CLUSTAL format seed alignment for MF_02208

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURD2_XANOM           ----MRISQFE-------GKAVALWGWGREGRGAYRALRAQ-LPT--QSLTMFCNAEEVR
MURD2_XANCP           ----MRISQLE-------GKAVALWGWAREGRAAYRALRQQ-LPA--QPLTVFCNAEEAR
MURD2_XYLFA           ----MRISALE-------GCRVALWGWGRESRAAYRTFRAA-FPK--QPLTLFCTIAEAT
B2FSJ4_STRMK          ----MKISKLD-------GKRVALWGWGREGRAAFAVLRER-LPT--LPLSLFCPAAEVE
A0A0S2F8E0_9GAMM      ----MLISQLD-------GQRVALWGWGREGRAAYQAIRSR-QPE--LALTLFCSADEAA
G7UQU4_PSEUP          ----MRISQLE-------GQRVALWGWGREGRAAHALLRSR-LPS--LPLTLFCSQAEAV
A0A075K4L4_9GAMM      ----MRIADLA-------GRRVAIWGFGREGKAAITAIRTR-LPS--LPLTLFCSEAEVA
M4NH31_9GAMM          ----MRFDELR-------DRRVAIWGFGREGRAVLKALRER-LPS--QPLTLFCSAAEVD
H8KZN9_FRAAD          ----MGMSELKIDGRPLEGRRVLVWGFGREGRAVLELLRPQ-LPF--LQLAVLCSEAERE
MURD2_MICS3           ----MRLSDLR-------GRTVAVWGAGREGRAAVIAIAAH-GPADLVAVDDSANFLALP
F4FED0_VERMA          ----MRLSDLR-------GRTVAVWGAGREGRAAVIAIAAH-GPADLVAVDDSANFLTLP
MURD2_SALTO           ----MRLSDLR-------GRKVAVWGTGREGRAAVVAIAAH-GPADLVAVDDGGSTVSPP
G8SEF1_ACTS5          ----MRLADLR-------GRSVAVWGTGREGRAAVGAIAAH-EPSRLIAVNDGAGYLDDP
D2S4M7_GEOOG          ----MRLAELA-------GRRVGVWGHGREGRAAVRAALTA-RAAGVVVVDAVPPVDL--
F8AYB6_9ACTN          MRPTISWSDLR-------GRAVGIYGLGREGEANLRACLAR-GVDPVLVDDAPGRTHVDG
G4R6Q5_PELHB          ----MHI---E--------GPVLLYGAGREARSTAAFLRRT-YPDLELFVTTDDGVAELE
A0A5B9DQF0_9RHIZ      ----MHF---D--------APVLLYGAGREARSTREFIRTH-SPDTKVFVTVDSGEVDIE
A0A0K2LXF8_9NOST      ------------------MPEALIIGFGKSGVAAARLLKQEGWEVELCDSSTSPTLLEQQ
K9WXU7_9NOST          ------------------MPEARVIGLGKSGVGAARLLKREGWEVEICDRHTSETLLQQQ
E0TG10_PARBH          -----------------MSGPVLLIGLGVEGKAAARHFLGQ--GREIVVVDQRAPGTPPP
I0K0Y7_METFB          ----MTEAIRDY----FLGKKILIWGLGLEGRATLEFLLAH-LPETFFFVS---DSNPAA
                                             : * . .. .                           

MURD2_XANOM           ELESLADAALHVETDASAQALGRFEIVVKSPGISPYRAEALAAA-AQGTQFIGGTALWFA
MURD2_XANCP           DVAALADPALQVQTEASAQALAAFEVVIKSPGISPYREEARAAA-AQGARFIGGTALWFA
MURD2_XYLFA           EVQALADPVLSIETEVSVPRLAAFDVVIKSPGISPYSPLAVAAT-AAGAHFIGGTQLWFA
B2FSJ4_STRMK          AARAETQGVLDVRGEPSAEALAAFDVVIKSPGISPYQPIALAAE-GQGTRFIGGTALWFA
A0A0S2F8E0_9GAMM      DARGLNDARLAVETAATAERLSAFDWVIKSPGISPYRAEALAAA-EQGTRFIGGTALWFG
G7UQU4_PSEUP          QAAALGDGLLTARTDITGEALGGFEVVIKSPGISPYSAEAVQAQ-ARGARLLGGTALWFG
A0A075K4L4_9GAMM      AARVFDASLAVRGEEPDATALAMFDVVVKSPGISAYKPALLAAR-ETGIRITSGTALWFA
M4NH31_9GAMM          AARAFDAALHIVAGEPDAATLGRFDVVVKSPGISAYKPALLAAR-AQGTRLTSGTALWFG
H8KZN9_FRAAD          AVLAFDARLRVLDGPVDAELLAGWDIIVKSPGISAYVPALLEAR-RRGSLVTSGTALWFA
MURD2_MICS3           WEGPLAEAAPLVTGEEGFARLAAAEVVVRSPGVPNTHPWLVELR-GRGVTVTQGSALWMA
F4FED0_VERMA          WEGPLAEAAPLITGEEGFARLAAADVVVRSPGVPQTHPWLVELR-RRGVTITQGTALWMA
MURD2_SALTO           WDGFLATAAPLVTGDAGAQRLAAADVVVRSPGVPNTHPWLAELW-RRQVPVTQGTALWMA
G8SEF1_ACTS5          WNDP---RAPLAGGEHAFAALASADVVVRSPGVPSTHPFMAELR-TRGVPVTGGSALWMA
D2S4M7_GEOOG          --------PPGVQAGSDVAELAGCAVVFRSPGISPYREDARALAARTTLTSGTGVALAEF
F8AYB6_9ACTN          -------RPLLATAAGGFDALTRCDVVVKTPGISRYGETVRALQ-RRGIPVVGGVGLWLA
G4R6Q5_PELHB          GASFIP-----PDK---ANEVSRFGTIVKSPGVSLYKPIFEVAR-AAGVPITSNLNIWGA
A0A5B9DQF0_9RHIZ      DVEVLA-----PADLPDAIAARKFGTIVKSPGVSRYRPVFAIAR-EAGIAVTSNLNLWGE
A0A0K2LXF8_9NOST      QQLASEHITVKLGHKPEFTNSDISKLIVFSPGVPWDIPILAKAR-ELGIETIGEMELAWR
K9WXU7_9NOST          QELAAEQITVKLGYSPDLNSPDLPQLIVVSPGVPWDIPLLVKAR-DLGIETIGEMELAWR
E0TG10_PARBH          AEIAHSPKAHWVGESEAAKWLEKADLILRSPGVPPTHPLVERGL-AADRLITTPTGYWLA
I0K0Y7_METFB          LKAIQSPWIGQIEEEDLFSCMESFNVIVKSPGIRTSHLAIEPSI---KEKIVLQTDLFLQ
                                                :. :**:                           

MURD2_XANOM           EHAQPDGSVPGAICVTGTKGKSTTTALLAHLLRVAGHRTALVGNIGQPLLEVLAP-----
MURD2_XANCP           EHAQPDGYVPGAICVTGTKGKSTTTALLAHLLRADGHRTALVGNIGQPLLEVLSP-----
MURD2_XYLFA           AHADTDGVVPGAVCVTGTKGKSTTTALLAHLLRAAGHCTALAGNIGMPLLELLTP-----
B2FSJ4_STRMK          EHAADDGIVHDTVCVTGTKGKSTTTALVAHLLRAAGHRTGLVGNIGLPLLEVLDP-----
A0A0S2F8E0_9GAMM      EHADA-----RAVCVTGTKGKSTTTSLLAHLLRAGGHRTALAGNIGLPLLEVLDP-----
G7UQU4_PSEUP          EHPEA-----RTVCVTGTKGKSTTTALLAHLLRAGGHRTALAGNIGLPLLEVMDP-----
A0A075K4L4_9GAMM      EQPDA-----RVVAVTGTKGKSTTTALLAHLARSLGVRTALAGNIGMPLLELLG------
M4NH31_9GAMM          ENPDA-----RVIAVTGTKGKSTTSALIAHLARALGVRTALAGNIGLPLLELLG------
H8KZN9_FRAAD          RHPQA-----RVVAVTGTKGKSTTSAMLAHLARSLGLATVLAGNIGLPLLEVDA------
MURD2_MICS3           DHAR------RTVGVTGSKGKSTTSSLISHLLTAVDRPNVFGGNIGVPLLD---------
F4FED0_VERMA          DHGD------RTVGVTGSKGKSTTSSLIHHLLTAMDRPNVFGGNIGVPTLD---------
MURD2_SALTO           DHAA------RTVGVTGSKGKSTTSSLISHLLAAVDQPNVFGGNIGVPTLD---------
G8SEF1_ACTS5          DHAA------ATVGVTGSKGKSTTSSLISHLLAAVGRPNAYGGNIGVPLLD---------
D2S4M7_GEOOG          AARDV-----PTLCVTGTKGKSTTSALAAAVLTAASRPAVHAGNIGTPLLDVLLDDA---
F8AYB6_9ACTN          EADRS-----KVLCVTGTKGKSTTSAIAGHLLTRLGYRCLVAGNIGLPPHD---PQA---
G4R6Q5_PELHB          HFREG----RTVVAISGTKGKSTTATLVHLMLEKSGVDVVLAGNVGIPPLDAAGS-----
A0A5B9DQF0_9RHIZ      QYRDE----VKVIAISGTKGKSTTATLAWLMLVNSGVDAGLGGNVGVAPLDVADK-----
A0A0K2LXF8_9NOST      YLQDI-----PWVAITGTNGKTTTTALTAAIFQTAGLNAPACGNIGHAACEVAIQARGKG
K9WXU7_9NOST          HLQTI-----PWVAITGTNGKTTTTALTAAIFQTAGLNAPACGNIGYAACEVALAAK---
E0TG10_PARBH          SEAPE-----GTVTITGTKGKSTTTALLTDLLTALGEKAGAFGNIGTPVLSETAI-----
I0K0Y7_METFB          FWPGI------TIGITGSKGKSTTTSLIHHLLKTNGLEAYIGGNIGVPPFHLIPF-----
                                  : ::*::**:**:::   :    .      **:* .            

MURD2_XANOM           --------QPPPAYWAIELSSYQTGDVGRSGARPELAVVLNLFPEHLDWHGDEAR-YVRD
MURD2_XANCP           --------QPPPAYWAIELSSYQTGEVGRSGARPELALVLNLFPEHLDWHGSEAA-YVRD
MURD2_XYLFA           --------QPTPEYWAIELSSYQTGDVARSGARPVLALVLNVFPEHLDWHGSEQR-YIND
B2FSJ4_STRMK          --------QPAPEYWAVELSSYQTGEVARSGARPQVAVVLNLFPEHLDWHGSEQR-YIED
A0A0S2F8E0_9GAMM      --------PQPPEFWAIELSSYQTGDVAAGGARPEVAIALNIYPEHLDWHGSQAR-YVED
G7UQU4_PSEUP          --------QPAPQLWAIELSSYQTGAVADGGVAPEVAVVLNLFPEHLDWHGSQQR-YIQD
A0A075K4L4_9GAMM      ---------ESAGLWAIELSSFQTGEAG----QVELGVMTSLYEEHLDWHGSRER-YIED
M4NH31_9GAMM          ---------QSADLWVIELSSFQTGEAG----PLELGVVTSLYEEHLDWHGSRER-YVAD
H8KZN9_FRAAD          ---------VEADLWVLELSSFQTREAG----PLELAVIVSLYEEHLDWHGSRQR-YVED
MURD2_MICS3           --------LPDADLYVLELSSYQCADLTD---SPRVAVVTALFPEHLDAHGGERE-YYRD
F4FED0_VERMA          --------LPEAELYVLELSSYQCSDLTD---SPRVAVVTALFPEHLDAHGGERE-YYRD
MURD2_SALTO           --------LPAADLYVLELSSYQCSDLTD---SPRVAVVTALFPEHLDAHGGERE-YYRD
G8SEF1_ACTS5          --------LPPAELYVLELSSYQCADLTD---SPRVAVVTSLFPEHLDAHGGERE-YYRD
D2S4M7_GEOOG          --------VAEGTPLVVEVSSYQAAAVEG---WSGWGAVTSLAPEHLDWH-GDVETYYRD
F8AYB6_9ACTN          --------GSGYDFWIVEISSYQATDLAC---SPPVVALTSLHPDHLPWHRDDPETYYRD
G4R6Q5_PELHB          -----------AQTVVLELSSYQTADIDF---APDIAAISNLYPEHVDWHGGLDA-YYRD
A0A5B9DQF0_9RHIZ      -----------YRTVVFELSSYQTADMAF---TPDIAAITNLSPEHTDWHRDVEH-YYAD
A0A0K2LXF8_9NOST      QEARGNTDKSSVNWIIAELSSYQIESSVT--LAPRIGIWTTFTPDHLARHKTLEN-YYNI
K9WXU7_9NOST          ----------PPNWVIGEISSYQIESSVT--LAPRIGIWTTFTPDHLARHQTLEN-YYNI
E0TG10_PARBH          ----------ALDYPVVEVSSYMLHDVPA---GPYTHMVTSLFRDHTPWHGSEAA-YRAA
I0K0Y7_METFB          --------ASEKAIAVLELSSYQLEYCRH---SPSIAIWLNLYQEHLNYHGSFEAYSLAK
                                       *:**:                   .  :*   *          

MURD2_XANOM           KLSLVTEGRPRIVLLNAADPLLASLQLP-----------------------DSEVLWFNH
MURD2_XANCP           KLALVTDGRPRIALLNAADPHLAQLQLP-----------------------ESEVRWFNH
MURD2_XYLFA           KLSLVTVTRPRIALLNAADPRLASLALP-----------------------QSDLRWFNR
B2FSJ4_STRMK          KLRLVTEAAPRIAVLNATDPHLAALSLP-----------------------DSEVVWFNQ
A0A0S2F8E0_9GAMM      KLRLLTAGKPKIAVLNANDAVLAGLDLP-----------------------DSEIRWFGR
G7UQU4_PSEUP          KLALVTRAHPRIAVLNAADPLLFKLELP-----------------------HSRIVWFNH
A0A075K4L4_9GAMM      KLKLANVS--KQLLVNATQPPLLERTAR-----------------------HPYRIVFGD
M4NH31_9GAMM          KLKLADVS--RMLLVNGLQPGLLERTAA-----------------------HPRRLVFGT
H8KZN9_FRAAD          KLALAEVA--RQLLLPASSPVLRERLGG-----------------------HAGLSLFGQ
MURD2_MICS3           KLNLLAHGPQTIVVNGADPRLAAELG-------------------------DRPAVRAGS
F4FED0_VERMA          KLNLIAYGPRTVVVNGADPRLAFELG-------------------------DRAAIRAGT
MURD2_SALTO           KLNLLAHGPETVVVNGADPRLAAELG-------------------------DRPVVRAGT
G8SEF1_ACTS5          KLNILAHGPELIVVNGADERLRDEIR-------------------------GVSD-RSGF
D2S4M7_GEOOG          KLHVFAGCGPESVVVSAQA----------------------RSIAEQHLDPAVLVDPAEL
F8AYB6_9ACTN          KLSACSQPGAELTVANGDSDLIRAHRHLLGPKVHWVHADDGTTGSADIAGPAVPVGPAGF
G4R6Q5_PELHB          KLNLIAKG-PKMVAIGPQAA-------------------------------TVERVISTI
A0A5B9DQF0_9RHIZ      KLNLIDRDRDFPVALGVGAK-------------------------------DNKLVLEAL
A0A0K2LXF8_9NOST      KAKLLHNSQIQIFNGDDTYLSKLGLTHW----------------PNAYWTTVKGEKFLIG
K9WXU7_9NOST          KAKLLHQSQLQIFNGDDTYLSKLGLNHW----------------PDAFWTSVKGKDFLIG
E0TG10_PARBH          KLRPFGLRPPIPGLAPKAVIEEAALPLS--------------------------VGAFEH
I0K0Y7_METFB          SNIARFQSSENFFLYNADNPSLSEFLAS-----------------------------IDP
                      .                                                           

MURD2_XANOM           PEGWHLRGDVVYR-----------------GEQAIFDSADVPLPGVHNRRNLCAVLAALE
MURD2_XANCP           PDGWHLRGDVVYR-----------------GQQPIFDTANVPLPGEHNRRNLCAVLAAVE
MURD2_XYLFA           RDGWHVRGQVVYR-----------------GDRAVLDTALIPLPGAHNGSNVCAVLATLE
B2FSJ4_STRMK          LQGWHMRGDIVHR-----------------GEQAVFDTRNAPLPGRHNRGNLCAVLAALE
A0A0S2F8E0_9GAMM      EDGWHLRGDVLWR-----------------GEREVLDTSALPLPGRHNRSNLCAVLTAIE
G7UQU4_PSEUP          AQGWHLRGDVLYR-----------------GDAEVFDTRAVPLPGRHNRGNLCAALAAIE
A0A075K4L4_9GAMM      AKGWHVAGGFICR-----------------GAQSLFEIAKLRAPGEHNALNACAALAALE
M4NH31_9GAMM          PEGWHVCDGAIRR-----------------GGQAVFDSAALAAPGLHNALNACAALAALE
H8KZN9_FRAAD          PEGWHVRDEAIWR-----------------GGQRIFERARLALPGLHNALNACAALTALE
MURD2_MICS3           PDTTHVAPGP------------DGTPWFHLGDRPLFPRAVLPLVGRHNEGNLCVALAVLA
F4FED0_VERMA          ADSVNVAGGP------------DGTPWFHLVDRPLFPRAVLPLVGRHNEGNLCVALAVLD
MURD2_SALTO           PDTTHVAGGP------------DGTPWFHLGDQPLFPRAVLPLVGRHNEGNLCVALAVLD
G8SEF1_ACTS5          PPVPAAADDSRFRVE-------DGTVFCS--DDPLFPRSALALVGRHNERNLCVALAVLD
D2S4M7_GEOOG          VPEARLAGFP-----------------------------LERLSGVHNVANLHVALAACV
F8AYB6_9ACTN          AGPLGTAGPPGPGTAGPAGAGTAGPAGADAAGDAGDWTRPLGLLGRHNRRNAVIVRACLR
G4R6Q5_PELHB          PATTRRIPPLDIE----------------LADEILMAAMNSRLKGAHNHDNARLAAAIAL
A0A5B9DQF0_9RHIZ      RDPKRLIAPLDRV----------------VDQAVVDAVSTSRLKGAHNLDNARLAAQIAL
A0A0K2LXF8_9NOST      EKGFYIENGWVMEKITP-------------TPQPIVEVSALRMVGEHNQQNLLMSVAAAR
K9WXU7_9NOST          EKGFYIEDGWVIEKLNAE-----------TPPKPIVQVSALRMVGEHNQQNLLMSVAAAR
E0TG10_PARBH          YAALEGEGLSVRG------------------EALLIPQQINSAFTSHPLRLALRAAAAWA
I0K0Y7_METFB          MPGKLIAVDDKWQ--------------------ETFDCSRLHLPGEHNKRNALFAALTAS
                                                                    *             

MURD2_XANOM           ALGLDAE----ALAPAALSFRPLPNRLQVLGSVDGISYVNDSISTTPYASLAALACFAQR
MURD2_XANCP           ALGLDAA----ALAPAALTFRPLPNRLQWLGSVDGIAYVNDSISTTPHASLAALACFAQQ
MURD2_XYLFA           ALGLNAV----ALAPAACNFHPLPNRLQFLGERDGILWVNDSISTTPHATLAALDCFLGR
B2FSJ4_STRMK          ALGLDAA----ALAPAVQDFRPLPNRLQRIGVADGLTYVNDSISTTPHASLAALECFAGQ
A0A0S2F8E0_9GAMM      ALGVDAA----PLAAHAASFRPLPHRLQQLGERDGLVYVNDSISTTPHASLAALDCFAGR
G7UQU4_PSEUP          ALGIEAS----ALAPAALTFQPLPNRLQTLGTRNGISYVNDSISTTPHATLAALECFSGQ
A0A075K4L4_9GAMM      ALGLDAL----RAAPALADFRPLPHRLQPLGEHDGFHWVNDSISTTPLATLAALGSLDGR
M4NH31_9GAMM          AVGMDAL----AAAPALATFRPLPHRLQPLGEHEGWHWVNDSISTTPLATLAALESLHGR
H8KZN9_FRAAD          LMGHDAM----AAAPALATFRALPHRLQALGLRDGRQWVNDSISTTPEATLAALQSLPDG
MURD2_MICS3           ALGVDVVARADALAVAVAGFQGLAHRLTEIADPSGLTFVDDTLATSPYAAMHAIDAYEGR
F4FED0_VERMA          ALGVDVVGRKDALAVAVAEFQGLAHRLTEIVDPSGLTFVDDTLATSPYAAIHAIDAYEGR
MURD2_SALTO           VLGVDVLARRDTLAVAVAGFQGLAHRLTEIVDPSGLTFVDDTLATSPYAAMHAIDAYDGR
G8SEF1_ACTS5          GMGVDVVGLRADLEAAVRSFPGLPHRLTEIADPSGVTFVDDTLSTSPYSAMHAVEAYEGR
D2S4M7_GEOOG          RMGVDLDRSAEAVRRAVAGFRALPHRLSPVATRDGVTFVDDALSTTPVSVRAAIDAFAGQ
F8AYB6_9ACTN          ALGVPEADDDDALRAAAAGFAGLDSRLKMIGSVGGVSFVDDSLSTNVLPTLAAVDAFDDR
G4R6Q5_PELHB          AAGATRE----GIFAGIEAFIPLPHRLEEV-MVGDILFVDDSISTTPEATKVALAAYKGK
A0A5B9DQF0_9RHIZ      AGGATLE----GVLKGIAAFKPLPHRLEEH-HFGGLLFVNDSISTTPEATKAALAAFPGM
A0A0K2LXF8_9NOST      LAGIDIT----AISQAVREFSGVPHRLEHICNWQGIDFINDSKATNYDAAEVGLASVHSP
K9WXU7_9NOST          LAGIDSD----SITRAISEFPGVPHRLEHICTWENIDFINDSKATNYDAAEVGLASVKSP
E0TG10_PARBH          RRRWPDRPLTDALIDTVRRYRGLPARQEIVASHDGRIWVNDALATIPEATVHAIDRFAVL
I0K0Y7_METFB          LFGISAK----KIAESFASFYGLPHRLEYVATIEGVSYYNDSIATVPEATLAGIEAIPNV
                                         :  :  *        .  : :*: :*   .   .:      

MURD2_XANOM           -RVALLVGGHDRGLDWHDFARHMAQQAP-LEIVTMAANGPR--IHALLAPLADAGRFGLH
MURD2_XANCP           -RVALLVGGHDRGLDWQEFAAHMAQQAP-LEIVTMGANGPR--IHALLAPLAQSAGFGLH
MURD2_XYLFA           CRVAVLVGGYDRGVDWECFAARITRKVP-LDIVTMGANGPH--IQALLAPLA-AGRFGLH
B2FSJ4_STRMK          -RIALLVGGHDRGLDWTDFMQHMAHDVPPVEIVTMGSNGPR--IHAMLQPLADAGRFGLH
A0A0S2F8E0_9GAMM      -RIAILLGGHDRGIDWQVFADAMRRQAP-VAIVTMGENGPR--IHELLASIAAQSDFRLS
G7UQU4_PSEUP          -RIALLVGGHDRGLDWHDFAQAMRMQAP-LGIVTMGANGPR--IHALLQEVAGQGGFALS
A0A075K4L4_9GAMM      -AVTVIVGGHDRGLDWSEFVAAMKAHAP-HAIVAQGVNGPR--IANALREAGVA----VE
M4NH31_9GAMM          -AVTVLVGGHDRGLDWTPFVEAMRTAPA-HAIVCMGANGGR--IEAALRAAAVAC--PVL
H8KZN9_FRAAD          -EVTVIVGGHERGLDWSHFIDEVQQEAP-ALIITQGANGPR--IAEALRTADYRG--RLE
MURD2_MICS3           -PVTVIVGGADRGLDYAPLREHLAEREIT--VLGIPDSGQ-----RIVATLAGLPRVRAE
F4FED0_VERMA          -PLTVIVGGNDRGVDYTPLREHLAERELT--VIGIPDSGP-----RIIEALAGLPKVRTD
MURD2_SALTO           -ALTVIVGGADRGLDYTPLRDHLAEREIT--VIGVPDSGA-----RIVAALDGLPKVRCD
G8SEF1_ACTS5          -PLTVLLGGTDRGLDYAPLREFLASRELT--VIGLPDSGP-----RILAELSGLPKVTTL
D2S4M7_GEOOG          -QVTLIAGGQDRGLDYTDLAAAVVARGGTVQVLTIPDTGARFAADLRAAAAAAGVAAPVT
F8AYB6_9ACTN          -RVALIVGGYSRGIDYRPLAVGLRGRTLDTFVLTVPDNGP--DIRRQVTQTGAGPHVTVV
G4R6Q5_PELHB          -KIALIAGGHERQQDYTDLANLMGLTSV-VMLCSLPVTGTR----LAQAVRDNTP-IPIA
A0A5B9DQF0_9RHIZ      -RIALIAGGHERNQDYAELATLLAPRGV-TVLVCLPVTGDR----LATATYAAAPQIEVL
A0A0K2LXF8_9NOST      --AILIAGGEAKAGDDTTWLAQIQAKAAAVLLIGNAAPAFS-------KRLQEMGYSNYH
K9WXU7_9NOST          --AILIAGGEAKPGDDTGWLAKIQAKAAAVLLIGNAAPAFA-------QRLQEVGYSNYE
E0TG10_PARBH          GRVVLLVGGQDRGQDFAPLATSLADYDCVTTGIFGGIADRL-------APRLRAAGVAFT
I0K0Y7_METFB          --ESLILGGQDRGLPLEGFASKLCQTRNLRNIILLPETGWR----IGTFFERKNHKKNIF
                          :: **  :          :                                     

MURD2_XANOM           AANDLEHAMQLARDAL---GGQGGVVLLSPGAPSFGAYSDYVARGRHFAQLAGFDPAAIS
MURD2_XANCP           AADDLAHAMQLARSAL---GAQGGVLLLSPGAPSFGVYSDYVARGRHFAQLAGFDPAAIS
MURD2_XYLFA           AAVDLPQAVALARTAL---GAQGGVLLLSPGAPSFGAYQDYVARGRHFAILAGFDPEVIS
B2FSJ4_STRMK          AAGDLAEAMALARTAL---GEQGGVVLLSPGAPSFGAYRDYVARGRHFAELAGFDPDSIS
A0A0S2F8E0_9GAMM      AAKDLAEAMAQAQAALREGGGEGGVVLLSPGAPSYGPYRDYVARGRHFAELAGFDPDSIS
G7UQU4_PSEUP          SAPDLASAMQQAEAML---GGQG-VVLLSPGAPSFGMYRDYVERGKEFARIAGFDPEAIV
A0A075K4L4_9GAMM      EAGDLAAAVARARALT----PVGGTILLSPGAPSFDQFHDYADRGRHFAEMAGFDAHEIV
M4NH31_9GAMM          LVNDLASAVEAARART----LAHGVILLSPGAPSFDQFRDYAERGRQFSALAGFEATGVA
H8KZN9_FRAAD          SRADLAAAVDCARALT----PAGDTILLSPGAPSFDQFSDYAARGRRFAELAGFAAESAT
MURD2_MICS3           VVDDLVAAVRRARELTP----ADGVVLLSPAAPSYGRFRNFEHRSEVFAEAVRDTAGHPA
F4FED0_VERMA          LVDDLAAAVQLARQVTP----VGGVVLLSPAAPSYGRFRNFEHRSEVFAEAVRATAPR--
MURD2_SALTO           VTGDLVEAVRLARRVTP----AGGVVLLSPAAPSYGQFRNFEHRSEVFAQAVRDTAG---
G8SEF1_ACTS5          PAEDLADAVRLAREVTP----AGGVVLLSPAAPSYGRFRNFEHRSEAFAEAIRATAS---
D2S4M7_GEOOG          ETGSLADAVAEALRTAR----PGGLVLLSPGAPSYNRFRNYEELARTYEQILLDAGAQRV
F8AYB6_9ACTN          DTPDLATAVVEGYRWAK----PDGVVLLSPAAASFGRFRDYRDRGAAFARAMHNCHTT--
G4R6Q5_PELHB          ECSTLDEAMQALASAGH----IFDTVILSPGAPSYNQFKNFEERGDRFKALARQHFG---
A0A5B9DQF0_9RHIZ      EAENLETAMQALASRRN----RFDAVILSPGAPSYNQFKNFEERGNTFIALAEELFGAKA
A0A0K2LXF8_9NOST      IVETMANAVSLSAELAK--KYQASVVLLSPACASFDQYPNFEMRGEDFRQLCQKYLVP--
K9WXU7_9NOST          IVETMSQAIPKSAELAK--QYQAPVVLLSPACASFDQYPNFEVRGDDFRQLCLDWAKT--
E0TG10_PARBH          PLGTFESALAWVTSSAP----KGATILFSPSAASEPPYADYVARGAAFRAAALDA-----
I0K0Y7_METFB          FAKDLEEAVIIASKFTT----KGSSCLFSPAAPSYHRYLNFEKRGEHFKWLVSQLKNI--
                          :  *:                 ::**...*   : ::   .  :            

MURD2_XANOM           AIPGLGVH-----
MURD2_XANCP           AIPGLGVQ-----
MURD2_XYLFA           SISGLGIA-----
B2FSJ4_STRMK          AIPGLGIA-----
A0A0S2F8E0_9GAMM      TIAGLGIA-----
G7UQU4_PSEUP          AIPGLGVA-----
A0A075K4L4_9GAMM      GIEGLGIG-----
M4NH31_9GAMM          GIDGLGIEGTPHD
H8KZN9_FRAAD          MIEGMGLA-----
MURD2_MICS3           R------------
F4FED0_VERMA          -------------
MURD2_SALTO           -------------
G8SEF1_ACTS5          -------------
D2S4M7_GEOOG          -------------
F8AYB6_9ACTN          -------------
G4R6Q5_PELHB          -------------
A0A5B9DQF0_9RHIZ      A------------
A0A0K2LXF8_9NOST      -------------
K9WXU7_9NOST          -------------
E0TG10_PARBH          -------------
I0K0Y7_METFB          -------------