CLUSTAL format seed alignment for MF_02211

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MPAA_ECO57            --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRE
MPAA_ECOLI            --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRE
B2U0L9_SHIB3          MIIRKICTTLPVILPEPETIMTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRE
E2XH82_SHIDY          --------------------MTVTRPRAERGAFPPGTEHYGRSLLGEPLIWFPAPTASHE
B7LRX2_ESCF3          ---------------MVETMMTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAANSE
B5RA02_SALG2          --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAANRE
Q8ZP67_SALTY          --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAVNRE
A8AGC4_CITK8          --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAADRE
D2TK92_CITRI          --------------------MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAADRE
L0M6G7_ENTBF          --------------------MSATRPRALRGAFPPGTQHYGRSLLGAPLIWFPAPLADHT
A6T820_KLEP7          --------------------MSISRPRPQRGDFPPGTRQYGSSELGAPLLWFPAPQADSR
H5V5A8_ATLHE          --------------------MTTLRPRSQRGHFPPGAERYGKSVFGAPLLWFPAPEASEN
K8D8Z7_CROSK          -----------------MNTLTPLRPRARRGALPDDARRYGESALGAPLLWFPAPEAQHA
I2B974_SHIBC          --------------------MTTQRPRPLRGLLPASPRPYGKSVLGAPLLWFPAPRRSPH
H3RD33_PANSE          --------------------MPSMHPRSQRGKLAISWQQYGRSVLGAPLLWFPANQTDSN
D4GF62_PANAM          --------------------MSSIHPRPLRGKLAISWQQYGRSVLGAPLLWFPAVQADGD
E6WDP5_PANSA          --------------------MSSLHPRPLRGKLDAVWQQYGQSVLGAPLLWFPAPAADAD
D8MSL6_ERWBE          --------------------MSPIHPRPLRGKLDAVSKVYGASVLGAPLLWFPAPAADED
A0A071MBN5_9ENTR      --------------------MPLSRARQFRGNFQTPAQQYGASVGGAQLLWYPATEMQPS
A0A2I5TJY6_SERS3      ----------------MTQHALPYRDRQSRGFFSTSSEPYGHSRLGAPLLYFPAEIQHSG
E0SFX3_DICD3          ----------------MTDAEFLHRPRTERGFFTSPGQEYGRSRLGAPLLWFPAEVEGKH
Q6D5Q0_PECAS          ----------------MENTIIPLQARQQRGNLPSLGEPYGKSLLGAPLLYFPAELAPSE
A1JNE3_YERE8          --------------------MSQYRPRSTRGNLVTLGQHYGTSLLGAPLIYFAAANPSAQ
A0A0T9LGC7_9GAMM      --------------------MTQLRPRPLRGHLPPLGKLYGSSFLGAPLLYFPAQTPAAD
A0A097R201_HAFAL      ----------------MGNGVKQIRPRSERGQISATAVTYGHSLLGAPLLYFPAVQPDRD
A0A143HL97_9GAMM      --------------------MSALRPRSDRGHFCHPHTQYGATELGAPLFYFPAQSGDK-
A0A1R4B6F5_9VIBR      --MINLVYQRDATIESEGKDMTQCITRSQRGQFSMLPIQYGTSSLGAPLYYFPAQCQAEN
A0A2T5EKM7_VIBSP      ---------------------MSLIPRTERAAFSIKPLSYGKSVLGAPLLYFPAQIESES
B7VT71_VIBA3          ---------------------MSLIPRTERAAFSIKPLSYGKSVLGAPLLYFPAQIESES
A0A4R3P2P0_9VIBR      ---------------------MSLIPRTERAAFSIKPLPYGKSVLGAPLLYFPAQVESES
Q87FD9_VIBPA          ---------------------MSLIPRTERATFLIRPTTYGHSVLGAPLLYFPAQVESAS
MPAA_VIBCB            ---------MNRYYSNNQEITVSLIPRTERAAFLITPTSYGKSVLGAPLLYFPAQVESNS
A0A2N7D0S8_9VIBR      ----MHKPFKPHKLTKTDDSIEGHVPRQERAQFLIQPDIFGRSVFNAPLLFFPAQVDSND
                                                *  *. :      :* :  .  * ::.*      

MPAA_ECO57            SGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRN
MPAA_ECOLI            SGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRN
B2U0L9_SHIB3          SGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRN
E2XH82_SHIDY          SGLILAGTHGDENSSIVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRN
B7LRX2_ESCF3          SGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLNVNPDGSQLGLRANANGVDLNRN
B5RA02_SALG2          SGLILAGTHGDETSSVVTLSCELRTLNPTLRRHHVVLAVNPDGCQLGLRANANGVDLNRN
Q8ZP67_SALTY          SGLILAGTHGDETSSVVTLSCALRTLNPTLRRHHVVLAVNPDGCQLGLRANANGIDLNRN
A8AGC4_CITK8          SGLILAGTHGDENASVVTLSCALRTLNPSLRRHHVVLAVNPDGCQLGLRANANGVDLNRN
D2TK92_CITRI          SGLIIAGTHGDENSSVVTLSCALRTLTPSLRCHHAILAVNPDGCQLGLRANANGVDLNRN
L0M6G7_ENTBF          SGLIIAGTHGDENSSIVTLSCALRTLSPELRRHHVVLTVNPDGCQLGLRANANGVDLNRN
A6T820_KLEP7          SGLIIAGTHGDENSSIVTLSCALRTLKPELRRHHVVLTVNPDGCQLGLRANARGVDLNRN
H5V5A8_ATLHE          AGLILAGTHGDENAAMVTLSCALRTLEPQHRQHHVVLAVNPDGCQLGLRANAHGVDLNRN
K8D8Z7_CROSK          PGLIIAGTHGDENAALVTLSCALRTLEPAHRRHHVVLAVNPDGCQLGLRANARGVDLNRN
I2B974_SHIBC          TGLIIAATHGDENAACVTLSCALRTLEAELRRHHVLLAVNPDGCQLGLRANARGVDLNRN
H3RD33_PANSE          SGLILAGTHGDENAAIATLSAALRTLPDGLRRHHVVLAVNPDGCQLGLRANANGVDLNRN
D4GF62_PANAM          SGLILAGTHGDENAAIAALSAALRTLPEAQRRHHVVLAMNPDGCQLGLRANANGVDLNRN
E6WDP5_PANSA          SGLIIAGTHGDENAAVATLSGAMRTLPDALRRHHVILAVNPDGCQLGLRANARGVDLNRN
D8MSL6_ERWBE          SGLILAGTHGDETAAVVTLSCAMRTLLEPHRRHHVVLAVNPDGCQLGLRANSRGVDLNRN
A0A071MBN5_9ENTR      AGLIMAGTHGDETASVITLSCALRTLEETHRRHHVILCVNPDGCQSGLRANLRGVDLNRN
A0A2I5TJY6_SERS3      SGLIIAGTHGDETASTIALSCAMRSLAPGHRHHHVILAVNPDGCQLGIRSNANGVDINRN
E0SFX3_DICD3          SGLILAGTHGDETASVVALSCALRTLAPGSRAHHVVLAVNPDGCQLGLRANAGGVDLNRN
Q6D5Q0_PECAS          SGLIIAGTHGDETAAVVALSCALRTLFSGQRRHHVVLAVNPDGCQLGLRANANGVDLNRN
A1JNE3_YERE8          TGLIIAGTHGDESAAIVALSCALRSISPEQQRHHVILAVNPDGCQLGLRANANGVDLNRN
A0A0T9LGC7_9GAMM      TGLIIAGTHGDETAAVITLSCALRSISTEQLRHHVILAVNPDGCQLGLRANANGVDLNRN
A0A097R201_HAFAL      TGLIIAGTHGDETTAVIALSCALRSLQPMQQRHHVILAVNPDGCQLGLRANSAGVDLNRN
A0A143HL97_9GAMM      HGIVMAGTHGDEVAAVVALSCALRALPPSALRHHVILAVNPDGCQLGLRANARGVDLNRN
A0A1R4B6F5_9VIBR      AGLLFAGMHGDETASISLLSAGLRTIAHARLRHHVIVSANPDGNQLGLRSNANGVDLNRN
A0A2T5EKM7_VIBSP      RGLILAGTHGDETASIAGLSCALRSLPAANLRHDVILSMNPDGNQLGTRANANQVDLNRA
B7VT71_VIBA3          RGLILAGTHGDETASIAGLSCALRSLPAANLRHDLILSMNPDGNQLGTRANANQVDLNRA
A0A4R3P2P0_9VIBR      RGLLLAGTHGDETASIAGLSCALRSLPAPNLRHDVILSMNPDGNQLGTRANANQVDLNRA
Q87FD9_VIBPA          RGLILAGIHGDETASIAGLSCALRSLPAKNLRHDVILSLNPDGNQLGTRANANQVDLNRA
MPAA_VIBCB            RGLILAGTHGDETASIAGLSCALRSLPAECLKHDVILSMNPDANQLGTRANANQVDLNRA
A0A2N7D0S8_9VIBR      RGLILAGTHGDEAGAIALLSAALRSLQPNQLRHDIVLSINPDGNQLGTRANAHQVDLNRA
                       *:::*. ****  :   **  :*::      *. ::  ***. * * *:*   :*:** 

MPAA_ECO57            FPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPL
MPAA_ECOLI            FPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPL
B2U0L9_SHIB3          FPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPL
E2XH82_SHIDY          FPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPL
B7LRX2_ESCF3          FPAANWKAGETVYRWNSAAPERDVVLLTGDAPGSEPETQALCQLIHRIQPAWVVSFHDPL
B5RA02_SALG2          FPAANWKAGETVYRWNSRAQERDVVLLTGDHPGSEPETQALCQLIHRLQPAWVVSFHDPL
Q8ZP67_SALTY          FPAANWKAGETVYRWNSRAQERDVVLLTGDHPGSEPETQALCQLIHRLQPAWVVSFHDPL
A8AGC4_CITK8          FPAANWKAGETVYRWNSSAEERDVVLLTGEHPGSEPETQALCQLIHRVHPAWVVSFHDPL
D2TK92_CITRI          FPAANWKAGETVYRWNSAAAERDVVLLTGDRPGSEPETQALCQLIHRIHPAWVVSFHDPL
L0M6G7_ENTBF          FPSANWKAGETVYRWNSSAESRDVVLLTGDNPGSEPESEALCQLIHQIHPAWVVSFHDPL
A6T820_KLEP7          FPAANWKQGETVYRWNSAAAERDVVLLTGEQPGSERETEALCQLIHQIHPAWVVSFHDPL
H5V5A8_ATLHE          FPSANWRAGETVYRWNSAAEKRDVVLSTGEKPGSEPETVALCQLIHQIAPRWVVSFHDPL
K8D8Z7_CROSK          FPAANWQPGETVYRWNSAAEARDVTLSTGEKPGSEPETAALCQLIHQLKPAWVVSFHDPL
I2B974_SHIBC          FPSRNWQPGQTVYRWNSQATQRDVRLSTGQHPGSEPETAALCQLIEDIRPAWVVSFHDPL
H3RD33_PANSE          FPAANWQSGETVYRWNSAADARDVTLSTGAHPASEPETQALCSLIHQLKPAWVVSWHEPL
D4GF62_PANAM          FPAANWQSGETVYRWNSAADARDVKLSTGTHPASEPETQALCALIHQLKPAWVVSWHEPL
E6WDP5_PANSA          FPAANWQSGDTVYRWNSVADERDVVLSTGEHPSSEPETQALCQLIHSLKPRWVVTWHEPL
D8MSL6_ERWBE          FPAANWQPGDTVYRWNSEADERDVVLSTGEKPASEPETQALCDLIHALKPSWIVTFHEPL
A0A071MBN5_9ENTR      FPAANWKPGETVYRWNTQAPVRDVKLSAGEFAGSEPETQALCQLITRIKPAWAVSFHEPL
A0A2I5TJY6_SERS3      FPASNWQPGETVYRWSDATKARDVTLSTGDAPGSEPETQALCQLIDRLSPPWVVSFHEPL
E0SFX3_DICD3          FPAANWQPDGTVYRWSEDTPVRDVQISTGDRPGSEPETQALCRLIDRLSPPWVVSFHEPL
Q6D5Q0_PECAS          FPASNWQPGNTIYRWNSAADERDVELSTGETAGSEPETKALCTLIEKLNPHWVVSFHEPL
A1JNE3_YERE8          FPAKNWQAGETVYRWNSAADARDVVLSTGECAASEPETQALCALITQLSPRWVVSFHEPL
A0A0T9LGC7_9GAMM      FPANNWQSGETVYRWNSAATERDVLLSTGSEAGSELETKALCQIIGELAPAWVISFHEPL
A0A097R201_HAFAL      FPAANWLPGHSVYRWNSASSERDVRLSTGDAAGSEPETQALCQLIHRLKPAWVVSLHEPL
A0A143HL97_9GAMM      FATANWDGSGTTYRWNSEAEARDVRLSTGSKPGSEKETRALCRLIAELQPAWAVSIHEPL
A0A1R4B6F5_9VIBR      FPTQNWSGNGTVYRWNSYAETRDVYLNTGEYGGSEPETHHLIELIDSLQPTFILSFHEPL
A0A2T5EKM7_VIBSP      FPTKNWTENGTVYRWSSHTPVRDVKVKTGQVDQLEPEVQSLINLIEQRQHKFVISFHEPL
B7VT71_VIBA3          FPTQNWTENDTVYRWSSHTPVRDVKVKTGQADQLEPEVQSLINLIQQRKPKFVISFHEPL
A0A4R3P2P0_9VIBR      FPTQNWTENGTVYRWSSHTPVRDVKVKTGQTDQLEPEVQSLIDLIEQRQPKFVISFHEPL
Q87FD9_VIBPA          FPTQNWTEHGTVYRWSSHTPIRDVKVKTGSKNQLEPEVGALINLIELRRPKFVVSFHEPL
MPAA_VIBCB            FPTQNWTEHGTVYRWSSHTPVRDVKVKTGDKEQLEPEVDALISLIELRRPKFVVSFHEPL
A0A2N7D0S8_9VIBR      FPSANWTPNGTTYRWSTNNKDRDVDVATGNATTLEPEIDALIKLIRTRKPSFIVSIHEPL
                      *.: **    : ***.     *** : :*     * *   *  :*      : :: *:**

MPAA_ECO57            ACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEAS
MPAA_ECOLI            ACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEAS
B2U0L9_SHIB3          ACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEAS
E2XH82_SHIDY          ACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEAS
B7LRX2_ESCF3          ACIEDPRQSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLPCITAEFPAISSDEAS
B5RA02_SALG2          ACIEDPRRSELGEWLADAFALPLVTSVGYETPGSFGSWCADLNLHCITAEFPPVSTDEAS
Q8ZP67_SALTY          ACIEDPRRSELGEWLADAFALPLVTSVGYETPGSFGSWCADLNLHCITAEFPPVSADEAS
A8AGC4_CITK8          ACIEDPRHSELGEWLARAFELPLVSSVGYETPGSFGSWCADLNLHCITAEFPPISSDEAS
D2TK92_CITRI          ACIEDPASSELGDWLAQAFALPLVTSVGYETPGSFGSWCADLGLHCITAEFPPISSDEAS
L0M6G7_ENTBF          ACIEDPRHSELGRWLAESFALPLVGCVGYETPGSFGSWCNDIGLHCITAEFPPISSDEAS
A6T820_KLEP7          ACIEDPGHSPLGRWLADAFSLPLVGSVGYDTPGSFGSWCADIGLPCITAEFPPVSADEAT
H5V5A8_ATLHE          GCIEDPAASPLGHWLAQAFNLPLVTSVGYDTPGSFGSWCADISLPCITAEFPPISADEAT
K8D8Z7_CROSK          GCIEDPQQTPLGRWLADAFGLPHVTSVGYETPGSFGSWCADLGLTCITAEFPARRQTRRS
I2B974_SHIBC          ACIEDPGNSALGNWMADAFGLPLVTSVGYATPGSFGSWCADRSLPCITAELPPISADDAS
H3RD33_PANSE          ACIDDPHHAEVGAWLAAQTGLPRVSSVGYATPGSFGSWCHDLSLPCVTAEMPVIAVDEAT
D4GF62_PANAM          ACIDDPEQTDVGAWLAAQTQLPRVSSVGYATPGSFGSWCHDLSLPCVTAEMPAISVDEAT
E6WDP5_PANSA          ACIDDPHHSELAQWLSQQTQLPVVSSVGYATPGSFGSWCDDIGLLCITAEMPPISVDEAT
D8MSL6_ERWBE          ACIEDPDTSPLGHWLAKKMELPLVTSVGYATPGSFGSWCADLSLPVITAELPPISADEST
A0A071MBN5_9ENTR      ACVEDPYRTPLGEWLATTLMLPLVTSVGYATPGSFGSWCKDNSLPCITAELPPVSADLAC
A0A2I5TJY6_SERS3      ACIDDPQCSVLGTWMAYHFSLPQVDNVGYGTPGSFGSWCADRALLCITAELPVIAADTAN
E0SFX3_DICD3          ACIDDPHRSELGGWLAREFALPLVDSVGYPTPGSFGSWCAERRLHCITAELPVIAADSAN
Q6D5Q0_PECAS          ACIEDPHGSELGQWLAQQCELPLVSSIGYDTPGSFGSWCADRSLHCITAELPPISADAAS
A1JNE3_YERE8          ACIEDPDSSALGEQLAANFNLPLVTNVGYATPGSFGSWCADISLPCITAELPPISADAAS
A0A0T9LGC7_9GAMM      ACIEDPDSSPLGHWLSEQFDLPLLTNVGYATPGSFGSWCADISLPCITAEFPPISADAAS
A0A097R201_HAFAL      ACVEDPHQTLLGQQLSADFELPLVSNVGYETPGSFGSWCADLSLPCITLELPAISADLAS
A0A143HL97_9GAMM      ACVEAPDDSTLGQWLAGQLQLPLVNDIGYQTPGSFGTWCAERSLPCITVELPPVSADAAS
A0A1R4B6F5_9VIBR      ACIDAGQHKKLGKKLVEMFELPLMDGVGYDTPGSFGTWCDEQAIENITIELPPIATDDVT
A0A2T5EKM7_VIBSP      AMVDDPTQSELAIWLGKQFNLPLVEDVDYETPGSFGTWCQERNLPCITVELPPVSADLTI
B7VT71_VIBA3          AMVDDPTQSELASWLGKQFNLPLVEDVDYETPGSFGTWCQERSLPCITVELPPVSADLTI
A0A4R3P2P0_9VIBR      AMIDDPTQSELAIWLGKQFNLPIVEDVDYETPGSFGTWCQERNLPCITVELPPVSADLTI
Q87FD9_VIBPA          AFVDDPKHSNLAKWLGEQFQLPIVDDVDYETPGSFGTWCSERDLPCITLELPAISADLTI
MPAA_VIBCB            AFVDDPAHSDLAKWLGKQFNLPIVDDVDYETPGSFGTWCNERQLPCITVELPPISADLTI
A0A2N7D0S8_9VIBR      ACVDDPEESTLGYWIASHFALPLVTDIGYDTPGSFGSWCKEQAIPCVTLELPNTSADQLT
                      . ::      :.  :     ** :  :.* ******:** :  :  :* *:*        

MPAA_ECO57            EKYLFAMANLLRWHPKDAIRPS-
MPAA_ECOLI            EKYLFAMANLLRWHPKDAIRPS-
B2U0L9_SHIB3          EKYLFAMAYLLRWHPKDAIRPS-
E2XH82_SHIDY          EKYLFAMANLLRWHPKDAIRPS-
B7LRX2_ESCF3          EKYLFAMSNLLRWHPKDALVRS-
B5RA02_SALG2          EKYLLAMSNLLRWHPKDGVDPS-
Q8ZP67_SALTY          EKYLLAMSNLLRWHPKDGVDPS-
A8AGC4_CITK8          EKYLMAMSTLLRWHPKDEVARS-
D2TK92_CITRI          EKYLQAMSSLLRWHPTDAIARS-
L0M6G7_ENTBF          EKYLGAMTALLRWRAAAQR----
A6T820_KLEP7          ERYLPAMTDLLRWQA--------
H5V5A8_ATLHE          ERYLEAMTALLHWQPYR------
K8D8Z7_CROSK          ARSRPIMRSG-------------
I2B974_SHIBC          ERYLHPMTALLQWS---------
H3RD33_PANSE          ETWLEVMVNLLRWQP--------
D4GF62_PANAM          ETYLETMLTLLRWQPSLTPRHVP
E6WDP5_PANSA          EVYLETMINLLRWQPQA------
D8MSL6_ERWBE          EKYLGAMVDLLSWQP--------
A0A071MBN5_9ENTR      ERYLDGFTSLLTYKG--------
A0A2I5TJY6_SERS3      ERYLDPMVNLLGHNFLYQI----
E0SFX3_DICD3          HRYLTALTRLLSHNFLYQC----
Q6D5Q0_PECAS          ECYLNAMVALLSQQF--------
A1JNE3_YERE8          ECYLAALIDLLTRPD--------
A0A0T9LGC7_9GAMM      ESYLAAMTALLTRP---------
A0A097R201_HAFAL      EKYLPALLALIDYDL--------
A0A143HL97_9GAMM      ETYLQALIQLLTYEQ--------
A0A1R4B6F5_9VIBR      EKYLNTVSSLLVDDINHR-----
A0A2T5EKM7_VIBSP      EQYLDAFLAVLGG----------
B7VT71_VIBA3          EQYLDAFVAVLGCEGVV------
A0A4R3P2P0_9VIBR      EQYLEAFVAVLGCE---------
Q87FD9_VIBPA          EKHLSAFIALLMHDPDL------
MPAA_VIBCB            EKHLDAFIALLQHDPDL------
A0A2N7D0S8_9VIBR      IDYLEPTMALMRYISAG------