVAVISLSGIVYSRSIRVAGDKMDASISQHIKRKYNLL
Q9Z756_CHLPN          GVDLPVHEPAASMIIDIGGGTTEIAIISLGGIVESRSLRIAGDEFDECIINYMRRTYNLM
F8KYQ5_PARAV          GVDLPVHQPAASMIIDIGGGTTEIAIISLGGIVESRSLRIAGDEFDECIINYMRRTYNLM
Q1PZZ1_KUEST          GVGLPVGEPEASMVVDIGGGTTEVAVLCLGDIFTHESLRIAGDELDEAIVQYVRKTYNLD
B2A3F3_NATTJ          GANLDIFEPSGSMVVDIGGGTTDVAVLSLGDLVTSTSLRIGGDKFDEAIVQYMKNNHNLV
B1MWY9_LEUCK          GAGLDIFKPIGSMVIDMGGGTSDIAVLSLGDIVVSESIRIAGDKMNFDIVGYLKRRHNLI
B8IZZ9_DESDA          GADLPIHEPLGNLVLDIGGGTSEVAVITLSGVANSQSVRVAGDTMNLAVQRFMRDAFRME
Q1MP88_LAWIP          GASLPVLEPIGSMIVDIGGGTTDIAVISMGEKACAQSVRVAGDALNKAVQRYLQEHMQIF
R5FDM5_9BACT          GIGIDVEAPEGNMIVDIGGGSTEIAVISLGGIVSNNSIRTAGDDLTADIQEYMSRQHNVK
F9D0U9_PREDD          GIGIDVEAPEGNMIVDIGGGSTEIAVISLGGIVSNNSIRIAGDDLTADIQEYMSRQHNVK
E6SSP3_BACT6          GIGIDVEAPEGNMIVDIGGGSTEIAVISLGGIVSNNSIRIAGDDLTADIQEYMSRQHNVK
A6LD55_PARD8          GVGIDVLAPEGNMIVDIGGGTTEIAVISLGGIVSNKSIRMAGDDLTADIVEYMRRQHNVK
H8KXT1_SOLCM          GIGIDVEEPMGNMIIDIGGGTTEIAVIALGGIVCDQSIRVAGDNFDADIVNYMRRQHNIL
Q26G04_FLABB          GIGVDIMQPKGNMIVDIGGGTTEIAVIALGGIVCDKSVKIAGDVFTNDIVYYMRTQHNLY
E3H9T1_ILYPC          GSGIDISAPEGNMIVDIGGGSTDIAVISLGGTVVSKSIRTAGNNFDEDIIKYIKKTHNLL
D1AWM7_STRM9          GAGINISNPNGHMVIDIGGGSTDVAILSLDEIIVSKSIKIAGNKFDEDIVKYVKEKLFLN
D4LEE4_RUMC1          GAGVSIGQANGHMVVDIGGGTTDIAVVSMNGIVASHSIKVAGNKLDEAIIRYVSNKYKLM
Q65K55_BACLD          GADLPVDEPVANVVVDIGGGTTEVAIISFGGVVSCHSIRIGGDQLDEDIVSFVRKKYNLL
G2TLR6_BACCO          GADLPVDEPIANVIVDIGGGTTEVAIISFGGVVTYNTIRIGGDKMDDDIMQHVRKTYNLL
A4IKA1_GEOTN          GADLPVGEPVANVIVHLGAGKTEAAIISFGGVVACQSLRIGGNQLDEDIMQYVRQRYNLL
H2J3E5_MARPK          GIGLDITKPNGHLIVDIGGGTTDIAVISLSGSVVSESIKFAGEIMDQEIIKYVKRKYKFL
H9UD07_FERPD          GIGLDVMKPMGNMIVDIGGGTTDIAVISMGGIVVGDSIKLAGNALDDAIIKGVRRNFGLL
C5CED5_KOSOT          GAGLDIFDSTGNLVVDIGGGTSDIAVISLGGIVVSRSLRVAGDAMNEAIIKYVKRKYKFH
G9PYA6_9BACT          GIGLAIDEAQGNMVVNMGGGTCEVAVLSLGGIVINQSVRVAGDALDEAIISMLRQNYTLA
F7V628_CLOSS          GLGLDSTEPTGIMIVDIGSATTEISVVSLGGMVLSELLHYGGNRLDESISSYIRRNDNLV
C4ZA48_AGARV          GLGIDVNEPTGVMIVDMGADTTETSVISLGGLVLSDLLHFGGNRLDESIISFVRKEFNLV
E0RWC5_BUTPB          GMNVDVMNSQGVLVVNVGYDTTEISILSLRGIVVSKLIKVGGKKFDESIRNVIRKEFGLL
B0S3Y5_FINM2          GLGVDVDEPTGHIILNIGAGTIEASVISLGGIVTSYCIKSGGEDIDQEIKQILKKKFGVN
V5RK33_SPIAP          GGGVNIYAPTGNLIVDMGGGTTDIAVLASGDIVLSKSVKVAGNYLNDECQKFIRSQYGLE
V5RHX5_SPIAP          GGGINIEAPMGQLVVDMGGGTTDVAVIASGDIVISKSIKVAGNVLNEEILKFIRSQYGME
F0RUT9_SPHGB          GAGVDIFKSKGVMVVDIGGGTTDVGVISFGDIVLSRTIRKAGSFMDDEISKFVKKTQSVE
E8N4P5_ANATU          GVDLPIGTPSGNMVLSIGGGTVQAAVLAMYDIVRAETLRTGGIRMDEAIISYVRKKYGVI
A8ZNP8_ACAM1          GIGLPITKPKGNLIIDIGGGTTEMAVICSSQVIDSQVISIAGDSFNQATVDYLRQTFQVH
O27103_METTH          GAGLPIAEASGTMVIDIGAGSSDIVVISLGGITDIQTIRVGGDDIDSNIVELVKEKFNVE
F0T6K9_METLA          GAGLPIAEAAGTMVIDIGAGSSDIVVISLGGITDIETIRDGGDDIDKNIVEKVKELYNVE
D3DZK8_METRM          GAGLPIAEPMGTMVLDIGAGSTDIVVISLGGINDIETVRCGGDDIDNRIVELIEEKYNVA
F6EJS9_HOYSD          GAGINPLEPRVHLVVDIGGGTAEMTAFCYGGILAHQSCKLAGDELTSALYHYLRAEHGVV
C5AJR5_BURGB          GAGLPVTEAVGSMVVDIGGGTTEVGVVSLGGVVYQQSVRVGGDQFDAAIVNHVRGLYNVL
A5VGL2_SPHWW          GAGLAVDEPAGSMIVECGAGTTEVAVFSLGGICGTGSVRIGGDTLNRALADQVHLQHKFL
F2R0Z7_STRVP          GCGLPVEQPTATMILVCGAATTQVAVLSLGSIVTAERMPVGGDAIDHAVIQHLRHHHELM
B5GQK5_STRCL          GCGLPVEQPTATMIVVSGAATTQLAVLSLGSIVTAERIPVGGNAIDNAVIQHLRTQHELL
C9ZCF8_STRSW          GCGLPVEQPEATMIMVCGAGATELAVLSLGSVVSAVRIPVGGEAIDHAIVQHLRLRHELT
B5G8B1_STRSH          GCGLPVERPEATMIMACGAATTQIAVLSLGAIVTAQRLPVGGDAIDHAIVAHLRHRHELL
M3CC37_STRMB          GCGLPVELPEATMIIVCGAASTQVAVLSLGSIVAAEKVQVGGDAIDYAIVQHLRGEHQLM
T0BS21_ALIAG          GAGLAVDAPQGALVVDLGAGSTQVGLLSMRGVVSSQRLPQGMMAIDYEVVEAIRRDQGFA
                      *  :    .   :::  *    :   .             .   :       :       

MREB_BACSU            IGDRTAEAIKMEIGSA--EA-PEESDNMEIRGRDLLTGLPKTIEITGKEISNALRDTVST
Q38XC7_LACSS          IGERTAEQIKLAIASASPER-AKEVESMSVRGRDLVTGLPKTVDIKASDIAEAIKEIVTA
B0KAD9_THEP3          IGERTAEEIKIQIGSAFPKP-KEE--TMDIRGRDLVSGLPKTLKITSTEILEALKDPISS
K4LRY7_THEPS          IGERTAEDIKIKIGSALLDG-KKE--TYEVRGRDLVTGLPKTVEITAEEVQAALAETVAS
A0A222TBA9_9ACTN      LGERTAENIKITIGSAAESD-EEE--HTEIRGRDLVSGLPKTVVISAAEVRKAMEEPVNS
MREB_ECOLI            IGEATAERIKHEIGSAYP---GDEVREIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTG
J7U1C3_MORMO          IGEATAERIKHEIGSAYP---TDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTG
G4QFF8_GLANF          IGEATAERIKHEIGTAYP---GEEVKEIEVRGRNLAEGVPRGFILNSNEILEALQEPLSG
E1SN04_FERBD          IGEATAERIKHEIGSAYP---GDEVRELEVRGRNLAEGVPRSFTLNSNEILEALQEPLSG
A0A0Q2RJE1_VIBFU      IGEATAEKIKHEIGSAYP---GDEVQEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLTG
D4G7J1_RIEPU          IGEATAERIKHSIGSAYQ---SEPSQEIEVRGRNLAEGVPRSFLLTSHEILEAFQEPLSG
MREB_PASMU            IGEPTAERIKQEIGSAFIQE-GDEVREIEVHGHNLAEGAPRSFKLTSRDVLEAIQAPLNG
F6AF11_PSEF1          IGESTAERIKQEIGTAYP---GGEIREVDVRGRNLAEGVPRSFTLNSNEVLEALQESLAT
Q7CLP3_XANCP          IGEATAERIKLQIGCAYP---QDEVQEMEISGRNLAEGVPKMIKINSNEVLEALHEPLSG
Q8Y3C1_RALSO          IGEQTAEAIKKEIGSAFP---GSEVREMEVKGRNLSEGIPRAFTVSSNEILEALTDPLNQ
Q2KU74_BORA1          IGEPTAELIKKQIGSAFP---GSEVREIEVKGRNLAEGVPRSFTVSSNEILESLTDPLNQ
A1W2L8_ACISJ          IGEPTAEAIKKNIGSAFP---GSEVKEMGVKGRNLSEGVPRSFTISSNEVLEALTEPLNQ
Q7NPY5_CHRVO          IGETTAEEIKKTIGSAFP---GAEVREMEVKGRNLAEGIPRAFTVSSNEILEALTEPLNQ
MREB_CAUVN            IGETTAERIKKEIGTARAPA-DGEGLSIDVKGRDLMQGVPREVRISEKQAADALAEPVGQ
B8DRC1_DESVM          IGESSAEEIKIKIASAYPM--DPEQQ-LEVKGRDLVTGIPQNIIITSEEVRKAISEQVES
F0JDA7_DESDE          IGESTAEQIKIHIGSAYPLG-DEEPI-MEVKGRDLVTGIPQNRPITAEEVREAISEQVEG
C0Q988_DESAH          IGERTAEIIKTTIGNAYPDP-ENLET-IEVKGRDLVSGIPKILTIDSEEICLAISEQIDA
Q9Z756_CHLPN          IGPRTAEEIKITIGSAYPLG-DQELE-MEVRGRDQVAGLPITKRINSVEIRECLAEPIQQ
F8KYQ5_PARAV          IGPRTAEEIKMTIGSAYPLG-ENELE-MEVRGRDQVAGLPVTKRINSVEIRECLAEPNQQ
Q1PZZ1_KUEST          IGHRTAEQIKILIGSAYPL--EEELK-MEVRGRDAIAGLPRATNIGSEEIREALKEPIDK
B2A3F3_NATTJ          IGERTAEDIKKQVGTAYP---ELKQDTMEVRGRDQVSGLPRNVTISSEEVYQALKEPVSS
B1MWY9_LEUCK          VGERTAETIKIQIGSALP---VDEPLTMEVRGRDNFEGMPKTITINSNEVEEALHDTLQQ
B8IZZ9_DESDA          VGDNTAENVKKIIGAAVPMP---NAPILEVSGKDMVRGCPRVVKVTEAHIREALREPVQA
Q1MP88_LAWIP          VGEIMAEKIKMTLGSLETPP---EPLTMEISGKHITNSGPTNLKLDHTHVQKAITPVIDI
R5FDM5_9BACT          VSERMAERIKIHVGSALTDLGDEAPEDYIVHGPNRITALPMEVPVCYQEIAHCLDKTVAK
F9D0U9_PREDD          VSERMAERIKIHVGSALTDLGDEAPEDYIVHGPNRITALPMEVPVCYQEIAHCLDKTVAK
E6SSP3_BACT6          VSERMAERIKINVGAALTELGEDAPEDYIVHGPNRITALPMEVPVCYQEVAHCLEKSISK
A6LD55_PARD8          VSERMAERIKINVGSALTVL-EDAPEDYVVHGPNQMTALPMEVPVSYQEIAHCLDKSISK
H8KXT1_SOLCM          IGDRTAEKIKIEVGSALAEL-QEPPADFAVQGRDLMTGVPKQIMVSYTEIAHCLDKSISK
Q26G04_FLABB          VGERTAEKIKIQIGAATEDL-EVPPEEMSVQGRDLLTGKPKEVKIGYREIAKALDKSILR
E3H9T1_ILYPC          IGEKTAEQIKIQIGTALALS-EEE--TMTIKGRDMVTGLPKPLTITSAEVLEAIEDSLME
D1AWM7_STRM9          IGDRTAEKIKKELSTAIFLP-EEENKKMTIKGLDINTKKPKELVITSNQVCEAIEDSLNN
D4LEE4_RUMC1          IGDRTAEDAKIQLTNLYDPS-EDV--RMTVRGKNLMRGLPDSAELTEVELFEALEEDVFA
Q65K55_BACLD          IGERTAEEVKIEIGYALI---DHETKTMEVRGRDLVTGLPKTITLESKEIQKAMRESLLH
G2TLR6_BACCO          IGERTAEKIKMEIGHALV---DHPEQTLDVRGRDLVTGLPRTITLSSLEIQASLRDSLLQ
A4IKA1_GEOTN          IGEQTAEQVKIEIGSAPG---TSLTQPMTIHGRDFVTGFLKAVSLDPAEVQQAIKESLLQ
H2J3E5_MARPK          IGESTAEYLKKEIGKAHRDI---ETLELEVRGQDLATGMPSSRVINSDDIYEAIEDVLND
H9UD07_FERPD          IGDTTAEEIKIRIGKVHPDV---EDLELEVKGRDAVTGLPRTEVINSTDVYKMIRPVVDN
C5CED5_KOSOT          IGETTAEEVKIRIGKAFPTL---ENYELEVKGRDAVNGLPGNLRLTSEDVLEAITPILQE
G9PYA6_9BACT          IGESTAEEIKIAIGSVIPLD---QELKMDVKGRDLVDGLPKVVSICSEEVRESIEPIVMQ
F7V628_CLOSS          IGQKSAKLLKEKIGSALP---QEEETTYRIVGLNVVSGLPMEMEISSKIIYESIKDTLDS
C4ZA48_AGARV          IGQKTAKLLKETIGSALP---GRE-DSMVIVGRDVVSGLPIEMEIGSKVVYEAMKSNLES
E0RWC5_BUTPB          IGEKTSEAVKISLKDLE-----KEGKDAVVYGRDIVTGLPVERKIPTDLLNQALIENFDA
B0S3Y5_FINM2          IGISTAEAIKFKIATLNS---DRENNTMIVGGTDVISTMPKSVEIRAKDITPAIVPIADM
V5RK33_SPIAP          IGSKTAESIKVNAGSLAK---YPDERRMKVYGRDVVSGLPREIEITPEEVREVLKVPVSR
V5RHX5_SPIAP          VGIKSAETVKIKMGSLAK---YPDEKTMKVYGRDIVSGLPREIEIKPEEIREVLKIPLSK
F0RUT9_SPHGB          IGELTSEKMKIELGDLHA---EAKNVVNRYAGRDMVKGIPKWVMLSTTEVQSVLIPVFEE
E8N4P5_ANATU          IGQPTAEQLKIRLGAAIPQD---QQQTMEVQGQDQVSGLPKPVSLTSEDIIEALQEPLQE
A8ZNP8_ACAM1          IGELTAESLKIQFGSASDSAC--NDTPMEILGVNVGSGLPQRLEINSGELRDAISIPLHK
O27103_METTH          IGIHEAEKAKIEVGMVKCD-EDLENLKTVVIGKCMETNKPKKVEIDSEMVAEAAEPVVNG
F0T6K9_METLA          IGIHEAEKAKIAVGMVHSD-ADVENLINTAIGKSMETNKPKQVEIDSKIVADAAEPIVKN
D3DZK8_METRM          ISIHDAEAAKIEVGMVHCS-EEFENLNYEVIGKSLETNRPKKVVIDSMLVADAAEPIIKQ
F6EJS9_HOYSD          VGELTAENAKIHM-------HDAGEQSLILEGRDASTGRVRLVTLSTDEVAEALRPTTTE
C5AJR5_BURGB          LGEQTAEHVKKQIGSACHSV---PRESMRAVGRGVEDGLPRTIELSNHDVAEALAAPLKQ
A5VGL2_SPHWW          IGDRSAEQLKLDYVAHKGSR-SAQGDAIPVSGRCLRTGLPKTIAIKMADLDRVVEKHVAQ
F2R0Z7_STRVP          LPSQSVRPLQLALSGNGLTPQG--PAWTEIHGRDVATGLARSVTVDTAAVREAIHTPLTA
B5GQK5_STRCL          LPSQSVRPLQLALHGNGLHSHG--PESTEIHGRDVATGLARSVQVDTAAVRNAIHTPLTS
C9ZCF8_STRSW          LPSQSVRPLQLALSGNGLTPHG--PASTEIHGLDVATGLARSVQVDTAAVRDAIQTPLTA
B5G8B1_STRSH          LPAQSVRPLQLAVDAANPRT-----GTTEIRGRDAATGLARSVTVDTAALREAISAPFTT
M3CC37_STRMB          LPTQGLYPLHMALRADRLGGG----TETEVRGRDVATGLSRTVLVSTAHVREAVRTPLTV
T0BS21_ALIAG          VGLQSVQQVKHQLGEDGLETF-------RLIGRNMATGLPGEVEVKREMFEAPMISYCDQ
                      :        :                     *            :               

MREB_BACSU            IVEAVKSTLEKTPPELAADIMDRGIVLTGGGALLRNLDKVISEETKMPVLIAEDPLDCVA
Q38XC7_LACSS          IIDAIKETLEETSPEIAADVIDHGIVLTGGGALLKHLPEVISDATKVPVFIAQDPLDCVA
B0KAD9_THEP3          IIEAIKMTLEKTPPELAADIMDRGIMLTGGGALLSGIDKLIREETGMPVQIADQPTDCVA
K4LRY7_THEPS          IVEAIKVCLEKTPPELAADIMDRGIVLAGGGSLLHNLDKLVSEQTGIPVLMAEEPLYTVA
A0A222TBA9_9ACTN      IVDAVKTTLDKCPPELSGDVMDRGIVLTGGGALLRGLDERLRQETGMPIHIAEDPLDSVA
MREB_ECOLI            IVSAVMVALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVA
J7U1C3_MORMO          IVSAVMLALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVIVAEDPLTCVA
G4QFF8_GLANF          IVSAVMVALEQSPPELASDISERGMVLTGGGALLKDLDRLLMEETGIPVVIADDPLTCVA
E1SN04_FERBD          IVSAVMTALEQSPPELASDISERGMVLTGGGALVKDLDRLLQEETGIPVVVADDPLTCVA
A0A0Q2RJE1_VIBFU      IVSAVMVALEQCPPELASDISENGMVLTGGGALLKDLDRLLTEETGIPVVIAEDPLTCVA
D4G7J1_RIEPU          IVSAVMLALEKAPPELASDISEKGMVLTGGGALLKNLDKLLTEETGIPAIIAEDPLTCVA
MREB_PASMU            IVAAVRTALEECQPEHAADIFERGMVLTGGGALIRNIDVLLSKETGVPVIIADDPLTCVA
F6AF11_PSEF1          IVQAVKSALEQSPPELASDIAERGLVLTGGGALLRDLDKLLSQETGLPVIVAEDPLTCVA
Q7CLP3_XANCP          IVSAVKLALEQTPPELCADVAERGIVLTGGGALLRDLDRLISEETGLHVQVADDPLTCVA
Q8Y3C1_RALSO          IVSSVKIALEQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVV
Q2KU74_BORA1          IVSAVKIALEQTPPELGADITDKGIALTGGGALLRDLDRLLQEETGLPVVVADDPLTCVV
A1W2L8_ACISJ          IVSAVKNALEQTPPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVV
Q7NPY5_CHRVO          IVSAVKIALEQTPPELGADIAEKGMVLTGGGALLKDIDRLLAEETGLPVFVAEEPLTCVV
MREB_CAUVN            IVEAVKVALEATPPELASDIADKGIMLTGGGALLRGLDAEIRDHTGLPVTVADDPLSCVA
B8DRC1_DESVM          IVQAVRIALEQTPPELAADIVDRGIVLTGGGGLLKGLDQLLREETSLPITVVDDPLSTVV
F0JDA7_DESDE          IVQGVRIALEQTPPELAADIVDRGIVLTGGGALLKGLDQLLQHETQLPITVVEDPLTAVV
C0Q988_DESAH          IVECVKIALEQTPPELAADIVDSGIVLTGGGALLKNLDKLLREKSGLPIIVAEDPLSTVA
Q9Z756_CHLPN          IIECVRLTLEKCPPELSADLVERGMVLAGGGALIKGLDKALSKNTGLSVITAPHPLLAVC
F8KYQ5_PARAV          IIEHVKLTLEKCPPELAADLVERGMVITGGGALMKGLDKLLIKETGLPVITAPNPLLSVC
Q1PZZ1_KUEST          IVHAVKATLEKTAPELASDLLTNGLVLVGGGALIKRLDTLLAEETGLPVRVADDPLTAVA
B2A3F3_NATTJ          ILECIKQVLEQTPPELSADIMDKGIVITGGGSLLHGLDKLLQDEVDTPVYIPDNPIGSVA
B1MWY9_LEUCK          IVRAAHSVLAKLPPELAADIIDRGIMLTGGGALLHGMDQLLSDALEVPVVVSDSPLDNVA
B8IZZ9_DESDA          ILEVVLRALEKTPPELAADIYRNGMLMAGGGSLLKGLDQYISRETRLKVFVDKDPLTTVL
Q1MP88_LAWIP          ILKSILDVLEQTPPELSADIMQQGILLTGGGSLIQGLNTCITNLTGLPVNVDRTPLTTVI
R5FDM5_9BACT          IENAVLSALEATPPELYADIVKNGIWLTGGGALLRGLDKRLTDKINIPFHIADDPLHSVA
F9D0U9_PREDD          IENAVLSALEATPPELYADIVKNGIYLTGGGALLRGLDKRLQDKINIPFHIAEDPLHSVA
E6SSP3_BACT6          IETAILSALENTPPELYADIVHNGIYLAGGGALLRGLDKRLTDKINIPFHIAEDPLHAVA
A6LD55_PARD8          IEAAILSALEQTPPELYADIVKNGIYLAGGGAMLRGLDKRLRDKMNIQFHIAEDPLHAVA
H8KXT1_SOLCM          IEEAILKALEITPPELSADIFQTGIYLTGGGALLRGLDKRIAAKTKLPVHVAEDPLRAVV
Q26G04_FLABB          VEDAVMETLSQTPPELAADIYNTGIYLAGGGSMLRGLDKRLSQKTDLPVYIAEDPLRAVV
E3H9T1_ILYPC          IVTSVKQVLEKTPPELSADIVDKGIVMAGGGSLIRNFPELISKHTHLPVKLSTGPLESVV
D1AWM7_STRM9          LVAAVKEVIGKCPPELASDILDNGIVLTGGGALISNLYKLIENEVKVNVHVPDKPLDSVA
D4LEE4_RUMC1          IIEAVRHVLERTPPELIGDIYDNGILLTGGGSYLGGLEKLISRTLGVKCHVAKDAETCVA
Q65K55_BACLD          IIEAIRATLEDCPPELSGDIVDRGVILTGGGALLNGIKEWLSQEIVVPVHVAANPLESVA
G2TLR6_BACCO          ILETVRATLEDCPAELSGDIVDRGIVLTGGGALLQGMQEWLSNEISVPVHLAPNPLQSVV
A4IKA1_GEOTN          IAEAIRSVLEECPAELSGDIIDRGIVLTGGGALLHGIEQWLSATLHVPVHVAPNPAEAVA
H2J3E5_MARPK          IIQKTKNVLEITPPELSADILKNGIYLAGGVAKLRGLAQLFEEKTGVTTNVAEEPQLCVA
H9UD07_FERPD          IISRIKLVLEKTPPELSADIVEHGIVLTGGGALLRGIDKAIEEDIGVPCRIADEPLLCVA
C5CED5_KOSOT          LIVNLRQALEETPPEIASDIIDGGIVLAGGGSMIRGLPELFIQETGISTIVAPDPRTCVA
G9PYA6_9BACT          IEETIRSTLERTPPELVRDIVDQGIVLSGGTANLRGLNIRFADALNVPIHIAEQPVFSVA
F7V628_CLOSS          ICSAVKRILEKTPPELAKDVVKSGIYITGGSSQLKDFDKLIADVTGIQVNTCENPEECVV
C4ZA48_AGARV          ICTSIKMILEKTPPELAKDIIHSGIYITGGGSQLTGLDQLFEQITGIKVICSECPEESAV
E0RWC5_BUTPB          ILDNIKAALEKTPPELAADIFKHGLYLTGGASQVCHLAQRLSNGVGLNVNIAENPVGSGA
B0S3Y5_FINM2          CIEALRKVLEKTPPDIANDIIAEGIYIVGGVSLVDYIHEYITNVLGIKVLKVDSPMDCTG
V5RK33_SPIAP          IIDLTVQVLEDTPPELAGDIFRNGITICGGGALIRGIDKYFADTLQLPTKIGEQPLLAVI
V5RHX5_SPIAP          VIDLIVRVLEETPAELAGDIFRNGMTLCGGTALIKGIDKYFGDTLQLPAKIGQSPLLAVI
F0RUT9_SPHGB          IVKLIMGVLKDTPPELSADIYKNGILLTGGCSMIRGIEEYVQKRIQVPVKVVHNPLTCVA
E8N4P5_ANATU          VVACAKRVLEKTPPELIADIIDRGVALCGGGALLKGIDRYLTKALGIPAYLVDNPTTCTA
A8ZNP8_ACAM1          ISVALLNFLERTHPELVSDIAERGIMVTGGGALLSGIDTFFQDLTHLPVHISPNPLNSVV
O27103_METTH          IVKSIAEVLERLSPELISGVYNKTVVV-GGTSQLRGLKERIYDEVGIPVEISDDPMTVVA
F0T6K9_METLA          LIEALAVVLERMSPELISGVYNKTVVV-GGTSQLRGLKERIYQEVGVPVEISDDPMTVVA
D3DZK8_METRM          VIGGLNLILERLPAELMMGIYNNTVAV-GGSSRLRGIKERIFDESEIPIKISDDPMTVVA
F6EJS9_HOYSD          IVHALAACQEELPAQAVCDVLAEGLIVMGGGALLGGLTQLLEEASGFPVKVADRPLTCVA
C5AJR5_BURGB          VITTVKAVLENAPPELVTDIAHRGIVLTGGGALLAHLDRRLFDETGLAVRVADEPLSCAV
A5VGL2_SPHWW          IVKVVRDVLGQTAPDLSQDIHDKGILLTGGSALVPLMRTMIADATGLEVMTADEPAQCVA
F2R0Z7_STRVP          VLDGIGKVLRDCPPDLVADLADRGIMMVGGSALLPGLDQMLREATGMPVHIAERPDVCAV
B5GQK5_STRCL          VIDGIGKVLRDCPPDLVADLADRGITMVGGSALLPGFDQMLRDATGMPVRIADRPDVCAV
C9ZCF8_STRSW          VVDGIGKVLRDCPPDLVADLADRGIMMVGGSALLPGFDQMLRHATGMPVHIAERPDVCAA
B5G8B1_STRSH          ILDGIGRVLRSCPPDLVADLAEGGLTAVGGSALLPGLDRMLKEATGMPIRIAENPGMCAV
M3CC37_STRMB          VLDAIGRVLRDCPPDLVADLGTRGVMLAGGSALMPGLDTMIEDATGMTVHIAANPDHCSV
T0BS21_ALIAG          IVEFIRSTIESCPPELVGDIMDHGAVLVGGGANSALIRREIESRVEVPVAVAENPDDAVV
                                   .:   .:        ** .    :   .             .     

MREB_BACSU            IGTGKALEHIHLFKGKTR-----------
Q38XC7_LACSS          VGTGESLKNIEVMKKN-------------
B0KAD9_THEP3          LGAGKILEESSLFRRVLSPATRV------
K4LRY7_THEPS          LGTGKALENIEILKRVMATRNVR------
A0A222TBA9_9ACTN      LGSGKCVEEFEALQQVLDAQPRR------
MREB_ECOLI            RGGGKALEMIDMHGGDLFSEE--------
J7U1C3_MORMO          RGGGKALEMIDMHGSDLLSEE--------
G4QFF8_GLANF          RGGGKAFDMIDLHGGDLFSYE--------
E1SN04_FERBD          RGGGKALEMIDMHGGDLFSDE--------
A0A0Q2RJE1_VIBFU      RGGGKALEMIDMHGGDLFTDE--------
D4G7J1_RIEPU          RGGGKALEMIDNYLGDFLSDE--------
MREB_PASMU            RGGGEALEMIDMHGGDIFSDDI-------
F6AF11_PSEF1          RGGGKALEMMDRHSMDLLSTE--------
Q7CLP3_XANCP          RGGGRALELVDMHGNEFFAPE--------
Q8Y3C1_RALSO          RGSGMALERMDKLGSIFSYE---------
Q2KU74_BORA1          RGCGEALEHLEKLGAIFIND---------
A1W2L8_ACISJ          RGCGIALERMDRQGSIFTSD---------
Q7NPY5_CHRVO          RGSGKALEKMDKIGTIFTNVP--------
MREB_CAUVN            LGCGKVLEHPKWMKGVLESTLA-------
B8DRC1_DESVM          IGTGKALDNLHILKEVCID----------
F0JDA7_DESDE          LGSGKALDNIDLYKDITTD----------
C0Q988_DESAH          LGCGKVLDNIDILREVVIT----------
Q9Z756_CHLPN          LGTGKALEHLDQFKKRKGNLV--------
F8KYQ5_PARAV          LGTGKALEYLDKFKKRKAMANA-------
Q1PZZ1_KUEST          KGTGYLLENLDLFKAVLYDEDLQT-----
B2A3F3_NATTJ          EGTGKALEYLDKLESSLISSKSISKKNRH
B1MWY9_LEUCK          KGAGALLEHMKSSHKGL------------
B8IZZ9_DESDA          RGTARAMLDRETYRSVFIN----------
Q1MP88_LAWIP          NGAGATLDDIARYKQLLLE----------
R5FDM5_9BACT          KGAGVALKNVNRFSFLMR-----------
F9D0U9_PREDD          KGAGIALKNVNRFSFLMR-----------
E6SSP3_BACT6          KGTGVALKNVDRFSFLMR-----------
A6LD55_PARD8          KGTGVALKNIEKFNFLIR-----------
H8KXT1_SOLCM          RGTGIALKNIENFRFLMP-----------
Q26G04_FLABB          RGTGLTLKNIERYKSVLAK----------
E3H9T1_ILYPC          IGAGIALDKIEVLRKIEKAER--------
D1AWM7_STRM9          IGGSYAFDNKNLLNTLLVKEN--------
D4LEE4_RUMC1          KGTAKAFRRHDVLLDGFESVTLFK-----
Q65K55_BACLD          IGTGRSLEVIDKLQKAAK-----------
G2TLR6_BACCO          VGAGRSLQFIHKMTAGAGK----------
A4IKA1_GEOTN          IGTGKALQAIPKRLSTAL-----------
H2J3E5_MARPK          RGAGILLENPELLSKVAVI----------
H9UD07_FERPD          KGTGKLLEDEELLKNVAVTYEK-------
C5CED5_KOSOT          YGLGKLLDEEKNLERVAVKAGR-------
G9PYA6_9BACT          LGLGKILEMPQDKNRLSITVEKQGA----
F7V628_CLOSS          RGLSSIIAEPGYHKLAYTMKPKSFK----
C4ZA48_AGARV          RGLVQIVSDSKYKRLPFSIKK--------
E0RWC5_BUTPB          LGLAKIIKEDQYKALAYGIEEDK------
B0S3Y5_FINM2          IGIGKFLKKGDK-----------------
V5RK33_SPIAP          NGTKKFESEIWEIIKAQRLHEDIMSR---
V5RHX5_SPIAP          NGTKRHESYIYEQLKKHNQNSNLK-----
F0RUT9_SPHGB          EGTKYLLKNRGDYLVNPLQL---------
E8N4P5_ANATU          EGAARAFSMREALSRSLLPT---------
A8ZNP8_ACAM1          LGTGKILEYEHQSSYSFA-----------
O27103_METTH          KGAAIVAAEPRALEPEVRLKAMK------
F0T6K9_METLA          KGAAIVAAEPRALEPEVRLKAMK------
D3DZK8_METRM          KGTAIVAAEPLALEPEVRLKAMK------
F6EJS9_HOYSD          EGATRCLSQPEVLSAFAA-----------
C5AJR5_BURGB          RGAGEAMGRLEADIEH-------------
A5VGL2_SPHWW          KGLERLLEA--------------------
F2R0Z7_STRVP          LGLGAMLEGKVQPMVLDPLSERNPSADED
B5GQK5_STRCL          LGLGAMLEGNVKPLAFDPLTEVEE-----
C9ZCF8_STRSW          LGLGAMLDGRIAPISLDPVGD--------
B5G8B1_STRSH          RGLGAMLEGRVGPMTLSPIPAH-------
M3CC37_STRMB          LGLGAMMEGKVKPMVLDPLAAG-------
T0BS21_ALIAG          LGLEKMTEHSSHNWRNKAKSFLRTS----
                       *