CLUSTAL format seed alignment for MF_02209

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURL_XANOM            -------------------------------MSAFDKHQISTFRFVRCALDAQTGVATLV
Q8P774_XANCP          -------------------------------MSAFDKHQVSTFRFVRCALDAQTGVATLV
B2FSJ3_STRMK          -------------------------------MTAFDKHQVSRFRFVRCEFAAETGVAKLV
A0A0S2F8E1_9GAMM      ------------------------------MIPTQSSFKADVFRFVRCQLDAATGVAELV
G7UQU3_PSEUP          -----------------------------MSDLKFQREAVKAFRFVDCSLDLATGVARLV
Q9PEB1_XYLFA          MVLWSGCNDNDAGCASCCMETVDLSVSGVFMTATFDTSNISTFRFVRSTLDAQTGVVSLV
A0A075K015_9GAMM      ------------------------------MTTNINPRLTQVFRFVRCSY--ADGVAELV
M4NRT9_9GAMM          ------------------------------MTITVQPRLTRVFRFTRASY--ADGVAELA
H8KZP0_FRAAD          ---------------------------------MTDPRQFRRFRFVRHAY--AEGVAELV
MURL_MICS3            -------------------------------MPNEQLRRMDAFTFPSYSIDLATGEALFD
F4FED1_VERMA          -------------------------------MPNTQLARMDSFTFPSYSIDLSTGEALFD
MURL_SALTO            -------------------------------MPNEQLRRMDAFTFPSYSFDLSTGEALFD
G8SEF0_ACTS5          -------------------------------------MQFDVMRFPSSAFDETTGVATFD
M3UWL1_9ACTN          ------------------------------MGVTTEFNPADYRRLLIRECQIEGRVVSAR
A0A1H3EPM2_9ACTN      ----------------------------------MSERRGKRFTYERVELSPAAGTITSH
F8AYB5_9ACTN          --------------------------------MTASPPRGESFHYVGYDIDASRNRLVCR
D2S4M6_GEOOG          ------------------------------------MSEQDAFVVAGRSLDPATGEAAFT
G4R6Q4_PELHB          -------------------------------------MSQISFIIDAPAFDPSTGEAKFF
A0A1L9QUI5_9CYAN      -----------------------MQDLEKKHFNCQEFEDFLVDDVILENVLVKSNQIWFR
A0A1Q3GIS9_9BACT      ------------------------------MQKASLAERFRVNEASLESIKIHSNSIEYH
A0A0K2LZ08_9NOST      ---------------------------------------MKISVIKIDSLRIHEHHIEII
K9WWE4_9NOST          --------------------------------------MMKIEVIKIDELKIHEHHLDII
E0TG11_PARBH          --------------------------------MTSSPLRGARFDILGWRLDPTDDRQVLA
I0K0Y8_METFB          -----------------MLGMEYVPTKSAERNFLQLRKLFPRFVFSRFSSEIRQKTLYVE
G4ZQK1_PHYSP          -------------------------------<MQTAQQAEPFLTFESIQFDADSRLATFQ
A0A0C2LBY5_9CYAN      -------------------------MSSIFEQFKSRYHELRIQYMATGESPTCSVICSEA
                                                                                  

MURL_XANOM            YAF------DQGPELVETVAVPGAPFALGGANATAVQQALQLLHLIAGVSYFKAAVPPNI
Q8P774_XANCP          YAF------DQGPELVETVAVPGAPFVLDATRAAAVQQALRLLHLIAGVSYYKAAVPPTI
B2FSJ3_STRMK          YAF------DDGPEMVETITVPGAPFVLDEARAAAVQRALQLLHLIAGVSYYKAGVPETV
A0A0S2F8E1_9GAMM      YAF------DDGPELIETITVPGAPFALAGARATAVERALRLLHLIAGVSYYKAAVPETI
G7UQU3_PSEUP          YAF------DDGPALTETVSFPGAPLALDGARAQAVQRAVRLLHLIAGVSYYKAAVPPQV
Q9PEB1_XYLFA          YAF------DQGPEFVEKIMVPGAPFALEGPRAEAVRQALRLLHLIAGVSYYKAIVPSTV
A0A075K015_9GAMM      YAF------DHGEELIERVRFPSAP-ALPASHQAAFDQALKLLHLIAGVSYYKAGVPPRI
M4NRT9_9GAMM          YAF------DEGEELVETIRFPQAP-AVPTERRAAFDAALKLLHLVAGVSYYKAGVPPKI
H8KZP0_FRAAD          YAF------DDGEELIERITFPAAP-ALPAGREAAFAAALQLLHLIVGVSYYKAGVPEQI
MURL_MICS3            YALTGP---DGEQRFTEVITLPLPAEPPSDATVATLGRVLELLHVVAGVSYYKAAAPRRL
F4FED1_VERMA          YALTGP---DGEQRFTEVITLPVPEQSPSDAAVAALGRVLELLHVVAGVSYYKAAAPGQL
MURL_SALTO            YALTGP---DGEQRFTEVITLPLPASPPSDERVATLGRVLELLHVIAGVSYYKTAAPHRL
G8SEF0_ACTS5          YVLDGP---E-PLRFTETITLPVPAAPRD---TAALRRVLELLHVVAGVSYYKVGAPPRV
M3UWL1_9ACTN          YSLIGS---NGADDVEFAETFDFGGIDST---VAFDPRLLRLLALTAGVSYYKASAPETV
A0A1H3EPM2_9ACTN      YSLD---------DRSFSEVVQLAPEL--DWSAPALPAAARLLFLLSGVSYYKTAAPRVI
F8AYB5_9ACTN          YRLD---------GRDFREEITFPDGG--AWDEPAAAETARLIFLLAAVSYYKSAAPPVV
D2S4M6_GEOOG          YRLA---------GDEFTERLTLDPGLVAGADPARVDAALDLVHLVMGTSYYKLRAPGRV
G4R6Q4_PELHB          YRLA-------RHTLVETLRFPVEGLEAARAETAAFATLLDLSAAVLGVSYFKLLAPFEI
A0A1L9QUI5_9CYAN      YLLDG----EEVDCSVEYDSISF-EDQNLASPARVKCFAVVIAVLFSLRFSSLLPQKVDF
A0A1Q3GIS9_9BACT      YALDG----EGHRFRVSYNSVNFFQDFALSSKAELHAFAVILGIIGFARFGAVLPKRLTV
A0A0K2LZ08_9NOST      YLADK----FQFSTKIFYHDVSFSRLMEKYSQPIIQRIVSHIALFEGMKLCSLFPEYYDI
K9WWE4_9NOST          YSADK----FKFCTKVFYHDVSFSALKIKYPQKLIEGIAAHIALFEGMKLCSLFPKYYDI
E0TG11_PARBH          DFYC------DRHGHFTEGVRFPEATRPVAAAAAEAPALLTLLTIALGASYYKLAASPQL
I0K0Y8_METFB          YEFWTGKDKTEAIFFRPYLKIYGLPLEPKNNLGQYLDAFLFHIGMIELISYWKATCSPHI
G4ZQK1_PHYSP          FHFCGG-------RRFQAAMSLAGPLQGLDETSPVLRNALLHIGLCILPWFWMGYNCKYI
A0A0C2LBY5_9CYAN      PEWNSSKLIFPFLIDNWKHFYEIEFPLEFKNTEKPHPSVLIGIAMAEIYRLCEICTPEIV
                                                                                 .

MURL_XANOM            AIDSYSIDAETAALVQSVYLHGLGEFAYRNGLQLHGKIRFPVA-----------------
Q8P774_XANCP          QIEDYAIDAETAALMESVYLHGLREFAYRNGLNLHGKIHFPVT-----------------
B2FSJ3_STRMK          SIDSYSIDADTAALVETIYLNGLGEFAYRNGLNLRGRFRLPVQ-----------------
A0A0S2F8E1_9GAMM      RIDSYAIDADTAALLELIYVNGLGEFAYRNGLNLHGKIRFPVD-----------------
G7UQU3_PSEUP          VIEGDPIDPETAALLETVYRHGLGEFAYRNGLDLHGRIRFPCSESPPRLRERGRGQGEGD
Q9PEB1_XYLFA          TMDDDSIDAETAALVEEVYLYGLSEFAYRNGLNLHGRFQLPVQ-----------------
A0A075K015_9GAMM      DVAGGPLDDATADLLDALYLHGLAEFAYRNGLDLRGRITFPRL-----------------
M4NRT9_9GAMM          ELADGPLDDGTAELLDQLYLHGLAEFAYRNGLDLRGRIAFPRL-----------------
H8KZP0_FRAAD          VVEGELPDQDTAELLDDLYLHGLAEFAYRNGLDLRGRIRFPHN-----------------
MURL_MICS3            VLP-APLGEAAAALVTAVYTKGLAEYAYRNQLPHVLELTPEIPA----------------
F4FED1_VERMA          VLP-APLGPAAAEFVTAVYTKGLAEYAYRNQLPYVLELTPQIPQ----------------
MURL_SALTO            VLP-APLGPSAVALVTAVYTKGLAEYAYRNALPHVLRLRPEVPS----------------
G8SEF0_ACTS5          VAP-RPVAPAVATWFTRVYTDGLAEYAYRNRLPHVLELTVETP-----------------
M3UWL1_9ACTN          SID-FPITESEAAYVAAVIRGGLGEFAFENQLPDALTPMLDYRL----------------
A0A1H3EPM2_9ACTN      DLGSTSVSPSDVAFLREFYLEGLGEFSYVNDLPLGDLEIVGGDV----------------
F8AYB5_9ACTN          DLGDTAVTDTERAFLREFYLDGLGEFAYRNNLDLSGLRIVGPRL----------------
D2S4M6_GEOOG          VV-ERPVTKAQAAVAEAAYTHGLGEFAAVNRLPVPHEVAFDLEL----------------
G4R6Q4_PELHB          DATALALSKAQRAFLLDVYENGLGEFYARNDLKRFGRLTISVGAP---------------
A0A1L9QUI5_9CYAN      SKYSQFIDQELLNFLQTTIPKCWSETRYQVGKLVYQSPEIKVNESLLGQEV---------
A0A1Q3GIS9_9BACT      NEFSEYVPGFVYQFLQEVLPGVWSEHRYQLEMTDFKHPAWKKGDN-MYTPS---------
A0A0K2LZ08_9NOST      SVIAEYLELPILDLFLTIYQGVFGQHWYENNITNYQQPEIIYSQ-NLGVSQ---------
K9WWE4_9NOST          SVIAEHLEKPVLDLFGKIYQGVFAQHWYENNVSDYQQPEIIYSQVSLEKSN---------
E0TG11_PARBH          SLP--PGGPAASRLAAALYGEGLAEFRVRAGLPFPDDLTLVEDTG---------------
I0K0Y8_METFB          LIETAFLSLEQLNWWSKLYWKGLGEFFFQNGIEKAADELMQIECR---------------
G4ZQK1_PHYSP          RIEAGYLNPEQVHFWEEFYQNVLSEFLYLHGLDRDRLYIIVDAPA---------------
A0A0C2LBY5_9CYAN      QVCWYSCLAWESDWWNEDIYWYLQQKFYLEKWGWDKMPRIEFSQS---------------
                                              :                                   

MURL_XANOM            -------------------------AQAAA-AAPALGLRVHALVAIGGGKDSLVSIEALR
Q8P774_XANCP          -------------------------APAAD-QAPAAGLREHALVAIGGGKDSLVSIEALR
B2FSJ3_STRMK          -------------------------GEAV--QAPSLGLQPHALVAIGGGKDSLVSIEALR
A0A0S2F8E1_9GAMM      -------------------------AAAADTKASPLGLKPHALVAIGGGKDSLVSIEALR
G7UQU3_PSEUP          ASQSIIASNPLTPSVASRDFERSPASEGAGAGAPALGLAAHALVAIGGGKDSLVSIEALR
Q9PEB1_XYLFA          -------------------------ATGATAPAPQLGLREHALVAIGGGKDSLVSIEALR
A0A075K015_9GAMM      ----------------GAESKASPRGGAKLPDAKALGLPHRTLVPIGGGKDSLVAVEAIK
M4NRT9_9GAMM          ----------------GAGTGTERSRGGSAPAVGALDLPKRTLVPIGGGKDSLVAVEAIK
H8KZP0_FRAAD          ----------------GRRAAVPP----------ALGLASRTLVPLGGGKDSLVSVEAIR
MURL_MICS3            -----------------------GSVPPAREYD---NSDLRPLSAVGGGKDSIVSLEALR
F4FED1_VERMA          -----------------------GRVRPAAEYD---NSDRRPLSAVGGGKDSIVSLEALR
MURL_SALTO            -----------------------GEVTPPVGYD---TDGRRPLSAVGGGKDSIVSLEALR
G8SEF0_ACTS5          -----------------------GTLPAAAPVE---AGG-RPLSAVGGGKDSIVTLEILR
M3UWL1_9ACTN          -----------------------GGDVEIAAAESAWTLDAEPLVAVGGGKDSVVSIEALK
A0A1H3EPM2_9ACTN      ---------------------------ADRDPGPVADGPERALIPFGGGIDSVVVVEKTK
F8AYB5_9ACTN          ---------------------------ERTAPVAFSPRGGRPLVPFGGGVDSIVTAELLR
D2S4M6_GEOOG          ---------------------------TDDLPAPAEGGGREALLPVGGGKDSALALVVVT
G4R6Q4_PELHB          -----------------------------REDDVPPTLPDRALVLIGGGKDSLVSVQLLE
A0A1L9QUI5_9CYAN      ------------------------HYPIFNLKTEQNT--VDAIIGSGSGKDSLLCSLILQ
A0A1Q3GIS9_9BACT      ------------------------TFPLFAQDSMLPTDGQKVLLTSGAGKDSLLCAQLLE
A0A0K2LZ08_9NOST      ------------------------PTYILGDNH-------TILAGCGGGKDSILALKMLE
K9WWE4_9NOST          ------------------------PFPILGDNS-------TILAGCGGGKDSILAMKMLQ
E0TG11_PARBH          -----------------------PRPPQIAAPSKDQRARSSALVAFGGGKDSYVARRLMA
I0K0Y8_METFB          --------------------------SQRQFPAVEFPFLEGNVLPIGGGKDSFLTLEWLK
G4ZQK1_PHYSP          ----------------------SEALPVLPDRKLEEQSKAKVLVPLGGGKDSLVVYQLLS
A0A0C2LBY5_9CYAN      --------------------------GIEIENDWLPSVNDTYLLAVSGGKESTFGFEWMQ
                                                                :   ..* :* .      

MURL_XANOM            HAGVDQTVSWIGG-----------SQLIRACAERTGLPVLNIGRVLAPELFELNRQ----
Q8P774_XANCP          QAGVDQTVSWIGG-----------SQLIRACAERTGLPVLNIGRVLAPELFELNRQ----
B2FSJ3_STRMK          RAGVDETVTWIGG-----------SQLIRACAERTSLPTLNLGRTLAPELFELNRQ----
A0A0S2F8E1_9GAMM      TLGVEQTVTWIGG-----------SQLIAACAQRTDLPTLNLGRALAPQLFELNRQ----
G7UQU3_PSEUP          RAGVAQTVSWIGS-----------SQLIAACAARTGLPTLNIGRAIAPELFELNRQ----
Q9PEB1_XYLFA          VAGMQQTVVWIGA-----------SQLIRVCAERSELPMLNVGRTLAPELFALNRQ----
A0A075K015_9GAMM      SIGGDATAVWVGN-----------SPLIAACAERTGLPMLNIQRELAPGLFELNRL----
M4NRT9_9GAMM          AISGEATAVWVGN-----------SALIAACAERTGLPTLNIQRELAPGLFELNRL----
H8KZP0_FRAAD          QIGVEASVVWVSH-----------SPLIEACAERTGLPQLHLQRELAPGLFELNRL----
MURL_MICS3            RAGLDPVPFSVNP-----------NHVIVAVNEASGLAPLAARRRIDPVLFDLNAA----
F4FED1_VERMA          RAGLDPVPFSVNP-----------NHVIKAVNAASGLTALAARRRLDPVLFELNAA----
MURL_SALTO            RDGLDPLPFSVNP-----------NRVIEAVNVASGLPALAARRRIDPVLFDLNAA----
G8SEF0_ACTS5          AAGLDPVPFSVNP-----------NPVIENVNAASGLPALAARRRLDPRLFELNRA----
M3UWL1_9ACTN          AAGRTPTLFSVNR-----------YQPIEDCIAVSGLSSVHVLRKIDRTLIELNGA----
A0A1H3EPM2_9ACTN      RRVPDSSLFIAGR-----------YDPIEASAALTGLPIVRASRRLDPQVLKSADN----
F8AYB5_9ACTN          PLAKDPALFVVNRPGD-------RFDAIERPARVTGFPVVRAERLIDSQLLRSAEL----
D2S4M6_GEOOG          PAT---ALAVNPT------------DAQRDVTRAAGVRLIGVRRRLDPLLGERTRA----
G4R6Q4_PELHB          SAGAQMSLFAVNP-----------KGPILSSAERSGLPLLTVERVLDPEMIALGQKP---
A0A1L9QUI5_9CYAN      KADINYDILTCLYNSY-------GNIEEQKELFTQASEHLNYRKQHYIYFQDSYYPWLKQ
A0A1Q3GIS9_9BACT      QAHIEYDLVTLFFSLY-------GQFDQQKQMFRSVIGQNQQVRLHQVYFEDEYYQWLEE
A0A0K2LZ08_9NOST      VGGIPFASMQYSHSIY-------GKANFQHDLISQVLKSVKPVHKHQISIYDDFTEFPFL
K9WWE4_9NOST          EVDIPFASMQYSHSVY-------GKADIQHNLISGVLEHVKPVKNHKISIYDDFIDFPFL
E0TG11_PARBH          KHGVPCRLASVVLS----------PAVRDVLIATAPTAPIFIWRRLDPRLSARTPL----
I0K0Y8_METFB          EQKEKNLCFLLNPVQS-------QWDTLEYFGYPQNQ-IVVVERKIDDQLLELNKK----
G4ZQK1_PHYSP          SSDTPCAWLHVGDRPEEFERSWRFKEIVEMTQNRTGGTAFRFEHNMDDKTWEREVGGT--
A0A0C2LBY5_9CYAN      QANLPMEAFTLHH-----------AGGILGNNWQEKFPVFDDIRNRTRLWEILTHPREDP
                                                                 :                

MURL_XANOM            ------------------GAWNGHIPVTAVNSAILVLAALLNGVDQVVFSNERSASYGSQ
Q8P774_XANCP          ------------------GAWNGHIPVTAVNSAILVLSALLTGVDQVVFSNERSASYGSE
B2FSJ3_STRMK          ------------------GAWNGHIPVTVVNSAIMVLAALLHGVDQVVFSNERSASYGSQ
A0A0S2F8E1_9GAMM      ------------------GAYNGHIPVTVVNSAIMVLAALLHGVDQVVFSNERSASYGSL
G7UQU3_PSEUP          ------------------GAYNGHIPVTAINSAILVVAALLRGVDQVVFSNERSASYGSM
Q9PEB1_XYLFA          ------------------GAWNGHIPVTAINSAILVLVALLHGVDQVVFSNERSASYGSV
A0A075K015_9GAMM      ------------------GAWNGHIPVTAVNSAILAVAAILYGFDSIAFANERSASAATL
M4NRT9_9GAMM          ------------------GAWNGHIPVTAVNSAILAVAAILYGYDSITFANERSASAATL
H8KZP0_FRAAD          ------------------GGWNGHVPVTAINSAILLLAALIYDYDTIAFSNERSASAATL
MURL_MICS3            ------------------GARNGHIPVTAINSLIAVATAVLNRLGPVVMSNERSASDPNL
F4FED1_VERMA          ------------------GARNGHIPVTAINSLIAVATAVLHGLGPVVMSNERSASDPNL
MURL_SALTO            ------------------GALNGHIPVTAINSLIAVATSVLNGLGPVVMSNERSASDPNL
G8SEF0_ACTS5          ------------------GALNGHIPVTAINSLIAIATAVWHGLGPVVMSNERSASDPNL
M3UWL1_9ACTN          ------------------GAYNGHIPVTAINSVIALIAADVAGLGSVVMSNEQSADIENL
A0A1H3EPM2_9ACTN      ------------------GFFNGHVPVTGILSAIAVTAAVLDGRTSVVMSNEWSASSATV
F8AYB5_9ACTN          ------------------GFLNGHVPVTGILSAIALLAAVLDGRDAVVMSNEWSASVGTV
D2S4M6_GEOOG          ------------------GGLNGHVPVTAINSAISTLVAVLGGFDPVVFANERSADEETL
G4R6Q4_PELHB          ------------------GYYNGHVPSTAINSMIAALAGLLYGYGNIVLSNERSASEGNV
A0A1L9QUI5_9CYAN      RVNRYNIVDRTQKYFDYKKPFHNIAAENVILPFVVAPIQAMHKIPMLLVGNEKSADAHNL
A0A1Q3GIS9_9BACT      RLTQWSIREIFPD-----KPFRVEAGETLISSLAYVPVQLAHRCSVQAWGNEKSADLPNL
A0A0K2LZ08_9NOST      KLYFPENSG-------------ITAPETPVSIFESLILMLDQGYNYLCLAHEKSANTGNL
K9WWE4_9NOST          QLYFPENSG-------------ITVPETPVSIFESLFIMLDGGYHYLSLAHEKSANTGNL
E0TG11_PARBH          -------------------GFNGHIPITAINALCLALQAVLDGNREVIFANERSADEPTM
I0K0Y8_METFB          ------------------GFLNGHTPFSALLAFIGVLLMAIHKRKYFITSHESSASEPTI
G4ZQK1_PHYSP          ------------------RYQPAGHPWAALVAFDSVLAAILGDFTHVAVGNERSANYGNN
A0A0C2LBY5_9CYAN      -------------AEHFRYKGVRNDPTITNALFIMMVIAAQQGHRFLVLANDKSSNESNA
                                                                       .:: *:.  . 

MURL_XANOM            IPG--TGEVNHQWSKGWAFEQAFGDYVQRHVAADLRYYSLLRPLSELAVARQFAKT-DRY
Q8P774_XANCP          IPG--TGEVNHQWSKGWAFEQAFGEYVQQHVAADLRYYSLLRPLSELAVARQFAKT-DHY
B2FSJ3_STRMK          IPG--TGEVNHQWSKGWACEQAFGSHVQKYVAADLQYYSLLRPMSELAVARQFAKS-DFY
A0A0S2F8E1_9GAMM      IEG--TGEVNHQWSKGWACEQAFGDYVQHQVAADLHYYSLLRPLSELAVARQFART-DRY
G7UQU3_PSEUP          IPG--TGEVNHQWSKGWAFESLFGAHVQRHVAADLHYYSLLRPFSELAVARQFART-DHY
Q9PEB1_XYLFA          IPG--TGEVNHQWSKSWAFEQHFSDYVQRRVAADLRYYSLLRPLSELAVARQFAHC-ARY
A0A075K015_9GAMM      EYE--GQQVNHQWSKGYAFEQLLSDWLHQHVAADLNYCSLLRPYSELAVTRAFSRL-TSY
M4NRT9_9GAMM          EYD--GQQVNHQWSKSLAFETLLGDWLHTHVAADLDYCSLLRPYSELAITRAFAKL-TPY
H8KZP0_FRAAD          EYE--GQAVNHQWSKGYAFEQGLQQWVRQHLAADLSYCSLLRPYAELAVTRAFARLGSAY
MURL_MICS3            VWN--GHEINHQWSKGVEAEGLLRAALAEHAGLTEPYFSLLRSLSELHIARLFAQI-DRY
F4FED1_VERMA          IWN--GHEINHQWSKGVAAEGLLRAALAEHAGLTEPYFSLLRPLSELHIARLFATI-DRY
MURL_SALTO            IWD--GHQINHQWSKGVEAEGLLRGALEEHAGLTDPYFSLLRQLSELHIARTFARI-GGY
G8SEF0_ACTS5          IWN--GHEVNHQWSKGVLAEGLLRDAVTAHTGLVDPYFSLLRTLSELHIAQLFAGH-TAY
M3UWL1_9ACTN          SWH--GFEINHQWSKSREYENLLRSMLADYGMDPARYFSLLRGLPESDIADLFRGC-TAY
A0A1H3EPM2_9ACTN      EVA--GQGINHQYSKSYAFEAGFRRMLAGAVPG-VNYFSALRPWSELWVAERFATL-PQY
F8AYB5_9ACTN          EVD--GRSVNHQYSKSEGFENSLRSVLAETLAGGPDYFSLLRPFTELWIARRFAAL-PQY
D2S4M6_GEOOG          TIN--GARVNHQYSKSYEFERLFAAAGAEVGVG---YFSLTRQLSELATVAAVADL-PDL
G4R6Q4_PELHB          EFD--GRQANHQYSKSIDFERAIRDVLSTATSGALGYFSLLRPYSEARIAALFARS-NRY
A0A1L9QUI5_9CYAN      IDKYSGEAVAHQWVKSLEATKKTQDQM-AGMFNNINHASLIKAIHDVKIFELVFKLADQL
A0A1Q3GIS9_9BACT      VLPDTGEPIAHQWSKSLEAEQLINDFL-AKMFVDAHRSSLIKPLHDVRIFKTLFEISGNL
A0A0K2LZ08_9NOST      FWDEIGKEVNHQWGKGLAAEQILDQFIQEHLFTNFKYFSILQPIYDFRIFYNFSKYPEFI
K9WWE4_9NOST          FWEELGLEVNHQWGKSFVAEQILDQFIRENLLSNFQYFSLLQPIYDFRIFKNFSKYPEVL
E0TG11_PARBH          VLED-GITANHQYSKSSAFELILQEAIAEAGAAAPAVFSILRPYSELWIGRAFAAE-TEA
I0K0Y8_METFB          PSK----GINHQYSKSYEFEKDFQNYLTDFLCPSFCYFSFLRPLNEIQIARHVSAI-PKS
G4ZQK1_PHYSP          IVHE-GILVNHQYDKSFDFETRAHAYIRKYLVEDLHYFSALQHLWEVQIARTFASRSLES
A0A0C2LBY5_9CYAN      TYE--GREVNHQSAKGTAYIERFNSFLERKGLP-FRYVSICEEVYSIATVHQLSLWDKSL
                                **  *.                      *  .   .      .       

MURL_XANOM            DAHFSSCNRNFHIMG--ERPVHRWCGVCPKCHFVFLALAPFMPKTRLVNIFGR-NLLDDA
Q8P774_XANCP          DAHFSSCNRNFHIMG--ERPVHRWCGVCPKCHFVFLALAPFMPKTRLVKIFGR-NLLDDA
B2FSJ3_STRMK          DAHFSSCNRNFHILG--ERPVNRWCGVCPKCHFVFLALAPFMPKTRLVRIFGR-NLLDDA
A0A0S2F8E1_9GAMM      DTHFSSCNRNFHILG--ERPASRWCGVCPKCHFVFLALAPFMPKPRLVGIFGR-NLLDDA
G7UQU3_PSEUP          DAHFSSCNRNFHILG--ERPVNRWCGVCPKCHFVFLALAPFMPKPRLLNIFGR-NLLDDV
Q9PEB1_XYLFA          DAYFSSCNRNFHLLG--ERPAHRWCGQCPKCHFVFLALAPFMPKTRLVGIFGR-NLLDDA
A0A075K015_9GAMM      FDVFSSCNRNFKILG--PKPADRWCGQCPKCHFVFLALAPFLAKPRLLSIFGR-NLLDDE
M4NRT9_9GAMM          FDVFSSCNRNFKLLG--PKPVDRWCGQCPKCHFVFLALAPFLPKPRLLAIFGR-NLLDDE
H8KZP0_FRAAD          FDVFSSCNRNFRILG--PRPADRWCGQCPKCHFVFLALAPFMPKPRLLAIFGR-NLLDDE
MURL_MICS3            DDVVTSCNAAFKLRD--AS--ERWCRDCPKCRFVFLAMAPFMPRERVVHIFGG-DLLADE
F4FED1_VERMA          DDVVTSCNAAFKLRD--AS--ERWCRDCPKCRFVFLALAPFMSRQRITHIFGG-DLLADA
MURL_SALTO            DDVVTSCNAAFKLRG--AS--DRWCRDCPKCRFVFLALAPFMPRERITRVFGG-DLLADP
G8SEF0_ACTS5          DDVVTSCNKAFKLHD--PT--ARWCGDCPKCRFVFLAMAPHMPRERLAHIFGH-DLFADA
M3UWL1_9ACTN          FDVFVSCNRSFALDE--SRRRSRWCGECPKCLFVFVLLAPRIGRDRLCAIFAQ-NVLDND
A0A1H3EPM2_9ACTN      HPVFRSCNRAFHVDP--ARRAANWCGECDKCTFIDLILAPFLSPEQLRSVFGGVEPLDRP
F8AYB5_9ACTN          FDHFRSCNRAFHIDP--AQRLDRWCGRCDKCCFIDLVLAPFMAEPALRRVFDGREPLADV
D2S4M6_GEOOG          RGEILSCNRSYTQAHMGGEATQRWCLHCDKCLFTFLCFAVFLTPEEARAMFGG-DPLADP
G4R6Q4_PELHB          DDVFSSCNRNFRLAG---HDGPLWCGKCPKCHFVFLIFGPHMSKERLTKIFGQ-NVLDNP
A0A1L9QUI5_9CYAN      PYATNSCNIQ-----------KPWCCRCEKCCYVFAGFCAYGDREKVIKAFGK-DLFVME
A0A1Q3GIS9_9BACT      PYATNSCNIA-----------KPWCGHCEKCAYVFLGFATYGNYDKTIEAFGQ-NLLDKV
A0A0K2LZ08_9NOST      P-NIHSCNVQ-----------KPWCRKCPKCAYVWLGLMAFSQQSIVDEVFKK-NLFDDV
K9WWE4_9NOST          P-KIHSCNIQ-----------KPWCKKCPKCAYVWVGLMAFFQPDIVDAVFEV-NLFNDE
E0TG11_PARBH          FPRFTSCNRNFRMAG---DATQRWCGACPKCAFTSLILAPFLSETENRIAFGR-QFLDLD
I0K0Y8_METFB          VRIFQSCNRNRSSGG--------WCGHCPKCLFVFLILRPFVPQKELEVIFGS-DLLENE
G4ZQK1_PHYSP          SENFLPVFLSCNEAP----DGDKWCCKCAKCAFVFILMSAWCSEAQLVEIFGE-NLFEKQ
A0A0C2LBY5_9CYAN      LNVLTSCNEAQWAPG-----SCRWCCQCPKCAFSYALIEAATDYRFAVQVVGK-DLFSLS
                           .                 **  * ** :    :            .   : :   

MURL_XANOM            TQAGGYDALLEF-QDHKPFECVGEGRESRTAMAVLASRAEWKEDAVVKRFIRDIQPQLDP
Q8P774_XANCP          AQAGGYDALLEF-QDHKPFECVGEGRESRAAMAVLATRAEWKEDALVKRFIREIQPQLEQ
B2FSJ3_STRMK          EQAGGFDALLEF-QDHKPFECVGEGRESRAAMATLAQRPEWKEDVLVKRFCNEIQPQLDA
A0A0S2F8E1_9GAMM      AQTDGFDALLEY-RNHKPFECVGEGRESRAAMAALAERPEWREDTLVERFAREIRPQLGG
G7UQU3_PSEUP          AQTAGFDALLEY-QDHKPFECVGEGREARAAMATLGQRPEWREDALVARFNREIGPQLDA
Q9PEB1_XYLFA          SQASGFDALLEW-QDYKPFECVGEARESRTALAVLATRAEWKEDALVMRFMREIQPHLDP
A0A075K015_9GAMM      NLAPGFDALLEY-QDHKPFECVGEGAEARAAMVALSQRSEWQEDSLVARFISEILPQLDV
M4NRT9_9GAMM          NQAAGFDALLEY-QDHKPFECVGEGAEARAAMYALSQRPEWQEDALVERFRSEILPQLDA
H8KZP0_FRAAD          SQTAGFDALLEY-HDHKPFECVGEGGEARAAMHALGQRPEWREDALVARFVSEILPQLDP
MURL_MICS3            TQIPGYRELLGV-DGHKPFECVGEVEESVVALSLLAEQDQWRDAPVVRALVDAVPETAWS
F4FED1_VERMA          TQIPGYRELLGI-DGHKPFECVGEVEESVVALSLLAQQPEWRDTPVVTALVAALPDTAWE
MURL_SALTO            AQLPGYRELLGV-DGHKPFECVGEVEESVVALSLLGEQSGWRDAPVVSALIDAVPETAWK
G8SEF0_ACTS5          AQTPGFLELLGI-DAHKPFECVGEAEECLVALSLLTD-----DAPVLVALRAAVPPSAWD
M3UWL1_9ACTN          QNTELFLELAGL-TAHKPFECVGDYSEVAEAFVDLMDDSEWSDDAVVRRMADDRTRLMAS
A0A1H3EPM2_9ACTN      ELAGQFRALLGDTAQNKPFECVGDVGECKAAVLLAAERPDRAGSPLLSALRSEVL--ADG
F8AYB5_9ACTN          TLLGRFRTLLGLSADNKPWECVGDVTECRAATALAAPRHDRAGSAVLAALGPLP------
D2S4M6_GEOOG          SLADGFRRLW---ATEKPFDCVGERAESAAAMAHLARSTAWGDHAVVRALGAEAASFAAV
G4R6Q4_PELHB          DNIDPYRELTGL-SGHKPWECVGEILEAAACLWRIADNPDWRDSAVVKALKPDLEAFYGP
A0A1L9QUI5_9CYAN      ENLHIWSELLGL-KGYIPWECVGMPEENQLYFYKLYQQGVRNQAITLFENEILIPLQNRG
A0A1Q3GIS9_9BACT      ELLPIWEELLGL-KEYISWECVGSAEEAQIYFYKMYKKGIDSKATQLFEHQILQPMRDQG
A0A0K2LZ08_9NOST      DLLPTFREMVGL-SEHTPFECIGEIEESRLLMKRCLERDLSGKALDMFTEEILSDTT---
K9WWE4_9NOST          DLLTTFRQMVGL-TKHTPFECIGEIDESRLMIKKCLEKGLSGKALDMFAQEILPDPA---
E0TG11_PARBH          ALQPFYAQLLGL-SDHKPWECVGTIAECRAALGLAARREDLSRTMAVQHFAPRLTGLQDP
I0K0Y8_METFB          SLFGLLLSLCGE-GTHRPFECVGSEEETKAAASLLWYQARKSKEHPPLLIRKLIESYPEF
G4ZQK1_PHYSP          SIFSDFLSLLDE-EGVKPMECVGTACETWLSLYLALRVHGESTFLKAHEEEIRRK-----
A0A0C2LBY5_9CYAN      TLEEVWRRLFDP-TTEKPFECVGEKRETLMALAKCKERRLKNDQPLGVLAHIPNIEFDES
                              :        . :*:*   *                                 

MURL_XANOM            ----------NDLQVEPLMAIEGEHRIPPALWERVRANFAV------
Q8P774_XANCP          ----------DALQLQPLMTIDGEHRVPSALWERVRANFAA------
B2FSJ3_STRMK          ----------AELELAPLLQLQGEHRVPAALWERVREDFEA------
A0A0S2F8E1_9GAMM      ----------DDLRIEPLLVLDDEQRLPPALWERLRAHFAA------
G7UQU3_PSEUP          ----------DELQIGPLLQPEGEHRVPPALWNMLRANFAA------
Q9PEB1_XYLFA          ----------AQLQLDPLLTLSDEHRIPASLWESMSAHFRT------
A0A075K015_9GAMM      ----------TELAIEPWLQPSDEQRIPERLLPALAFFA--------
M4NRT9_9GAMM          ----------TQLALEPWLEPSPEHRVPARLQAALAAIG--------
H8KZP0_FRAAD          ----------AGLAMEPWLQASSEHQLPARLLPALAVIQGPC-----
MURL_MICS3            ----------AAATSDVFTP-GGPHHIPPPYAKALAQ----------
F4FED1_VERMA          ----------TAATSDTFTPSGGPSYVPPTYAKALNSLTA-------
MURL_SALTO            ----------TAATSAVFTP-GGPSFTPTRYADALGSLTEPARNLPG
G8SEF0_ACTS5          ----------DVSHSNVFTP-GGEHHIPPAYLKILTAAL--------
M3UWL1_9ACTN          ----------AANRVPVAES----ENIPAPYAGVLGALVSR------
A0A1H3EPM2_9ACTN      ----------DAPSAPSLMHPLGEHFIEQPYAADDLLV---------
F8AYB5_9ACTN          ----------EEPALEELLVPHGRHFVPDRYAPDDLLV---------
D2S4M6_GEOOG          ----------TGATVEGFLPPRGDHSVPDRYLASLQRVLAEARPPVA
G4R6Q4_PELHB          AR--------LHSAYEEFMTDSTDHLIPEHIESAVAPYAH-------
A0A1L9QUI5_9CYAN      NS---VEDYFQQIQNQFGQVDENHHTMPEWLWNKIRPVLE-------
A0A1Q3GIS9_9BACT      MNKGQIHLHFKLLEQRYLKVHSQHHTLPQWIMNRIRY----------
A0A0K2LZ08_9NOST      -------INWQKIEEKYNYVYATEHAIPDWIFEKIKDQL--------
K9WWE4_9NOST          -------INWQKLEAKYDRVYQTEHSIPNWLFTQIEGNL--------
E0TG11_PARBH          AE--------LDALVDACLRPVASPTLPRTYRPTAEGGAL-------
I0K0Y8_METFB          LL-------TMETLQALYDQTDREHRLPQKFLSILNEKCKIKVLFND
G4ZQK1_PHYSP          ----------GAELMHLLDDYNSEHLLPQFLEPTLRQPIMALEA---
A0A0C2LBY5_9CYAN      LLMISAPKNIPKQHAQKLNSVLSDSRTINLLNELGDTHP--------