CLUSTAL format seed alignment for MF_02213

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D7GCQ1_PROFC          -------------------------------MVKPIKIVVVYQSLLGIYGDRGNGMVLAK
Q6A776_CUTAK          ------------------------------MNIDRPKIVLLYQSLLGIYGDHGNAVVLTK
A0LVL7_ACIC1          MSAADRLRPEDAGRVHPRDPQSRDPQSQDPLPRDPLRIVSIFPTLLGTYGDGGNARILAV
Q5Z348_NOCFA          ------------------------------MGESTVRIGLVLPDVMGTYGDGGNALVLRQ
D0LDF5_GORB4          ------------------------------MSESTLRIGLVLPDVMGTYGDGGNALILRQ
F5YT07_MYCSD          -----------------------------------MRIGLVLPDVMGTYGDSGNAVVLRQ
B1VIS1_CORU7          --------------------------------MAELNIGLVLPDVLGTYGDDGNALVLRQ
G0HFG6_CORVD          ------------------------------------------------------------
Q8NTQ7_CORGL          --------------------------------MTTLNIGLILPDVLGTYGDDGNALVLRQ
D7BLC5_ARCHD          ---------------------------------MTLRIGILLPEVLGTYGDSGNADILAY
K0JUR2_SACES          ---------------------------------MTVSIALVLPDLLGTYGDFGNAVVLEK
G0G5G3_AMYMS          ------------------------------MADSIVHIGLLLPEVLGTYGDTGNAQVLGK
E2Q9G3_STRCL          ----------------------MRREGRNRMSDSSLRLVWVYPDLLSTYGDQGNALVVER
I2MUN5_STRT9          ------------------------------MADNSLRLVWVYPDLLSTYGDQGNALVVER
E8WDD0_STRFA          -------------------------------MNNSLRLVWVYPDLLSTYGDQGNALVVER
D5ZVE2_STRV1          ------------------------------MSDNSLRVVWLYPDLLSTYGDQGNVLVVER
J7LFU5_NOCAA          ----------------------------MSNTSSALRIVWIYPDLLSTYGDQGNVLILQR
D1A4K9_THECD          -----------------------------MSSSASIKIVWVYPDLLSTYGDQGNCIVLER
F4FHS4_VERMA          ------------------------------MSTETLRIVWIYPDLLSTYGDRGNALILAR
D9T691_MICAI          ------------------------------MSTESLRIVWIYPDLLSTYGDRGNALILAR
I0H145_ACTM4          ------------------------------MSTESLRIVWIYPDLLSTYGDRGNLLILAH
D3Q766_STANL          ------------------------------MSTSLLRLVWIYPDLLSTYGDRGNLLILAH
A8KY77_FRASN          -----------------------------MSRESATRIALIYPELLGTYGDGGNAIVLAQ
F8AX29_9ACTN          -----------------------------MSRDSATRIALIYPELLGTYGDGGNATVLAQ
A5D1R1_PELTS          ----------------------------------MISVCHLYPDLLDLYGDRGNVVAFKM
D5WQJ9_KYRT2          -------------------------------MTTKLIIGHLYPDLLDLYSDRGNVMILEK
A9WBM8_CHLAA          -------------------------------MNLTLRLAHLYPEHMNVYGDRGNVIALRQ
GATD_STAAN            --------------------------------MHELTIYHFMSDKLNLYSDIGNIIALRQ
Q2FX00_STAA8          --------------------------------MHELTIYHFMSDKLNLYSDIGNIIALRQ
GATD_STAAC            --------------------------------MHELTIYHFMSDKLNLYSDIGNIIALRQ
Q2NGS5_METST          ---------------------------------MELNLFHMYPEQLNLYGDTGNILCLKN
E9SCT7_RUMAL          --------------------------------MDKLRILHMYPAMLDLYGDSGNVEILSY
K9QU31_NOSS7          ------------------------------MKQLDLTIGWLYPTLMSTYGDRGNVITIER
Q8YTJ9_NOSS1          ----------------------------MNSPQLELTIGWLYPTLMSTYGDRGNVITIER
A0ZIX1_NODSP          ----------------------------MSSENLELIIGWLYPTLMSTYGDRGNVITIQR
K9Z0J4_CYAAP          -------------------------------MSMQLTIGWLYPKLMSTYGDRGNVICLQR
B1XJM2_SYNP2          ---------------------------------MHLKLGWLYPTLMGTYGDRGNVICLEK
GATD_STRR6            ------------------MVYTSLSS-KDGNYPYQLNIAHLYGNLMNTYGDNGNILMLKY
F9VD97_LACGL          ------------------MVYTSLTS-NLENPKYNLHVAHLYGDLMNTYGDNGNILMLKY
K8E2G6_CARML          --------------------------------MEELAVCHLYGNLLNTYGDNGNLLMLNH
Q38WJ1_LACSS          -------------------------------MTQTLKICHLYGNLMNTYGDLGNILVLDY
F9UQS8_LACPL          -------------------------------MTYTLHAAHLYGDLMNTYGDIGNILAMRY
A0A0R2H0I4_WEIVI      ------------------------------MAEYTLQTAHLYGDLMNTYGDYGNIVALNF
Q5FHZ2_LACAC          ------------------------------MSDKLIKIAYLYEDLMNTYGDSGDVKILSF
A0A0F4LP02_9LACO      ------------------------------MANKTIKIAYLYEDLMNTYGDSGDVKIIRY
Q74HI3_LACJO          ------------------------------MADKTIKIAYLYEDLMNTYGDSGDVKVIRY
A0A0H4QKW2_9LACO      -------------------------------MSDTIKIAYLYEDLMNTYGDSGDVKILAF
Q97KF8_CLOAB          ---------------------------------MELNICHLYPDLLNVYGDIGNIRILKY
A5HYV4_CLOBH          ---------------------------------MELNICHLYPDLLNVYGDIGNILVLKY
S0FLI5_RUMCE          --------------------------------MYDLNICHLYPDLLNTYGDRGNILALQR
D2Q7Q5_BIFDB          -------------------------------MSQAIDIVSLYPKDMNIYGDSGNVLTIQR
A0ZZL6_BIFAA          -------------------------------MSQVIDIVSLYPKDMNIYGDSGNVLTIQR
B8DVI5_BIFA0          -------------------------------MSKAIDVVSLYPKDMNIYGDSGNVLAVER
H0QKT1_ARTGO          --------------------MTPDSGTGTSASKGTIRVLQLYPREMNIYGDWGNALVLQQ
W0Z9J5_9MICO          -------------------------------MSDVLSIVSLFPERLNIHGDAESADVLRV
A0A0Q5B8R2_9MICO      --------------------------------MTVLRIGVLAPDVLDSNGDAANARVLVA
B0RC13_CLAMS          -------------------------------MSDALRILHLYPDELGINGDRGNVTVLVE
Q83MU5_TROWT          -----------------------------------MLLVDLFPHQLSIRGDRGNVTALKA
                                                                                  

D7GCQ1_PROFC          RLSWRGIASELIMVEPGQPVPT--NGAVYLLGGGEDQAQIAAVDALR--ADGGLFRALDD
Q6A776_CUTAK          RLQWRGIDAELLIVEPGQPVPT--DGAVYLLGGGEDTAQITAVQELE--ADGGLFTALDD
A0LVL7_ACIC1          RAQARGIAAEVLVIDPGTPLPV--DGDIYLLGGGEDDAQVAAARLLR--ADGGLARAADR
Q5Z348_NOCFA          RLRMRGYDAEIVEINLTDPVPE--SLDIYTLGGAEDSAQRLATRHLC--RYPGLQQAAAK
D0LDF5_GORB4          RARMRGIDAEVVHITLDDEVPD--SLDVYTLGGAEDYAQRLATRHLN--RHPGLQRAAAA
F5YT07_MYCSD          RLALRGIAAEIVEITLADPVPE--SLDLYTLGGAEDYAQRLATRHLI--RYPGLQRAAER
B1VIS1_CORU7          RARLRGITAEIHTIRYGEAVPE--TLDVYTLGGGEDVAQLLAAEHLR--ADGGLVRAVGA
G0HFG6_CORVD          ---MRGIDAESHRITLGDAVPE--GLDVYTVGGGEDVAQILAAEHLI--ADGGMTRAVNA
Q8NTQ7_CORGL          RARMRGINAEIQRVTLDDAVPS--TLDLYCLGGGEDTAQILATEHLT--KDGGLQTAAAA
D7BLC5_ARCHD          RARARGIDAEIVHVGIHDSIPE--SLDIYTLGGGEDIAQTIAARKLA--ADQGLARAVAS
K0JUR2_SACES          RMTWRGIPAEIVTVKFGESVPS--SCDIYVVGGGEDTAQTLAVRHLR--EHPGMQRAAQR
G0G5G3_AMYMS          RLQWRGLDAEVVPVGLGEPVPS--TLDLYLLGGGEDGAQVLAAAHLR--KHPGLRRAVAA
E2Q9G3_STRCL          RARQRGLDVMRVDVRSDQPIPT--SGDIYLIGGGEDRPQRLAAERLR--RDGGLNRAAEN
I2MUN5_STRT9          RARQRGLDVQRVDVRSDQPIPT--SGDIYLIGGGEDRPQRLASERLR--RDGGLNRAAEN
E8WDD0_STRFA          RARQRGLDVSRVDVRSDQPIPT--SGDIYLIGGGEDRPQRLAAERLR--RDGGLSRAASN
D5ZVE2_STRV1          RARQRGLDVARLDVRSDQPIPT--SGDIYLIGGGEDRPQRLAAERLR--RDGGLHRAVEN
J7LFU5_NOCAA          RAEQRGIPTEIVRVHSSDAVPE--QGDIYLLGGGEDRPQILAAERLR--ADGGLARAAAR
D1A4K9_THECD          RAALRGIHTRTVHVRSDETVPV--DGDIYLLGGGEDRPQILAARRLR--NDGGLHKAREF
F4FHS4_VERMA          RARQRGFPVEVLEVRSDQPLPT--TADIYLIGGGEDGPQALGAQRLL--ADGGLHRAVAQ
D9T691_MICAI          RAQLRGMPVEVLEVRSDQRLPA--TADIYLLGGGEDGPQALGAQRLI--ADGGLHRAVAQ
I0H145_ACTM4          RAAARGIPVETYEVRSDQQMPT--SADIYLIGGGEDGPQALAAQRLL--TDGGVHRAVNQ
D3Q766_STANL          RAESRRILTESITVRSDRPIPR--EGDIYLIGGGEDGAQALAAEKLI--ADGALNEAAGA
A8KY77_FRASN          RLRWRGLRAEIVEVPAGEVVPA--DCDIYLLGGGEDEPQVLAADGMR--RNRSLTRAVSG
F8AX29_9ACTN          RLRWRGLPAEVIGVPAGEPVPA--GCDIYLLGGGEDEPQVLAAEGLR--QNNAIAHAVAQ
A5D1R1_PELTS          RCQWRNIPVTVRQVSLGDKIDF-KEYDFVFLGGGSDREQNLIAADLMNRR-DEFKEAVED
D5WQJ9_KYRT2          RARWRGIDADVIRVDAGDDVDL-RDCDLVVMGGGMDREQSLVARDLQRRR-TNFEQATAE
A9WBM8_CHLAA          RCQRRGIALEIVPVNPGDTIDW-QTVDLAFFGGGQDSGQALITGDLIERQGPGLRAAIEA
GATD_STAAN            RAKKRNIKVNVVEINETEG-ITFDECDIFFIGGGSDREQALATKELS-KIKTPLKEAIED
Q2FX00_STAA8          RAKKRNIKVNVVEINETEG-ITFDECDIFFIGGGSDREQALATKELS-KIKTPLKEAIED
GATD_STAAC            RAKKRNIKVNVVEINETEG-ITFDECDIFFIGGGSDREQALATKELS-KIKTPLKEAIED
Q2NGS5_METST          RCEKRGIEVNLYKFSKEEK-YDLSLGDIFFIGGGSDNSQEIVYNDFL-NYKDSFKQIIEE
E9SCT7_RUMAL          RCRMRGIETEVIKHDLGDKDTDFSGVDIVYLGGGADFEQQLLADDLL-GLKDNIRKAYEN
K9QU31_NOSS7          RAQWQGYSVKVLPLDQNATADDIKSVDVIVGGGAQDRQQEIVMRDLQGAKAAAIREKIEN
Q8YTJ9_NOSS1          RAQWRGYTVKVLPLDQNSTADDIKSVDVIVGGGAQDRQQEIVMRDLQGAKADAMREKIDN
A0ZIX1_NODSP          RAQWRGYNVQVVALDQNSTDADIQAVDIIVGGGAQDRQQEIVMRDLQGAKADAMRDKIEN
K9Z0J4_CYAAP          RCQWRDLDVSILALDQESSIASFQEFDLIVGGGAQDRQQEIVMRDLQGEKAQIIKEKLTS
B1XJM2_SYNP2          RAQWRQITVEVIPLDKEAPLNVWEEVDLIVGGGAQDRQQEIVMRDLQGAKAEQLKALIED
GATD_STRR6            VAEKLGAHVTVDIVSLHDDFDE-NHYDIAFFGGGQDFEQSIIADDLP-AKKESIDNYIQN
F9VD97_LACGL          VGEKLGAEMTFDIVSLEDSFDQ-DFYDLVFWGGGQDYEQEIIADSFK-NITAPLKSYIEA
K8E2G6_CARML          RAKQMGIHLNTEIISLKDDFDP-KKYDLVFFGGGQDYEQLIVSRDIQ-SKKAALTEYIEA
Q38WJ1_LACSS          YAKKIGLKTETDVISIGQDFDA-SRYDIVLFGGGQDFEQKIISEDLN-SKKAALTAYIEN
F9UQS8_LACPL          YAKAVDADITVDLVSLDDRFDE-EKYDFALFGGGQDYEQTIVSKDLQ-TKKDALTAYIEA
A0A0R2H0I4_WEIVI      YAKQLGVAVETDMVSLGDDFDD-TKYDFVLFGGGQDYEQMVVTKDLP-SKAPAIKRYIED
Q5FHZ2_LACAC          LLKREGYDTQVDNISLGDEFNA-FDYDFVFFGGGQDFEQTVVAKDLP-RHKETLEKYIND
A0A0F4LP02_9LACO      LLKKQGYSTQIDNVSLGDEFNA-FDYDFVFFGGGQDFEQTVIAKDLP-RHKETLTKYIND
Q74HI3_LACJO          LLDKQGYQTEVDNISLDDSFDA-NDYDFLFFGGGQDFEQTVVAKDLP-RHKETIENYIKA
A0A0H4QKW2_9LACO      LLKEQGYDTQVDNISLDDEFNA-FDYDFLFWGGGQDFEQTVVAKDLV-RHRQTIQDYIEA
Q97KF8_CLOAB          RAEKRGIKVNISNVSLKDNFDK-DAYDIAFFGGGQDYEQSIVSEDLTNTKKESIRDYINS
A5HYV4_CLOBH          RAEQRGIKINVSNVSIKDNFPI-DKYDIALFGGGQDYEQSIVSKDMLETKKDDLTKYIEK
S0FLI5_RUMCE          RAQWHGINTQVTNITIGDSFDS-SEYDIIFLGGGQDYEQEIIQADVLNQKGSEIKSAIDN
D2Q7Q5_BIFDB          RLALYGYEPHVHAYNQGDEWPE--HVDMILGGGGQDTGQKKIIGDFF-MRADLLRSLAAD
A0ZZL6_BIFAA          RLALYGYEPRVHAYNQGCDWPE--HVDMILGGGGQDTGQKKIIDDFF-QRADLLRSLAAD
B8DVI5_BIFA0          RLALYGYEPHVHAVNQNDPWPE--HADIILGGGGQDTGQKKIIEDLF-RRADRLRDLAEH
H0QKT1_ARTGO          RLKWHGYTPELLEYNVGDEFPE--GVDIILGGGGQDSGQLVIQDDLQ-SRASLLKGMAED
W0Z9J5_9MICO          RAGWRGIEARVTTITSAQDASGL-RPDAITIGAGFDADAPEVLAGLR-EIADELNAWVES
A0A0Q5B8R2_9MICO      RARWAGLEAELVGLHHRDDFRE--RPDVLVAGTGADQDLPEVLDVLR-DVDATVRGWADS
B0RC13_CLAMS          RARIRGIRTEVVRHAPGGGDPG--DADLVVIGSGPLTAQRAVLPDLV-AHAPRLVALREA
Q83MU5_TROWT          RAHFAGHKLEIYDLHPGNVLPT--GVSGVVIGSGPDYVLADLLGDMR-RLACDLKALRDD
                                                     * .           .       .      

D7GCQ1_PROFC          GAVLFSVCAGYQILGNSFTVGDDDTVIEGLGLLDVDTRRGP--------VRAVGEVLSHW
Q6A776_CUTAK          GAMLFAVCAGYQICGKSFTIGARDEAIKGLGLLDAETRRGP--------ERAVGEVLHIW
A0LVL7_ACIC1          GAVIFGVCAGYQLLGHAFP-GAGGEIESGLGLLDVTTSRLT--------RRAVGELLAEP
Q5Z348_NOCFA          GAPVLAICAAIQVLGNWYETSSGER-VEGVGLIDVTTAPQD--------KRAIGEVVTAP
D0LDF5_GORB4          GRPVLAICAAIQVLGHWYETSAGER-VDGISLFDLTTAPQA--------KRSIGELITEP
F5YT07_MYCSD          GAPVLAICAAVQVLGAWYETSAGER-VDGVGMLDVTTAPQQ--------ARTIGEVVGDP
B1VIS1_CORU7          GRPVLAICAGLQVLGESFH-AGGKL-AEGLGLLDATTSQLG--------ERMIGELHSEP
G0HFG6_CORVD          GRPVLAICAGLQVFGRSFR-ASDRM-VDGLGLIDATTSSLQ--------TRMIGELKSVP
Q8NTQ7_CORGL          GRPIFAVCAGLQVLGDSFR-AAGRV-IDGLGLIDATTVSLQ--------KRAIGEVETTP
D7BLC5_ARCHD          GRPVLGICAALQVLGTWYTDARGMR-TPGAGLLDVITLPQG--------LRAIGELRTAP
K0JUR2_SACES          GAVVLGVCAGIQIFGESFTRADQVT-HGGLGLIDSTSHAGG--------SRAIGEVVATP
G0G5G3_AMYMS          GAVVFGVCAGLQVLGTRFRGLDGVD-HDGLGLLDVTTEPGP--------QRAVAELVAAP
E2Q9G3_STRCL          GAIIFSVCAGYQILGHEFINDLGER-EPGLGLIDVVSTRGEG-------ERCVGDVLADC
I2MUN5_STRT9          GAIIFSVCAGYQILGHEFINDLGQR-EPGLGLIDVISTRGEG-------ERCVGDVLADI
E8WDD0_STRFA          GAIIFSVCAGYQILGHEFINDLGER-EPGLGLLDVVSTRGEG-------ARCVGDVLGDI
D5ZVE2_STRV1          GAIVFSVCAGYQILGHEFINDLGQR-EPGLGLLDVVSVRGEG-------ARCVGDVLADI
J7LFU5_NOCAA          GACVFAVCAGYQIIGESYGDDEANP-LPGVGILDIRSGRGQ--------TRAVGEIVADV
D1A4K9_THECD          GAVIFAVCAGYQLLGTEFGGEEGQP-VQGLGLLDIRSGRGE--------RRAVGEIVGDV
F4FHS4_VERMA          GSVVFGVCAGYQLLGTSFFAK-GTQ-YRGLELLDLSSDRGA--------SRAVGELAGDI
D9T691_MICAI          GSVVFGVCAGYQLLGTSFFAK-GTR-CAGLELLDLSSDRGP--------TRAVGELAGEV
I0H145_ACTM4          GAAVLAICAGYQLFGHSFFAK-GAK-CSGLGLLDITSDRGV--------TRAVGELRGDI
D3Q766_STANL          GKVVFAVCAGYQLLGESFVAS-GQV-RAGLGLFDMRSDRDV--------KRAVGELSGEV
A8KY77_FRASN          GAAVLAVCAGYQVIGASFPAGNGRV-HEGVHLVDMETRRSFDPPDVPPPPRAVGDIVVEP
F8AX29_9ACTN          GAVVLAVCAGYQVIGVSFPGGEGRI-HDGLGLVDVETRRSFEQ---PVPPRAVGDIVVEP
A5D1R1_PELTS          GLVVLAICGGYQLLGKYYLAPGGKE-ISGLGMLDLYTRA--------GDRRLVGNAAVEV
D5WQJ9_KYRT2          GTVVLAICGGYQLLGEYFETGAGER-IPGIGLLDVYTVA--------GERRMVGNVMAEC
A9WBM8_CHLAA          DLVVLAICGGYQLLGHYFLTHTGER-LPGLGVLDVHTIA--------GKQRMIGNIVIEV
GATD_STAAN            GMPGLTICGGYQFLGKKYITPDGTE-LEGLGILDFYTESKT-----N---RLTGDIVIES
Q2FX00_STAA8          GMPGLTICGGYQFLGKKYITPDGTE-LEGLGILDFYTESKT-----N---RLTGDIVIES
GATD_STAAC            GMPGLTICGGYQFLGKKYITPDGTE-LEGLGILDFYTESKT-----N---RLTGDIVIES
Q2NGS5_METST          NKVLLAVCGGYQLLGKEYINKNGDS-LPGLNIFDYTTVHRQ-----N---RIINNIILET
E9SCT7_RUMAL          GVYFLMICGGYQLMGQYYKDSNGKK-IPGLGLFDYYTVAST-----NKRERCIGNIVVET
K9QU31_NOSS7          GTPGVFTCGSPQLLGHYYEPGLGQR-IEGLGILDLVSVHPG-----ENTKRCIGNLVIEV
Q8YTJ9_NOSS1          GTPGVFTCGSPQLLGHYYEPAFGQR-IEGLGILDLVSIHPG-----ENTKRCIGNLVIEV
A0ZIX1_NODSP          GTPGVFTCGSPQLLGKYYEPALGQR-IEGLGILDLVSVHPG-----ENTQRCIGNLVIEV
K9Z0J4_CYAAP          GIPGVFTCGSPQLLGKYYEPALGQK-IEGLGILDLVTKHPG-----INVPRCIGNVAFDI
B1XJM2_SYNP2          QVPGVFTCGSPQLLGKYYEPALGQR-IEGLGILDLVSKHPG-----FGAKRCIGNVAFEI
GATD_STRR6            DGVVLAICGGFQLLGQYYVEASGKR-IEGLGVMGHYTLN-------QTNNRFIGDIKIHN
F9VD97_LACGL          EKPMLAICGGYQMLGQYYINAAGTK-IDCTGILPHYTKN-------LGNDRFIGDIQIHN
K8E2G6_CARML          GGVTLAICGGYQLLGHYYMDASGNK-IDGIGALDHYTLS-------QDNSRFIGDIIIKN
Q38WJ1_LACSS          GGVMLAICGGYQLLGHYYIGANGDK-IPGIGALDHYTLS-------QDNSRFIGDIVIEN
F9UQS8_LACPL          GGPLLAICGGFQMLGHYYIGAHGEK-IAGIGALDHYTLS-------QDNNRFIGNITIEN
A0A0R2H0I4_WEIVI      GGTFLGVCGGFQLLGDYFVLADGTR-VEGIKAMMHYTLN-------QPNGRFIGNVTIED
Q5FHZ2_LACAC          DKPMLCICGGYQLMGSYYKTNSGVT-IPGLDILPLHTVF-------KSDKRMIGDTRYMT
A0A0F4LP02_9LACO      GKPMLGVCGGYQLVGTYYKTNSGVT-IKGLDILPFHTVF-------KADKRMIGDTRYMS
Q74HI3_LACJO          GNPMLCICGGYQLMGDYYKTNSGIT-IKGLGILPLHTIF-------KADKRMIGDTRYMT
A0A0H4QKW2_9LACO      GKPMLCICGGYQFLGKYYETVGGDT-IQCLDILPFHTVF-------KADSRMIGDTEYQT
Q97KF8_CLOAB          EKVFIAICGGYQLLGKYYTTPEGEK-LSGLDILNIYTE--------PGDKRFIGNTVIKN
A5HYV4_CLOBH          GKVLLAICGGYQLLGKYYTTPEGEK-LDGLDILDIYTE--------GGDIRFIGNTVIKN
S0FLI5_RUMCE          MKVFLCICGGYQLMGKYYKTWDGKD-IEFLGALDLWTV--------GGKERMIGNIVFES
D2Q7Q5_BIFDB          GMPMLMICGLYQLFGEYFETVDGSR-LDGIGVIGAYTVG--------REVRMIGNLTETS
A0ZZL6_BIFAA          GVPMLMICGLYQLFGEYFETVDGSR-LDGIGVIGAYTVG--------QETRMIGNLTETS
B8DVI5_BIFA0          GVPMLMICGLYQLFGEYFETIDGTK-LEGISIIRAYTVG--------RDVRMIGNLVEHS
H0QKT1_ARTGO          GTPMLLICGLYQLFGRFFKTRSGPV-IPGIGVLDVETHG--------TDERLIGNVKVTT
W0Z9J5_9MICO          GTVLLAIGLGWEMLSRSLELGRPDP-LSGIGIFTGRSVAS---------ERHVGRISVDS
A0A0Q5B8R2_9MICO      GTEFVAIGAGWELLAESFSTSE-GL-VNGIGVFPGRSVPSA--------ERVTDDLVLDS
B0RC13_CLAMS          GVPFLAVGGGLQLLGESVRLIDGGE-LVGAAVLPVRTTLTA--------ERRVGDLVLDT
Q83MU5_TROWT          NVPFLAISNGLRLLSEKFVSHDDVE-HTAAGVYPISCHRIR---------RRVGESIVKC
                          .      .. .                                   *         

D7GCQ1_PROFC          MTPEGD------------------------------------------------DYLLTG
Q6A776_CUTAK          TQPDGN------------------------------------------------TYPITG
A0LVL7_ACIC1          TDATPL------------------------------------------------QTFLTG
Q5Z348_NOCFA          TVPGLT-------------------------------------------------EPLTG
D0LDF5_GORB4          VVPGLH-------------------------------------------------APLSG
F5YT07_MYCSD          LLAGLT-------------------------------------------------QPLTG
B1VIS1_CORU7          YRLGGGDGRGAGAGADGVGADGAGAGGAGGVDAGSGAGGAGSNAQPLAADLSELTEPLTG
G0HFG6_CORVD          AKQGMR-----------------------------------------AAGMEELTEPLTG
Q8NTQ7_CORGL          TRAGFT---------------------------------------------AELTERLTG
D7BLC5_ARCHD          APALAA---------------------------------------------HGVTDTLYG
K0JUR2_SACES          ANGLFE-------------------------------------------------GMLTG
G0G5G3_AMYMS          SRLLDS-------------------------------------------------EALTG
E2Q9G3_STRCL          DPALGL-------------------------------------------------PQLTG
I2MUN5_STRT9          DPRLGL-------------------------------------------------PQLTG
E8WDD0_STRFA          DPNLGL-------------------------------------------------PPLTG
D5ZVE2_STRV1          DPRLGL-------------------------------------------------PPLTG
J7LFU5_NOCAA          DPSLGV-------------------------------------------------GRITG
D1A4K9_THECD          DPALGV-------------------------------------------------PRITG
F4FHS4_VERMA          DARLGL-------------------------------------------------PPLTG
D9T691_MICAI          DPRLGI-------------------------------------------------PHLSG
I0H145_ACTM4          DTRLGL-------------------------------------------------PPLTG
D3Q766_STANL          NPKLGL-------------------------------------------------EDLTG
A8KY77_FRASN          DQRLGL-------------------------------------------------PTLYG
F8AX29_9ACTN          APELAL-------------------------------------------------PLLLG
A5D1R1_PELTS          ELDGKRLKV-------------------------------------------------IG
D5WQJ9_KYRT2          ILDGRTETI-------------------------------------------------FG
A9WBM8_CHLAA          HLGAEPWQL-------------------------------------------------VG
GATD_STAAN            D---TFGTI-------------------------------------------------VG
Q2FX00_STAA8          D---TFGTI-------------------------------------------------VG
GATD_STAAC            D---TFGTI-------------------------------------------------VG
Q2NGS5_METST          TIDITPKTI-------------------------------------------------VG
E9SCT7_RUMAL          TLGDKKYKV-------------------------------------------------IG
K9QU31_NOSS7          TASRLAKDLEEMTGS---------------------------------------KPYLVG
Q8YTJ9_NOSS1          TASRLAKDLEEMTGS---------------------------------------KAYLVG
A0ZIX1_NODSP          TASRLAQELEDMTGS---------------------------------------KPYLVG
K9Z0J4_CYAAP          VAPTLKADLEEMLGE---------------------------------------VPTVVG
B1XJM2_SYNP2          TAEPLATELKAKLGD---------------------------------------RPIAIG
GATD_STRR6            EDFDETYY---------------------------------------------------G
F9VD97_LACGL          EEFGETYY---------------------------------------------------G
K8E2G6_CARML          EEFGETYV---------------------------------------------------G
Q38WJ1_LACSS          REFNETYL---------------------------------------------------G
F9UQS8_LACPL          AETHQTYY---------------------------------------------------G
A0A0R2H0I4_WEIVI      PTNGDIYH---------------------------------------------------G
Q5FHZ2_LACAC          E--WGEVK---------------------------------------------------A
A0A0F4LP02_9LACO      E--WGEVR---------------------------------------------------A
Q74HI3_LACJO          E--WGEVK---------------------------------------------------A
A0A0H4QKW2_9LACO      E--WGTVR---------------------------------------------------A
Q97KF8_CLOAB          ELFNETYV---------------------------------------------------G
A5HYV4_CLOBH          EEFNETYV---------------------------------------------------G
S0FLI5_RUMCE          DFISEDGKPLKIV----------------------------------------------G
D2Q7Q5_BIFDB          DDFGKIVG----------------------------------------------------
A0ZZL6_BIFAA          ADFGKIIG----------------------------------------------------
B8DVI5_BIFA0          AQFGDVLG----------------------------------------------------
H0QKT1_ARTGO          AEFGEVLG----------------------------------------------------
W0Z9J5_9MICO          EWGALT-----------------------------------------------------G
A0A0Q5B8R2_9MICO      ASGVLV-----------------------------------------------------G
B0RC13_CLAMS          PDGELV-----------------------------------------------------G
Q83MU5_TROWT          DFGELV-----------------------------------------------------G
                                                                                  

D7GCQ1_PROFC          FENHGGYTTLGPKAA--PFARVELGVGNR-------------------------------
Q6A776_CUTAK          FENHGGWTELGSDAK--PLAAVESGWGNG-------------------------------
A0LVL7_ACIC1          YENHAGATVIGAGAR--PLGQVRHGVGNGTLFA---------------------------
Q5Z348_NOCFA          FENHRGGTTLGPDAT--GLARVTRG------------VGNGVGDG---------------
D0LDF5_GORB4          FENHRGGTTLGSDAQ--PLGRVRHG------------VGNGVGDG---------------
F5YT07_MYCSD          FENHRGGTVLGPAAS--PLSKVTKG------------AGNRAGGG---------------
B1VIS1_CORU7          FANHMGATILGPDAY--PLGILRPRGG---------MVGNTDAHGVEAADVVVKNGEKQQ
G0HFG6_CORVD          FANHQGATILGPDAR--PLGHVTHG------------TGNTDAHGALTAGLTPETAKVEV
Q8NTQ7_CORGL          FENHMGATLLGPDAE--PLGRVVRG------------EGNTDVWAASEN----TDDQRQQ
D7BLC5_ARCHD          FENHGGATALGPDAA--PLGYVTYGTGNGVPGKAPAQTNDTRTPDPSAIPEATPEGYVTL
K0JUR2_SACES          FENHQGRTVLGPSAR--PLAHVKVG------------TGNDGS-----------------
G0G5G3_AMYMS          FENHLGVSKLGAGSE--PLGRVVRG------------TGNGDG-----------------
E2Q9G3_STRCL          FENHQGVTHLGPTAR--PLARTVVG------------RGNGT------------------
I2MUN5_STRT9          FENHQGITHLGPTAR--PFARTVLG------------RGNGT------------------
E8WDD0_STRFA          FENHQGVTHLGPSAR--PLARVRLG------------RGNGT------------------
D5ZVE2_STRV1          FENHQGVTHLGPTAR--PFAQVRFG------------NGNGT------------------
J7LFU5_NOCAA          FENHQGRTAIGPQAR--PLSTTVKG------------IGN--------------------
D1A4K9_THECD          FENHQGVTYLGPGAK--PLARVVHG------------VGN--------------------
F4FHS4_VERMA          FENHGGRTQLGPGVS--PLARVTAG------------VGN--------------------
D9T691_MICAI          FENHGGRTHLGPGVS--PLARVTTG------------VGN--------------------
I0H145_ACTM4          FENHGGRTHLGAHAA--PLARVTAG------------VGN--------------------
D3Q766_STANL          FENHGGRTHLGPATM--SLSSVTHG------------IGN--------------------
A8KY77_FRASN          YENHGGRTRPLPGSRGIPLGTVRLG------------VGDGTP-----------------
F8AX29_9ACTN          YENHGGRTRTLPNGHGRPLGTVRKG------------VGNGTP-----------------
A5D1R1_PELTS          FENHSGQTFLGE---VSPFGKVLS------------GYGNNGL-----------------
D5WQJ9_KYRT2          YENHSGRTYLREG--TEPWMRVVR------------GEGNNGR-----------------
A9WBM8_CHLAA          FENHSGRTFHGPG--VKSLGRVLV------------GYGDNGQ-----------------
GATD_STAAN            FENHGGRTYHDFGT----LGHVTF------------GYGNNDE-----------------
Q2FX00_STAA8          FENHGGRTYHDFGT----LGHVTF------------GYGNNDE-----------------
GATD_STAAC            FENHGGRTYHDFGT----LGHVTF------------GYGNNDE-----------------
Q2NGS5_METST          FENHGGRTYSNYTP----LGNVLV------------GKGNNDT-----------------
E9SCT7_RUMAL          FENHGGQTTNVKTP----FGKVLA------------GNGNEFA-----------------
K9QU31_NOSS7          FENHGGRTKLGKVE---ALGKVVY------------GLGNNGE-----------------
Q8YTJ9_NOSS1          FENHGGRTKLGKVE---ALGKVVY------------GLGNNGE-----------------
A0ZIX1_NODSP          FENHGGRTKLGKVE---ALGRVVY------------GLGNNGE-----------------
K9Z0J4_CYAAP          FENHGGRTYLGDVS---PLGKVVS------------GYGNNGE-----------------
B1XJM2_SYNP2          FENHGGRTYLGEVQ---PLGKVLK------------GYGNNGE-----------------
GATD_STRR6            FENHQGRTFLSDDQ--KPLGQVVY------------GNGNNEE-----------------
F9VD97_LACGL          FENHSGITYLGEGE--KALGKVVY------------GGGNNPD-----------------
K8E2G6_CARML          FENHNGMTFLGKGE--KPLGVVQQ------------GKGNNGE-----------------
Q38WJ1_LACSS          FENHNGRTFLGKDE--KPLGYVKR------------GHGNNGE-----------------
F9UQS8_LACPL          FENHNGMTFLGEGE--RPLGQVLQ------------GNGNNGK-----------------
A0A0R2H0I4_WEIVI      FENHQGRTFLDDKE--RPLGMVKQ------------GKGNNGE-----------------
Q5FHZ2_LACAC          FENHSGQTYFDDTDKLHPLGNMIE------------GYGNNPQ-----------------
A0A0F4LP02_9LACO      FENHSGQTYFDDSDKLHPLGEMIE------------GYGNNPQ-----------------
Q74HI3_LACJO          FENHSGQTYFDNTNMLHPFGEMIE------------GYGNNPQ-----------------
A0A0H4QKW2_9LACO      FENHSGRTYFDDKKKLKPLGKMIQ------------GYGNNPE-----------------
Q97KF8_CLOAB          FENHSGRTYINDLK---PFGKTIV------------GYGNNGS-----------------
A5HYV4_CLOBH          FENHSGRTYIGNLK---PLGKVIA------------GYGNNGE-----------------
S0FLI5_RUMCE          FENHSGRTYLGEGI--RPLGKVLS------------GSGNNGT-----------------
D2Q7Q5_BIFDB          YENHSGQTFLREGV--QPLGHVEAD-----------GTGNNGE-----------------
A0ZZL6_BIFAA          YENHSGQTFLRDGV--QPLGTVEQD-----------GTGNNGE-----------------
B8DVI5_BIFA0          YENHSGQTFLREGV--QPLGTVDGD-----------GTGNNGE-----------------
H0QKT1_ARTGO          YENHSGQTTLGPGV--APLGTV-AK-----------GTGNNSS-----------------
W0Z9J5_9MICO          YEYHLRDYVLGEDE--RPLGTVASG------------TGNIGTVQSG-------------
A0A0Q5B8R2_9MICO      FENHVRRFEGIDPG--SVLGRVLHG------------VGD--------------------
B0RC13_CLAMS          YENHGSTLEIGEH---APLGMVRAG------------FGNAG------------------
Q83MU5_TROWT          FENHDIEITDNEHPLGYGLDSRGTF-----------------------------------
                      :  *                                                        

D7GCQ1_PROFC          --GDGTDGAVQGRVMGIYPHGPLLPRNPLLADYLLGVALDRR---LEPLPNEQ-------
Q6A776_CUTAK          --NRRDEGAVQGRVIGTYPHGPVLVRNPQLADHVLEMALGSR---LEPLDIP--------
A0LVL7_ACIC1          --GKPAEGAVQGRIIGTYLHGPGLARNPDLADLLLSMAVGTP---LPPWPQP--------
Q5Z348_NOCFA          -----REGVVQGSVIGTYMHGPALARNPELADLLLCRALGVD--SLPPLDL---------
D0LDF5_GORB4          -----TEGVVQGSVIGTYMHGPALARNPELADHLLAQAIGTD--ALAPLEL---------
F5YT07_MYCSD          -----FDGAVQGSVVATYLHGPCLARNPELADLLLSKVVG----ELAPLEL---------
B1VIS1_CORU7          R----YEGAVQGSVIATYMHGPALARNPQLADVLLARALGTTVAELPELGAGSIAEFEGV
G0HFG6_CORVD          Y----HEGAVQGSVIATYMHGPVLARNPQLADLLLAKATGVALADLPPMTG---------
Q8NTQ7_CORGL          F----AEGAVQGSIIATYMHGPALARNPQLADLMLAKAMGVALKDLEPLDI---------
D7BLC5_ARCHD          FDGKPTDGIVQGSIFATYMHGPVLARNPQFADMLLALAIGVDVKDLAPVHV---------
K0JUR2_SACES          -----VEGAVQGRILCTYLHGPVLPRNPQLADLLIKWATGDE---LAPLDL---------
G0G5G3_AMYMS          -----TEGAVTDRVVGTYLHGPALARNPALADLLLAWTIGHP---LAPLRL---------
E2Q9G3_STRCL          --GDGTEGAFHDTVFGTYLHGPVMARNPQFADLLLKLALD--VNALPPTDD---------
I2MUN5_STRT9          --GDGTEGAYNETVFGTYMHGPVMARNPQIADLLLKLALD--VNALPPVDD---------
E8WDD0_STRFA          --GDGTEGAYNDTVFGTYMHGPVLARNPLIADHLLKLALD--VNALPPSDD---------
D5ZVE2_STRV1          --GDGTEGAYNDTVFGTYMHGPVLARNPQIADLMLKLALD--VNALPPTDD---------
J7LFU5_NOCAA          --DDRTEGAYQGQILGTYLHGPALPRNPQLADLLLRWRV----GALNPLPP---------
D1A4K9_THECD          --GDGTEGAYADHVIGTYMHGPALVRNPGLADLLLRWAIK---DELPPLPE---------
F4FHS4_VERMA          --DGATEGAWRGKLLGTYSHGPALARNPALADLLLRWATGAQQ--LPPLDD---------
D9T691_MICAI          --DGATEGAWRGKLLGTYSHGPALARNPDLADLLLRWATGIHQ--LPPLDD---------
I0H145_ACTM4          --DGQTEGAWAGKILGTYSHGPALARNPAIADLLLRWSTGADR--LAPLDD---------
D3Q766_STANL          --DGSTEGAWSGKMVGTYLHGPALARNPGLADQLLAWAIDRDRDELPELDD---------
A8KY77_FRASN          ---ARTDGIVDGKVIGTYLHGPVLAQNPALADLLLTWVHGR----LAPLDAP--------
F8AX29_9ACTN          ---DHTDGVVDGRVIGTYLHGPVLAQNPALADLLLSWVHGW----LPELAGP--------
A5D1R1_PELTS          ---DGTEGARYKNVFCSYLHGPLLPKNAGLTDYLISLALR-RRGCNRELTPLDDSFE---
D5WQJ9_KYRT2          ---DGTEGARKGRVFGTYLHGPLLAKNPRLADRLLGLALE-RRG-AEKLRALADRWE---
A9WBM8_CHLAA          ---DRKGGVIYRNTFGCYLHGALLPKNPQLTDHLIELALRRRYGSQYVLPPLPAERE---
GATD_STAAN            ---DKKEGIHYKNLLGTYLHGPILPKNYEITDYLLEKACERK-GIPFEPKEIDNEAE---
Q2FX00_STAA8          ---DKKEGIHYKNLLGTYLHGPILPKNYEITDYLLEKACERK-GIPFEPKEIDNEAE---
GATD_STAAC            ---DKKEGIHYKNLLGTYLHGPILPKNYEITDYLLEKACERK-GIPFEPKEIDNEAE---
Q2NGS5_METST          ---DGVEGVVYKNYIGTYLHGPILPKNPHVADYLILKALQNK-YEVESLEKLDDTIE---
E9SCT7_RUMAL          ---SSVEGYTEKNVTATYLHGPLLSKNPRLADHIISYCMTRKTGQPYKPEQINDKLE---
K9QU31_NOSS7          ---DGTEGAFYQNAIATYSHGPLLPKNPFVADWLIQTALRLKYQQPITLKPLNDDLA---
Q8YTJ9_NOSS1          ---DGTEGSFYQNAIATYSHGPLLPKNPFVADWLIQTALRLKYQQAITLQALDDSLA---
A0ZIX1_NODSP          ---DGTEGAFYQNAIATYSHGPLLPKNPFVADWLIQTALRLKYQEHISLSPLDDSLA---
K9Z0J4_CYAAP          ---DGYEGAFYQNAIATYAHGPLLPKNPFLADWLIIKAIEHKYQEKISLNPLDDYLA---
B1XJM2_SYNP2          ---DGWEGAFYQKAIATYAHGPLLPKNPFLADWLLEKALERKYNTEIHLDPLDDQLA---
GATD_STRR6            ---KVGEGVHYKNVFGSYFHGPILSRNANLAYRLVTTALKKKYGQDIQLPAYEDILS---
F9VD97_LACGL          ---DDTEGLHYKNTFGTYFHGPILSRNARLAYRLVTTALYQKYGQDLELPAFEEILA---
K8E2G6_CARML          ---DKTEGAIYKQTYCSYFHGPLLVKNTILADRLLHAAMDR-------------------
Q38WJ1_LACSS          ---DGTEGCVYKNTFGSYFHGPILTHNGVLAKRLLTTAISRRFPEFDLQPLTDLPIE---
F9UQS8_LACPL          ---DQSEGVIYKNTFGSYFHGPILARNEALAKRILKLALQRKYPE---------------
A0A0R2H0I4_WEIVI      ---DGGEGLVYKNTYGTYFHGPILTRNGNLALRMLQKMLERRYPD---------------
Q5FHZ2_LACAC          ---DHVEGLRYRNFIGSYSHGPLLK-NTNVANAIMKMIIAWHNER---------------
A0A0F4LP02_9LACO      ---DHVEGLRYRNFIGTYSHGPLLK-NLNVANAIVKMILSWHDER---------------
Q74HI3_LACJO          ---DKVEGLRYKNFIGSYSHGPLLR-NTNVANAIVKMILERHKER---------------
A0A0H4QKW2_9LACO      ---DKAEGMRYKNTIGSYSHGPILK-NENIARAIANEIIQSHNDR---------------
Q97KF8_CLOAB          ---DGYEGCIYKNTYCTYFHGSLLSKNPELADRFIKTALELKYKKEIILDPIDDSL----
A5HYV4_CLOBH          ---DQEEGCIYKSTFCTYFHGSLLSKNPELADRLLSTALKNKYGEDINLEPLDDNL----
S0FLI5_RUMCE          ---DGYEGAVYNNVYCSYSHGSLLPKNPQLTDHLLTLALKQKYTDFDTLGQLDDTF----
D2Q7Q5_BIFDB          ---DHTEGARVNNVIGTYMHGSLLPKNPAIADFLIRTAVERRYGTFDPVAVGQTSAQ---
A0ZZL6_BIFAA          ---DHTEGARVHNVIGTYMHGSLLPKNPAIADFLIRTAVERRYGTFDPAAAGQTDAQ---
B8DVI5_BIFA0          ---DHTEGARVHNVIGTYMHGSLLPKNPKITDFMIRTAVERRYGAFDPE---QTDAQ---
H0QKT1_ARTGO          ---DGQEGARYRNIVASYLHGSLLPKNPAIADFLIRTAVERKYGTFTPG-----------
W0Z9J5_9MICO          --AARFEGAVRGTAYGTGIRGPVLARNPVFADHLLELAAAHAGLALANGAPAGPLTT---
A0A0Q5B8R2_9MICO      --GNGVEGYLAGSLLGSHLNGPVLAKNPVLADRILQRVAERHGLGYE--ATDLRLRQ---
B0RC13_CLAMS          --QGGGEGVRVGASVGTHLGGPVLALNPRLADDLLSAALARHGLELP-ADISGTLDR---
Q83MU5_TROWT          ---SRPHGFFLGNLMACFLHGAFLPLNPIVADWFLSRMGGCATAHSVDNDCNPKQS----
                             *            *. :  *  .:  .                          

D7GCQ1_PROFC          -------------------------------------------------------VNDEL
Q6A776_CUTAK          ----------------------------------------------------------EI
A0LVL7_ACIC1          ----------------------------------------------------------EI
Q5Z348_NOCFA          ---------------------------------------------------------PEV
D0LDF5_GORB4          ---------------------------------------------------------PEV
F5YT07_MYCSD          ---------------------------------------------------------PEV
B1VIS1_CORU7          PAGDAGAGGAGAGNGADAGSSAGAGAGHGAGAGDGAGAGTGAGAGSPDGREFAAQLAAEV
G0HFG6_CORVD          --------------------------------------------------VFAEQLVGEV
Q8NTQ7_CORGL          ---------------------------------------------------------DVI
D7BLC5_ARCHD          ---------------------------------------------------------PSI
K0JUR2_SACES          ---------------------------------------------------------PAV
G0G5G3_AMYMS          ---------------------------------------------------------AEV
E2Q9G3_STRCL          ---------------------------------------------------------RWY
I2MUN5_STRT9          ---------------------------------------------------------RWY
E8WDD0_STRFA          ---------------------------------------------------------RWY
D5ZVE2_STRV1          ---------------------------------------------------------RWY
J7LFU5_NOCAA          ---------------------------------------------------------AWG
D1A4K9_THECD          ---------------------------------------------------------SWA
F4FHS4_VERMA          ---------------------------------------------------------TWA
D9T691_MICAI          ---------------------------------------------------------TWA
I0H145_ACTM4          ---------------------------------------------------------TWA
D3Q766_STANL          ---------------------------------------------------------SWI
A8KY77_FRASN          ---------------------------------------------------------VEA
F8AX29_9ACTN          ---------------------------------------------------------PET
A5D1R1_PELTS          ----------------------------------------------------DRARDVML
D5WQJ9_KYRT2          ----------------------------------------------------EAAREHLA
A9WBM8_CHLAA          ----------------------------------------------------LAAQRAMV
GATD_STAAN            ----------------------------------------------------IQAKQVLI
Q2FX00_STAA8          ----------------------------------------------------IQAKQVLI
GATD_STAAC            ----------------------------------------------------IQAKQVLI
Q2NGS5_METST          ----------------------------------------------------YLAHEKFL
E9SCT7_RUMAL          ----------------------------------------------------AECRKVLL
K9QU31_NOSS7          ----------------------------------------------------AQAREAMF
Q8YTJ9_NOSS1          ----------------------------------------------------MQAREAMF
A0ZIX1_NODSP          ----------------------------------------------------LQARSAML
K9Z0J4_CYAAP          ----------------------------------------------------DNGRKAML
B1XJM2_SYNP2          ----------------------------------------------------RQARQTMF
GATD_STRR6            ----------------------------------------------------QE-IAEEY
F9VD97_LACGL          ----------------------------------------------------HEEKGQQI
K8E2G6_CARML          ------------------------------------------------------------
Q38WJ1_LACSS          ----------------------------------------------------ESRYQVDA
F9UQS8_LACPL          ----------------------------------------------------GNFDALDQ
A0A0R2H0I4_WEIVI      -------------------------------------------------------VDWAS
Q5FHZ2_LACAC          ------------------------------------------------------------
A0A0F4LP02_9LACO      ------------------------------------------------------------
Q74HI3_LACJO          ------------------------------------------------------------
A0A0H4QKW2_9LACO      ------------------------------------------------------------
Q97KF8_CLOAB          ------------------------------------------------------EFKAKE
A5HYV4_CLOBH          ------------------------------------------------------EIKAKE
S0FLI5_RUMCE          ------------------------------------------------------ETAARS
D2Q7Q5_BIFDB          ----------------------------------------------------KAALNRIN
A0ZZL6_BIFAA          ----------------------------------------------------RAALHRID
B8DVI5_BIFA0          ----------------------------------------------------RAELARID
H0QKT1_ARTGO          --------------------------------------------------------EPDD
W0Z9J5_9MICO          -------------------------------------------------------ADDHA
A0A0Q5B8R2_9MICO      -------------------------------------------------------ADDTA
B0RC13_CLAMS          -------------------------------------------------------LDGWA
Q83MU5_TROWT          --------------------------------------CDNRYCCAQPSATDLDFYSHMA
                                                                                  

D7GCQ1_PROFC          ATLRHQRINVVRHTKSLSEDTRWLGERS
Q6A776_CUTAK          TALRQRRIEAVRTDRS------------
A0LVL7_ACIC1          EALRAERLASLRG---------------
Q5Z348_NOCFA          TQLRRERLRA------------------
D0LDF5_GORB4          DRLRRERLAAGRRG--------------
F5YT07_MYCSD          EMLRAERLGAPRRV--------------
B1VIS1_CORU7          EQLRKERLG-------------------
G0HFG6_CORVD          ATLRAERMRA------------------
Q8NTQ7_CORGL          DRLRAERLA-------------------
D7BLC5_ARCHD          AELRTEREAFIS----------------
K0JUR2_SACES          DRLRVERAKAAGV---------------
G0G5G3_AMYMS          ERLREERLAVPRRRRGA-----------
E2Q9G3_STRCL          EALRDERIAAATQPA-------------
I2MUN5_STRT9          EALRNERITAATQPA-------------
E8WDD0_STRFA          EALRAERIAAATQPA-------------
D5ZVE2_STRV1          EALRGERIAAAQQSA-------------
J7LFU5_NOCAA          ERLHDERLAAALR---------------
D1A4K9_THECD          DRLREERLKAVLG---------------
F4FHS4_VERMA          DRLRAERRTAVAAAARP-----------
D9T691_MICAI          DRLRSERRTAVAAAPRP-----------
I0H145_ACTM4          DRLRQERLEAASAV--------------
D3Q766_STANL          GKLRAERFAALAPA--------------
A8KY77_FRASN          DMLRRARARALAGG--------------
F8AX29_9ACTN          EVLRQARLHALDVHA-------------
A5D1R1_PELTS          ARLGLGRR--------------------
D5WQJ9_KYRT2          RRLAELEGMESPHVGTGGAKK-------
A9WBM8_CHLAA          QRLLTR----------------------
GATD_STAAN            DRANRQKKSR------------------
Q2FX00_STAA8          DRANRQKKSR------------------
GATD_STAAC            DRANRQKKSR------------------
Q2NGS5_METST          KLYNK-----------------------
E9SCT7_RUMAL          ERLLKK----------------------
K9QU31_NOSS7          KKLKVNLPN-TTVAKV------------
Q8YTJ9_NOSS1          KKLQVNPPRPSAVAKV------------
A0ZIX1_NODSP          HRLKVSLPN-PAIAKV------------
K9Z0J4_CYAAP          KRMLNQ----------------------
B1XJM2_SYNP2          QRLTLSVSSSPV----------------
GATD_STRR6            SDVKSKADFS------------------
F9VD97_LACGL          MDAKRKVEHYEH----------------
K8E2G6_CARML          ---KKQKN--------------------
Q38WJ1_LACSS          AGVKKVQN--------------------
F9UQS8_LACPL          LNEDLTKNVIVKP---------------
A0A0R2H0I4_WEIVI      RVSEIEPEFY------------------
Q5FHZ2_LACAC          --TNKPATVTE-----------------
A0A0F4LP02_9LACO      --VSA-----------------------
Q74HI3_LACJO          --TANEVESV------------------
A0A0H4QKW2_9LACO      --LAQTN---------------------
Q97KF8_CLOAB          FVINRETNTK------------------
A5HYV4_CLOBH          FIIHRESKA-------------------
S0FLI5_RUMCE          SVIERILKNI------------------
D2Q7Q5_BIFDB          EVAQRARRVAMSRPR-------------
A0ZZL6_BIFAA          EIADRARRVAMSRPR-------------
B8DVI5_BIFA0          EYAAHAREAAATRPR-------------
H0QKT1_ARTGO          RYAVLAREHAARRPR-------------
W0Z9J5_9MICO          AKANVIVRRALGLSA-------------
A0A0Q5B8R2_9MICO      RAAREVIAKRLGVGR-------------
B0RC13_CLAMS          QEARATVMARPAHY--------------
Q83MU5_TROWT          RRVIKKRVTRAIRYKFIPGK--------