CLUSTAL format seed alignment for MF_02214

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURT_STRR6            ---------------------------MNLKTTLGLLAGRSSHFVLSRLG-RGST-LPGK
T1ZDJ2_STRIT          ---------------------------MKINTALGLLAGKSSHFVLSKMG-RGST-LPGK
A4VWE8_STRSY          ---------------------------MKINTALGILAGKSSQFILKKLG-RGTT-LPGK
F9VD98_LACGL          ---------------------------MTMKTSFATLAGKSSRLVLEKIFKRGST-LPGK
C9AB20_ENTCA          ---------------------------MGIRSHLAVSVGKTSQWVLKNFFKGGSS-LPGK
G4L4D1_TETHN          ---------------------------MGFRSYIASFVGKSSQWFLKTFTKGGSS-LPGK
C2D415_LACBR          ------------MFIEFERLHQKEQKFMSLKSSIATAAGKSSYWFLHTFL-KGGSSLPGK
F9UQS7_LACPL          ---------------------------MSINSTLATWTGKSAYWFLHTFR-GGGSSLPGK
Q74K27_LACJO          ---------------------------MNLKSGIAKVAGKSSYWFLHNVL-KGGTSFPGK
F8HZ51_WEIKK          ---------------------------MTFRSSLATFAGRLTYLSLTKVLHRGGTSLPGM
C5R966_WEIPA          -----------------MISKHKQEDNMSLKSGLATLVGKGTYAVLHDVLHRGGTSLPGK
D9SST9_CLOC7          ------------------------MIKIGFRSFISIISSKVLGTISKKLF-KGGTNFPGR
A5HYV5_CLOBH          ------------------------MCKINIKSFFSIIISKMVLKLSKTLF-KGGTNFPGK
Q8XL54_CLOPE          ------------------------MFKIAIKSYLSIILSKMTQFISKKVF-KGGTNFPGK
MURT_STAAC            -----------------------------MRQWTAIHLAKLARKASRAVG-KRGTDLPGQ
Q2FWZ9_STAA8          -----------------------------MRQWTAIHLAKLARKASRAVG-KRGTDLPGQ
MURT_STAAN            -----------------------------MRQWTAIHLAKLARKASRAVG-KRGTDLPGQ
F6B3J3_DESCC          ---------------------------MRIRLIIAIWAAKLAAFLSQKFG-WKGSSLPGV
F4LWL4_TEPAE          -----------------------------MRRILAVIAAKMTSALAKLTG-HQGTNIGGE
R5VS95_9FIRM          --------------------------MSSFRFHVALAAAKLSKGLIQLLGRN-GTHTPGV
A0A1G4SKQ8_9FIRM      ---------------------------MGVRFIAALWLAKLSIPALKITGHN-GTDFPGS
R5KFY8_9CLOT          ------------------------MYKKNVRFFFALFMGKLARTMQRMLKMN-ASYFPGK
H6LDB0_ACEWD          -----------------------------MKFYFALWFAKLMGLAIKLVSKDRGTNLPGE
E3GNJ9_9FIRM          -----------------------------MKFYLALWYAKAINGLINLVSKGRGSNLSGE
K9Z1X9_CYAAP          -------MAQFVIAHKLTHLIIGMNIVERLRLGLAVATAKIVTGLVKTFKLGAASVLPGE
E0UKE0_GLOV7          -----------------------MQVLDQIRLGLAVAVAKTVTSLVRVLRLGSASVLPGE
K9ZP66_ANACC          -------------------MGKKIQLIDRVRLGLAVSIAKSVTFLVRSLRLGAASVLPGS
K9U9A2_CHAP6          ---------------------MQINLLDRIRLGIAVFAAKTITSTIRTFKLGAASVLPGT
B1XIK7_SYNP2          -----------------------MAILRSVRLAIACGLGKTITAVVRGLKLSAGSVLPGA
A5UQM1_ROSS1          -------------------------MMFDVRLFLAITAGQSAGIASRMLRRGGGTTLPGL
D3FEX1_CONWI          --------------------------MAGLPLGPKLAVARAVGSVARRAGRGGGTSLPGK
Q0S8X7_RHOJR          ------MSTGTGITTR---------------GKLALRAAAAASWASQKAGRGKGSMIGGL
E9SXE2_RHOHA          ------MGTSTRINLR---------------GRLAMRAAAAAAWASQKAGRGKGSMIGGL
U5EEB7_NOCAS          ---------MADISVR---------------GRLALRAAAAASWASQKAGRGKGSMIGGL
G8RQS2_MYCRN          -----------MVTIR---------------GRAALAAGAGARWASRITGRGAGAMIGGL
Q6NJX8_CORDI          ----------MSFNLR---------------TRLAIGAAAVATTASRATGRGSGGMIGGL
C3PJQ7_CORA7          ----------MNFNFRSAFSSA--------RTAVATTAAALATTASRATGRGAGGMIGGL
F8DXS6_CORRG          ---------MVGVNKAETPRTGKGRKQMSLRSRVATAAADAATWASRKTGRGAGGMIGGL
G0G5G4_AMYMS          -----------------------------------MAAGRLTAWLSRSSGLGRGGMIGGR
A8KY78_FRASN          ----------MMTPLPRRRFSA--------RTQAALAVERLAAEASRRLGRGSGEMIGGK
A0LVL8_ACIC1          ----------MSAAL---------------RLRTAVRLGRLAGVLSRALRRGDGMVISGR
G2NNC6_STREK          --------------------MAGNTEPLSPRAKLAVTAGKAAAAVSRAAGRGSGSVIGGR
F2RA08_STRVP          -----------------MSGHPGNPEPLSPRAKLAVTAGRAAAAVSRAAGRGSGSVIGGK
K4RE05_STRDJ          --------------------MAGNSDPLTPRAKIAVTAGKAVAAASRAAGRGSGSVIGGR
Q9FCA1_STRCO          --------------------MAGNSDPLTPRAKIAVTAGKAVAAASRAAGRGSGSVIGGR
S5VC22_STRC3          --------------------MAGNSDPLSPRAKLAVTAGKAVAAASRAAGRGSGSVIGGR
E2Q9G2_STRCL          -------------MQGGSRTMSGNSE-LSPRAKLAVTAGRAAAAVSRAAGRGSGSVIGGR
E4N655_KITSK          --------------MPGTDSEAPRDASLPARAKIAVTAGKMAAALSQKAGRGSGSVIGGK
Q47LC5_THEFY          ------------------------MSELPLRAQLAAALGRGAASLSRATGRGDGSVIGGR
F4FHS3_VERMA          -------------------------------------MSRTAAALSRAAGRGDGSVIGGW
I0H146_ACTM4          ---------------------------MPLIAKVATTASKTAAALSRAAGRGDGSVIGGW
D7GCQ2_PROFC          -MPSNSSRPAPGRAQPINALPFGTGLGRRVWRDAAIGLGNLAALASRAAGRGTGTSIRGQ
F5XQ41_MICPN          ------------------------------------------------MGRGAGTAIKGA
A0JXB6_ARTS2          ------------------------------MLYISVPLGKLVRRVSRLR--GGGSALPGL
F0M2I5_PSEPM          ---------------------MPLLGYIQNMLSFSVPLGKLVRRVSRLR--GGGSALPGL
A1R729_PAEAT          MAQAFRYAVCGHQALPAVRVPCPDWDILQSMLSFSVPLGKLVRTLSRLR--GGGSAFPGL
B0RC12_CLAMS          -----------------MPLPLPLPLPLPLPLRLAVAAGRAARWAARLR--GGGSAVPGV
Q6AFF8_LEIXX          -----------------------------MRYRLAVIAGRLARWLLRLR--GGGSAVPGR
A0A2T0VG40_9MICO      ----------------------------MIRDYVAVFAGRSVAALLHVVRPGGGTALPGT
A0A0Q5E0Y2_9MICO      -----------------------------MRYAPAILAGRAVRFLARLRKPGGGSAVPGL
E4Q3C5_CALOW          --------------------------MEKIKLYIAILLGMIVKLMLKLFG-QDATSAPGK
A0A0A8W970_PAESO      -------------------------------MRIKIILIKLLILFLELFG--KGGSLPGK
Q83MU4_TROWT          -----------------------------MRGCLAIFFGRALLVALRVLR-SGGSVLPGV
G4KZB7_OSCVS          -----------------------------MKKFFAILVCKLGRFVGKLVG--RGSSLPGK
                                                                                * 

MURT_STRR6            VALQFDKDILQSLAKNY--EIVVVTGTNGKTLTTALTVGILKEVY----GQVLTNPSGAN
T1ZDJ2_STRIT          VALTFDKNILQNLAKNY--EVVVITGTNGKTLTTALTVGILKEAF----GEVVTNPSGAN
A4VWE8_STRSY          IALKFDKHILDSLAKDY--EVVVVTGTNGKTLTTALTVGILQEAF----GEITTNTSGAN
F9VD98_LACGL          IALKFDPEILATLTKDY--EIIVVTGTNGKTLTTALTVGILEKAF----GKVVTNTSGAN
C9AB20_ENTCA          LALKVDPHILDHLAKDY--QVVVITGTNGKTLTTALTVNILRQEF----DEVLTNPTGAN
G4L4D1_TETHN          LALKIDPAILDRLASDY--KVVVVTGTNGKTLTTALTVNILQQEF----DDVLTNPTGAN
C2D415_LACBR          ITKKLDPDILATLGRNY--DVIVITGTNGKTLTTALTVQVLKEKY----ENILTNPTGSN
F9UQS7_LACPL          LALKLDPTILKHLAKNY--DVIVITGTNGKTLTTALTVKVLREQY----PDILTNPSGSN
Q74K27_LACJO          FAMKIDPEVLNSLAKGY--ETIIVTGTNGKTMTTALIVEALKKKY----GDILTNPSGSN
F8HZ51_WEIKK          VATKIDPNVLQTIADRY--DVVLVTGTNGKTLTTALITRVLREKY----ARVITNPSGSN
C5R966_WEIPA          LATKIDPNVMQSYAEKY--DVILITGTNGKTLTTTLTTRVLREKY----ADVITNPSGSN
D9SST9_CLOC7          IALKIKKDILKDITKGY--KIILVTGTNGKTTTTSMIYNMLKDSG----LDVITNATGAN
A5HYV5_CLOBH          VALKLDKKILKTVAKDY--KVILVTGTNGKTTTTSMIYNMIKDSN----KFVISNSTGAN
Q8XL54_CLOPE          VALKIDRNILKVVSKNY--KVILVTGTNGKTTTTSMIYNVLKGNG----LDVITNATGAN
MURT_STAAC            IARKVDTDILRKLAEQV-DDIVFISGTNGKTTTSNLIGHTLKANN----IQIIHNNEGAN
Q2FWZ9_STAA8          IARKVDTDILRKLAEQV-DDIVFISGTNGKTTTSNLIGHTLKANN----IQIIHNNEGAN
MURT_STAAN            IARKVDTDVLRKLAEQV-DDIVFISGTNGKTTTSNLIGHTLKANN----IQIIHNNEGAN
F6B3J3_DESCC          VARKLYQGTLRDLASQARKGVIMVTGTNGKTTTNNMIANVIKAGG----FRIVVNQEGAN
F4LWL4_TEPAE          LALRLCPDILTWFGSKVKDKIIFVTGTNGKTSTNNMIYSIIRQSG----HSCVCNQLGAN
R5VS95_9FIRM          IALKICPDFLAQAPKAP--LTICVTGTNGKTTCSNLITDVLEKDG----RRVVSNRTGSN
A0A1G4SKQ8_9FIRM      LALKICPDFLERIGKPE--TIIAVTGTNGKTTCANMICDAFEAQG----RKVLCNRYGSN
R5KFY8_9CLOT          LAVKLCPDFMGCIDKPK--TIITVTGTNGKTTVCNMIIDILEANG----YDVLNNRAGSN
H6LDB0_ACEWD          KALLIDPRFVKHFKNIDYAKVIFITGTNGKSSTTNLVTHILKENG----KKIVSNLEGAN
E3GNJ9_9FIRM          KALKVDPRMVEHFKGIDYSKVVFITGTNGKSSTTNLVTHILRENG----KTVVSNLEGAN
K9Z1X9_CYAAP          ISRRLYPRLLQLLSQQFRGGLILVVGTNGKTTTSLLLKDILVHKG----YKVIHNSTGAN
E0UKE0_GLOV7          IARRLHPRLLSLLSQQVSQGIIFIVGTNGKTTTSLLLRTILESQG----WRVTHNETGAN
K9ZP66_ANACC          IARRIEPQILQLLSQQVKNGIILIAGTNGKTTTALLLCTILEHKG----YKIAHNSTGAN
K9U9A2_CHAP6          IGKRLHPQILTMLSQQIKYGVIVVAGTNGKTTTSLLLRDILEKDG----WKVVHNEAGAN
B1XIK7_SYNP2          IARRIFPEILPDLFQQAKKGVILVVGTNGKTTTSLLIKAILTAQG----YKLAHNATGAN
A5UQM1_ROSS1          VARRIDPHTLRKLTARLPQGVALLSGTNGKTTTTRMIAATLAADG----RALLHNRAGAN
D3FEX1_CONWI          VLMKLDPHAIGALASRLPEGSVAISATNGKTTTAAMVASVLERRG----TPLVHNRAGAN
Q0S8X7_RHOJR          IALKIDPTLMEQLGAGRR--TAVITGTNGKSTTTRMTAAALSTLG-----EVATQADGAN
E9SXE2_RHOHA          IALKIDPTLMQQLGRGRR--SVVITGTNGKSTTTRMTAAALATLD-----EVATQADGAN
U5EEB7_NOCAS          IALKIDPTIMTQLGRGRR--TVLITGTNGKSTTTRMTTAALGSLG-----QVATQADGAN
G8RQS2_MYCRN          VAMTLDKSILGQLGDGRR--TAIVTGTNGKSTTTRMTAAALGTLG-----PVATNAEGAN
Q6NJX8_CORDI          IAEKIDPNIMQSLAKTRP--TALVTGTNGKSTTTRMLASAVRAQH-----TVATNEGGDN
C3PJQ7_CORA7          IANAIDPTIMQNLANQRP--AILVTGTNGKSTTTRMLAAAVRAEH-----TVATNDGGDN
F8DXS6_CORRG          IAGAIDPNLLTNLGGDRP--VALITGTNGKSTTTRMMTAAVRTAT-----SVCTNEGGDN
G0G5G4_AMYMS          VTLALDPAALRRLGRERT--VVIVTGTNGKTTTSLMLTRALETLA-----EVAANSDGSN
A8KY78_FRASN          LALRIAPDALAEVGSNRL--TACVSATNGKTTTTRLLARALGTLG-----PVKSNSGGAN
A0LVL8_ACIC1          VALAACPDAFRQLTAVRP--VTFVSATNGKTTTTRLLAAALRTAG-----PVVTNLSGAN
G2NNC6_STREK          VALKLDPDLLGRLAQHLD--VILVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
F2RA08_STRVP          VALRLDPDLLGRLAQHLD--VVLVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
K4RE05_STRDJ          VALKLDPDLLARLAQNLD--VVLVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
Q9FCA1_STRCO          VALKLDPDLLGRLAGHLD--VTLVSATNGKTTTTRLIAEALKAAG-----PVVSNALGAN
S5VC22_STRC3          VALKLDPDLLGRLAQNLD--VVLVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
E2Q9G2_STRCL          VALKLDPDLLGRLAQHLD--VVLVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
E4N655_KITSK          VALKLDPDLLATLTEHLD--VVLVSATNGKTTTTRLIAEALRAAG-----PVVSNALGAN
Q47LC5_THEFY          IALKVEPNLLAELARGRR--IALISATNGKTTTTRLIAAALREIG-----EIATNEHGAN
F4FHS3_VERMA          IGLKIDPDLLAHLSAGRA--IALISGTNGKTTTTRLAAAAVGVLG-----RVATNSFGAN
I0H146_ACTM4          IGLKIDPDLLAHLSSGRA--VALVSGTNGKTTTTRLTAAAVGVLG-----RVATNSFGAN
D7GCQ2_PROFC          VITKLYPPAFDELIAGRR--IAAVSGTNGKTTTTHLLTAALRAVK--GDQNVVTNADGAN
F5XQ41_MICPN          VMLKIAPQALEQLLAGKH--LAMVSGTNGKTTTTHFLAAAVRAGLDPGGTRVVHNADGAN
A0JXB6_ARTS2          VVEKIDPGFMQRTLSTLPLGVAVVSGTNGKTTTTKMVVELLESQG----LKVFTNRTGSN
F0M2I5_PSEPM          VVEKIDPGFMRRTLTTLPHGVAVVSGTNGKTTTTKMVVELLESQG----LKVFTNRTGSN
A1R729_PAEAT          VVEKIDPGFMQRTLASLPLGVAVVSGTNGKTTTTKMVVELLESQG----LKVFTNRSGSN
B0RC12_CLAMS          VALRLDPRFLERTIADLPHGVVAVTGSNGKSTTTHMLTAVLRAHG----LRVFTNPSGGN
Q6AFF8_LEIXX          VALAIAPRFLERAVSRLPLGVVFVSGSNGKSTTTNMLTGILREHG----LSVFTNPSGGN
A0A2T0VG40_9MICO      VAHRISPRLLARVLQGPREGIVVVTGSSGKSTTTQMVVGILRQHG----LTVFTNNRTAN
A0A0Q5E0Y2_9MICO      VVNRVAPGFLPDTLNSFPRGLVIVSGSSGKSTTTKMLVGILRAHQ----VSVFTNPSTAN
E4Q3C5_CALOW          IALKIYPGIMKEINKRSK-LKILISGTNGKTTTNNIINWLIGNDK-----IVLSNLKGSN
A0A0A8W970_PAESO      LALKMDKNLFDKFNYPKN--VVLITGTNGKTTINNLIFESLKKAN----VNIISNIKGNN
Q83MU4_TROWT          LAEFISPGILIRLIGNSE--IIFVTGSNGKTSTTRMAVSILRAHG----HEVFTNSSGAN
G4KZB7_OSCVS          YALKICPDILRQVTLPRY--IIAVTGSNGKTSTVEMIAAILRAEG----KNVVYNEEGSN
                               .             : .:.**:    :    .             :    *

MURT_STRR6            MITGIATTFLTAKSSKTGKN--IAVLEIDEASLSRICDYIQPSLFVIT-NIFRDQMDRFG
T1ZDJ2_STRIT          MISGITTTFLTAKKGKSTKN--IAVLEIDEASLSRICDYIKPSLFVFT-NIFRDQMDRYG
A4VWE8_STRSY          MITGITATFLSAKKNKNGKK--IAVLEIDEASLARVTDFIKPSLIVFT-NIFRDQMDRYG
F9VD98_LACGL          MITGITATFLTAPKVKKGKKG-FAVLEIDEASLPKITEYIKPSLFVFT-NIFRDQMDRYG
C9AB20_ENTCA          MVQGIVSTFLSARPK-KGKK--FAVLEIDEASLSKVTKYIKPELFVFT-NIFRDQMDRYG
G4L4D1_TETHN          MVQGIVSTFLSANPKNEQKK--FAVLEIDEASLSKVTDYIKPELFVFT-NIFRDQMDRYG
C2D415_LACBR          MEQGIITTFLHAS-RPKGKRP-LAILEVDEANVIKVTQYIKPKAFVFT-NIFRDQMDRYG
F9UQS7_LACPL          MKQGIVTTFLRAP-KAH-QKP-LAVLEVDEANVIMVTKYITPKAFVFT-NIFRDQMDRYG
Q74K27_LACJO          MQQGIVTAFLAHK-NKRAKKK-IAVLEVDEANVKMVTKLLHPSVFVLT-NIFRDQMDRYG
F8HZ51_WEIKK          MIQGIAGTMLSAKQPKKGEKV-LVVLEVDEANMEMVSAQLKPQAFVLT-NIFRDQLDRYG
C5R966_WEIPA          MMQGITGTMLTAKVTDKKQRP-VALLEVDEANVAAVAKQLKPKAFVLT-NIFRDQMDRYG
D9SST9_CLOC7          LISGIVACFINNYSFKKNKSQRYAVIEVDEANLKFITDKISPDVITIT-NLFRDQLDRYG
A5HYV5_CLOBH          MFPGIVACFVENFSFN-NKEEKYAVIEVDEANVKFITEYVSPEIITIT-NLFRDQLDRYG
Q8XL54_CLOPE          LYPGIVSTFVANYKFS-SNKERYAVIEVDEANLKFITEYITPEIITVT-NLFRDQLDRYG
MURT_STAAC            MAAGITSAFIMQST----PKTKIAVIEIDEGSIPRVLKEVTPSMMVFT-NFFRDQMDRFG
Q2FWZ9_STAA8          MAAGITFAFIMQST----PKTKIAVIEIDEGSIPRVLKEVTPSMMVFT-NFFRDQMDRFG
MURT_STAAN            MAAGITSAFIMQST----PKTKIAVIEIDEGSIPRVLKEVTPSMMVFT-NFFRDQMDRFG
F6B3J3_DESCC          LITGVTAAFVRYANWLGRINCDYALLEVDEASFPKVVNEVKPQIVVVN-NFFRDQLDRYG
F4LWL4_TEPAE          MNSGLISAFINSST-LGSFEWDYACLEVDEASLPKVMAHIKPHIIVFT-NIFVDQLDRHG
R5VS95_9FIRM          IVPGCTTNVINSLTFTGKVRVDATVFEVDERASRLILPYVKPDYLVVT-GLFRDSLKRNA
A0A1G4SKQ8_9FIRM      IATGLSTCFLQGATLTGKTKYDTAVLEIDERSAPRIFPYVVPQYLCVT-NLFRDSIMRNG
R5KFY8_9CLOT          VNAGVASSLIAGSTLTGKAKKEYAVFEVDERSSKLIYPYVKPTYAVCT-NLFRDSIQRNA
H6LDB0_ACEWD          LLSGIATILAKEASLTGKLKADYFIFETDERYLPLIFAQLPAENMLIT-NLQKDQVQRNG
E3GNJ9_9FIRM          LLPGIATILAKESTMTGKLKADYFVFETDERYLPLIYDQLPAENMLIT-NLQKDQVQRNG
K9Z1X9_CYAAP          LINGLITCLVTNSNLWGILSADYGILEVDENVLPLVLKECQPSHILAL-NLFRDQLDRYG
E0UKE0_GLOV7          LINGLITTLLGDANLIGQLKTDYAILEVDENIVPLVLEDCQPKFIVAL-NLFRDQLDRYG
K9ZP66_ANACC          LENGLATALIDNANLLGSLNVDYAILEVDENIVPKVLKPLQPRIILCL-NLFRDQLDRYG
K9U9A2_CHAP6          LVNGLITTLLENTSLTGKLKADYGILEVDENVIPIVIPQLKPKYVLAL-NLFRDQLDRYG
B1XIK7_SYNP2          LINGLTTALLEHANLFGQLDIDYAILEVDENIIPILLKTCSPTHILAL-NLFRDQLDRYG
A5UQM1_ROSS1          LVSGVTTTALAGASPDGRLRAQIALFETDEAAFPDVAAETHPRLVVLH-NLFRDQLDRYG
D3FEX1_CONWI          MAGGIASTLLGAAQGKG-IDGRLGLFEVDEFWLGGLVEQLRPRKLLLG-NLFRDQLDRYG
Q0S8X7_RHOJR          MDAGIVAALSTRV------HAPLAALEVDELHVPHVSDAVNPEALVLL-NLSRDQLDRVG
E9SXE2_RHOHA          MDAGIVAALTARP------DAPLAALEVDELHVPHVSDAVNPEVVVLL-NLSRDQLDRVG
U5EEB7_NOCAS          MDAGIVAALSVHQ------GVPLAAIEVDELHLPHVSDALDPAAVVLL-NLSRDQLDRVG
G8RQS2_MYCRN          MDAGLVAALAGTR------EATLAALEVDEMHVPHVADALDPAVIVLL-NLSRDQLDRVG
Q6NJX8_CORDI          MDAGIISALMAGQ------SASHVVLEVDELHVPSAADRLHPQCLILL-NLTRDQLDRVG
C3PJQ7_CORA7          MDAGIISALLAGK------DASHLVLEVDELHVPHVADNLNPTALVLL-NLSRDQLDRVG
F8DXS6_CORRG          MDAGVISALLAGR------DADSVVLEVDELHVPSIAEKLDADVLVLL-NLSRDQLDRVG
G0G5G4_AMYMS          MPDGVLAALTACP------DAPYAVLEVDETYVPWVADQVRPAVLVLL-NLSRDQLDRVG
A8KY78_FRASN          MAPGVLAALSKPP------YDAAAALEVDEIWLPKVARAIEPRVVLLL-NISRDQLDRSN
A0LVL8_ACIC1          MPPGLIAALLTAPD-----ASTPAVFEADETYLPTLLDQAPRRTTLVLGNLTRDQLDRVG
G2NNC6_STREK          MPAGITSALAGGS------DAKYGVIEVDEKYLAGVARDTTPKVIALL-NLSRDQLDRAA
F2RA08_STRVP          MPAGITSALAGGS------DSKYGVIEVDEKYLAGVARDTTPKVIALL-NLSRDQLDRAA
K4RE05_STRDJ          MPAGITSALAGGS------EARYGVIEVDEKYLAGVARDTDPKCIALL-NLSRDQLDRAA
Q9FCA1_STRCO          MPAGITSALAGGA------DARYGVIEVDEKYLVGVAQATDPKCIALL-NLSRDQLDRAA
S5VC22_STRC3          MPAGITSALAGGS------ESKFGVIEVDEKYLAGVARDTSPKCIALL-NLSRDQLDRAA
E2Q9G2_STRCL          MPAGITSALAGGS------DARFGVIEVDEKYLAGVARDVEPKAIALL-NLSRDQLDRAA
E4N655_KITSK          MPAGITGALAGGT------GARFGVIEVDEKYLPMVARDTRPKAIALL-NLSRDQLDRAA
Q47LC5_THEFY          MPTGHITALANNP------KALIGVLETDEKYLPQVLRETNAVVVVLM-NLSRDQMDRAS
F4FHS3_VERMA          MPTGHTSALAKAG------STPYAVLEVDEHYLAQVIEATEPHVVALL-NLSRDQLDRAK
I0H146_ACTM4          MPTGHTSALAKEG------HTPFAVLEVDEHYLAQVIESTRPKVVALL-NLSRDQLDRAK
D7GCQ2_PROFC          LREGIASAISQNM------SAPLAVLETDEQVVPELITQGHPEVLIML-NFSRDQLDRHH
F5XQ41_MICPN          LHGGITAALSDNR------SATWAIIETDERVVADMIRLGHPEVLVLL-NFSRDQLDRHH
A0JXB6_ARTS2          FTRGVAAALLGDVDWRGRLKADIAVLELDEAHAVHFVNRVPPRYSLLL-NVLRDQLDRFG
F0M2I5_PSEPM          FTRGVAAALLGEVDWRGRLDADVAVLELDEAHAVHFVNSVPPRYCLLL-NVLRDQLDRFG
A1R729_PAEAT          FTRGVAASLLGDVDWRGRLDADIAILELDEAHAVHFVNKVEPRFSLLL-NVLRDQLDRFG
B0RC12_CLAMS          LPQGIASAVLADADASGRLDADVAVLEIDEAYGVALSALLTPRTVLLL-NIQIDQLNRFH
Q6AFF8_LEIXX          LPQGIASALLAEVPLDGYVRGDVGVIEVDEAYGVDLATVLKPRASLLL-NVQIDQLNRFF
A0A2T0VG40_9MICO      ITKGLVSELLPQLNWRNRIEVDVAVLEIDEGYSAIISEMVTARVSILL-NVMIDQLHRWH
A0A0Q5E0Y2_9MICO      ISQGLTSALLERADLRGRIDADLGVLEMDEGHGALIAPRLRPAHVILT-NVSVDQIDRFH
E4Q3C5_CALOW          MANGIVSSFINNFR----SSYDIACFEVDEGSLPFVTRYLKPDIFVTT-NVFRDQLDRYG
A0A0A8W970_PAESO      LKTGIATLLCKHSDLNLNIKADVIVLEVDELTVPNLFKKLNTSVFLIS-NLFRDQLDRVG
Q83MU4_TROWT          MKYGIIASLLAVPK---RTRKGIALLEVDEGHIETLADLLKPSTALFL-NLQVDQLNRFH
G4KZB7_OSCVS          QIEGVTTTVLTHSTYGGVMKADVLLIESDERYAAHSFQFFHPTHFVVT-NLYRDQLTRNG
                         *                     :* **                   ..  *.: *  

MURT_STRR6            EIYTTYNMILDAIRKV--PTATVLLNGDSPLFYKPT--I---------PNPIEYFGFDLE
T1ZDJ2_STRIT          EIYTTYQMILDAAAKV--PEATVLMNGDSPLFNSVR--L---------KNPVRYYGFDTK
A4VWE8_STRSY          EIYTTYQMILDGAAKA--PQATILANGDSPLFNSTN--V---------INPVKYYGFATE
F9VD98_LACGL          EIYTTYDFIVKGAANA--PEATVLLNGDSPLFHSRT--L---------VNPVKYYGFDHE
C9AB20_ENTCA          EIYTTYKMIVEGAANS--PEATILCNGDSPLFNSVA--T---------VNPRKYYGFDHL
G4L4D1_TETHN          EIYTTYQLIVDGAAKS--PEATILANGDSPIFNSLE--T---------TNPRKYYGFDHE
C2D415_LACBR          EIYTTYQKILNGVALA--PNATIIANGDAPIFHSKQ--L---------PNPIIYYGFDN-
F9UQS7_LACPL          EIYTTYQKILDGVALA--PEATIIANGDLPLFNAKQ--L---------PNPILYYGFDY-
Q74K27_LACJO          EIYTTYQKIVDGIKLA--PDATIIANGDASIFSSVE--L---------PNKKVFYGFKLP
F8HZ51_WEIKK          EIYTTYDKILRGIRQF--PEATVILNADSPIFLREQ--L---------PNPVINFGFNHL
C5R966_WEIPA          EIYTTYEKILKGIRLF--PEATVIANADSPIFMRGD--L---------PNPKVYYGFEHV
D9SST9_CLOC7          EVYTTLNILLSAIKMS--PDSKLILNGDESLLGDLK--L---------PNPVSYYGFKVG
A5HYV5_CLOBH          EVYTTLKKILEGIEKS--PNSKLILNGDESLLGDLNNSL---------PNKVLYYGFSHF
Q8XL54_CLOPE          EVYTTLNKILEGVVKV--PSTTLLLNGDESLLGRLD--V---------KNPKVYYGFKVS
MURT_STAAC            EIDIMVNNIAETISN---KGIKLLLNADDPFVSRLKIAS---------DTIVYYGMKAHA
Q2FWZ9_STAA8          EIDIMVNNIAETISN---KGIKLLLNADDPFVSRLKIAS---------DTIVYYGMKAHA
MURT_STAAN            EIDIMVNNIAETISN---KGIKLLLNADDPFVSRLKIAS---------DTIVYYGMKAHA
F6B3J3_DESCC          ELDKTVQLVRDALKSL--PNVHLVLNADDPLVAQMQSTT---------GHLATYFGLASN
F4LWL4_TEPAE          EMDVLLDKIKTAIKTS--EDTVLLINADDPALVSLGDGL---------PHMKYYYGVET-
R5VS95_9FIRM          HPDYIFSVIDTYCPD----SAKVILNADE-LCSSMLKK----------DSYRVFYGIGKQ
A0A1G4SKQ8_9FIRM      HPDYIAGILDKNIPA----TTKLILNGDD-LISGRIAI----------NNPRAYYGIDKL
R5KFY8_9CLOT          NPEFIFNFINNNMPK----ESHLILNADD-LISSNLGS----------ENEKTYFSINRL
H6LDB0_ACEWD          DPEFIIRKLKEVINP----KMTLILNNEE-PRSRYFEEI---------AGRTIYYGVARH
E3GNJ9_9FIRM          DPDFIYRKLTSFMNP----KMHLYLNNEE-PRTKSFERF---------TDHVTYYGVEKH
K9Z1X9_CYAAP          EVDTISYRWQNAITPLN-KDTYIIINGDDPTLCYLGQNL---------PQKVCYFGLNEP
E0UKE0_GLOV7          EVDIISQRWQKAIAPLA-KDTVVVLNADDPTLSHLGQQL---------PQRVLFFGLSEP
K9ZP66_ANACC          EVDTISKKWTKVISTLP-DETVVIPNADDPTLSYLGQQL---------NQKVLFFGLNEP
K9U9A2_CHAP6          EVDTITYRWGKAIAALD-GDTILVTNGDDPALAHLGQQLTTGDK----PKQVKYFGLSEP
B1XIK7_SYNP2          EVDTISQRWQAAIAPLP-PETTIIVNGDDPTLNDLGQNL---------SQTVKFFGLNEP
A5UQM1_ROSS1          EVDTVAAGWRAALERLP-ATTTVLLNADDPAVAALGEGL---------TAQVRYYGLNDV
D3FEX1_CONWI          ELETIADRWAEIVARHG-SSTQLVLNADDPLVADLGRE----------QPRVVYFGVQDD
Q0S8X7_RHOJR          EINMIERKLRACVAAH--PEAVVIANCDDVLVTSVAYD----------AKNVVWVAAGGG
E9SXE2_RHOHA          EINMIERALRAGLQRH--PDAVVVANCDDVLVTSVAYD----------CKNVVWVAAGGG
U5EEB7_NOCAS          EINMIERKLRAGLARH--PDTVVIANCDDVLVASIAYD----------HPNVVWVSAGSG
G8RQS2_MYCRN          EINHIERTLRSGLARH--PSTVVIANCDDVLMTSAAYD----------SPNVVWVAAGGG
Q6NJX8_CORDI          EINKIERALRDCVTAH--PDMTVIANCDDVLVTSVAYD----------APNVVWVSAGAG
C3PJQ7_CORA7          EINKIERALRGAVEAH--PDMLVIANCDDVLMTSVAYD----------AKNVIWVSAGAG
F8DXS6_CORRG          EINKIERALRACVEAR--PSMTVVANCDDVQVTSVAWD----------SPNVVWVSAGAG
G0G5G4_AMYMS          EVRATERDLRAAIAEL--PGTVVVANCDDVLVTSAASV----------AAKLVWVSTGRR
A8KY78_FRASN          ETRRIAALWRELGADL--RDTVVVANVDDPLVAWSAMT----------WSRQIWVSAGQN
A0LVL8_ACIC1          EVAMVARRWRKAFAAH--PELTVVANADDPHVVWAASV----------VPTVTWVAVGQP
G2NNC6_STREK          ETRMLAEKWREGLSG---SKAVIVANADDPLIVWAAS----------SSPNVVWVAAGQA
F2RA08_STRVP          ETRMLAEKWREGLNG---TKAVVVANADDPLIVWAAS----------SSPNVVWVAAGQE
K4RE05_STRDJ          ETRMLAENWREGLAG---SKAVIVANADDPLVVWAAS----------SSANVIWVAAGQM
Q9FCA1_STRCO          ETRMLAENWREGLAG---SKAVVVANADDPLVVWAAS----------SSPNVIWVAAGQM
S5VC22_STRC3          ETRMLAENWREGLAG---SKAVVVANCDDPLVVWAAS----------SSPNVVWVAAGQM
E2Q9G2_STRCL          ETRMLAEKWREGLAG---SKAIVIANADDPLVVWAAS----------SSPQVVWVAAGQE
E4N655_KITSK          ETRMMAEKWREGLRD---TEAVIIANADDPLVTWAAS----------SCKKVVWVAAGQA
Q47LC5_THEFY          EINLLAKKWREALAA---SQAHVVANADDPLVAWAGL----------AAPHATWVAAGQR
F4FHS3_VERMA          EVAMMAQLWRAALVRH--PDIRIVANADDPMVVWAATPPATHDQRI-TPPHVTWFSAGQR
I0H146_ACTM4          EVAMMAQLWKTALASH--PHIKVVANSDDPMVVWAAS----------GSPQVTWFSAGQR
D7GCQ2_PROFC          EIKSLGKKWRDALIATGTAGPVAVGNIHDPLVTWSAEA----------AHRAVWVDMGVG
F5XQ41_MICPN          EIKALGRSWRNALEAAGERGPVVVANADEPLVVWAAQT----------AREVVWVDTATT
A0JXB6_ARTS2          EIDKTAQLLQHIASKT---TGTVVLNREDPR--VARIADTLDG------PEVRYFGLDDS
F0M2I5_PSEPM          EIDKTAQLLQHIAAKT---TGTVVLNREDPR--VARIAETLTG------QDVKYFGLDDS
A1R729_PAEAT          EIDKTARLLEHIASKT---TDTVVLNREDPR--VARIANALNTLDAVHHPEIRYFGLDES
B0RC12_CLAMS          EPDRVVGMLERIAATA---TEAVVANRDDAH--VNAIAAHTARTGR---AAVDWFGVSEE
Q6AFF8_LEIXX          EPTRVIGMLRTIADRS---REFVVVNADDDS--LARIGAELVAAG----SDVSTFAVAPA
A0A2T0VG40_9MICO      EPERVAGYLARTAGAT---SDTVVVNADDPHLAAIGMATDLSTTAD---ATVRRFALGSD
A0A0Q5E0Y2_9MICO      DAAMVSRMLDAIAGRS---TGSLVLNGDD------ALVDAVASGSA---ATRWRYGVSAS
E4Q3C5_CALOW          ELDRVKELILSHIGQA-----LAIINADDPNLASFSG------------KRKVFYSVDEN
A0A0A8W970_PAESO      EMDNIVQKFENIVKDF---DGHLILNGDDPNVVKIKDSCK--------SSNIEFFSVYNC
Q83MU4_TROWT          DPGTVLVKLKNSLAFV---KDVLIFNLNEPCFSELLESSLA-------SQKLSVYGFSSS
G4KZB7_OSCVS          HPEWVFDALKPAMFPE----TRLILNADDPLSACFALDR----------DNVRWFGLDRC
                      .                        * .                                

MURT_STRR6            ---KGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGA--YICEGCGCKRPDL----DYR
T1ZDJ2_STRIT          ---KGQAELAHYNTEGILCPKCQHILKYKLNTYANLGD--YICEYCHFKRPEL----NYK
A4VWE8_STRSY          ---EHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGS--YICTNCGFSRPEL----DYK
F9VD98_LACGL          ---SHAPERAHYNTEGVVCPECHHILDYKLNTYANLGD--YICQNCGFKRPEL----DYR
C9AB20_ENTCA          ---PDEEQMAHYNTDGVLCPECHHILHYKMITYANLGK--YYCPNCGFHRPEL----DYK
G4L4D1_TETHN          ---SDEEQMAHYNTDGVLCPKCQHILHYKMITYANLGK--YYCPNCGFTRPQL----DYK
C2D415_LACBR          --QEQGDIKATPNTDGVLCPQCQHILHYRFISYSNLGK--YFCPNCGYQRPKL----NFA
F9UQS7_LACPL          --QPDHDQQAPANTDGLLCPRCQHILRYHSRTYSNMGK--YYCPHCGFERPQL----TYK
Q74K27_LACJO          EDKPENDFKAPVNTDGVLCPKCDHILHYHERIYANLGD--YFCPNCGYHRPEL----TYS
F8HZ51_WEIKK          --PVTGDERAPINTDGVLSPTDDSILSYHFRTYANQGF--YFSKTDDFKRPEL----DYA
C5R966_WEIPA          --PATGDMKAPHNTDGVLSPTDNSILHYHFMTFGNQGD--YFSVTDDFKRPAL----NYA
D9SST9_CLOC7          ---INDNKEIDINADAKFCKVCKSPYKYNFVTYNHLGS--FYCENCGYSRPSL----DFS
A5HYV5_CLOBH          ---KNADTVIDVNADSKFCKKCKHPYSYEFLTYNHLGS--YYCENCGYKRPNI----TFS
Q8XL54_CLOPE          ---PNKNKNIEINADAKFCKFCKEPYSYNFITYNHLGS--FYCPNCGFKREDL----KYK
MURT_STAAC            ---HEFEQSTMNE--SRYCPNCGRLLQYDYIHYNQIGH--YHCQ-CGFKREQA----KYE
Q2FWZ9_STAA8          ---HEFEQSTMNE--SRYCPNCGRLLQYDYIHYNQIGH--YHCQ-CGFKREQA----KYE
MURT_STAAN            ---HEFEQSTMNE--SRYCPNCGRLLQYDYIHYNQIGH--YHCQ-CGFKREQA----KYE
F6B3J3_DESCC          ---QRNDGGTKQTRESRFCPHCGQELHYDYYQYSQLGA--YSCNGCGFRRPQP----DIA
F4LWL4_TEPAE          ---ETDMGSKGLARDAVFCKKCGNRLHYNYCYYGQLGH--YTCQKCGFTRPVP----DFR
R5VS95_9FIRM          --PDDKTEPYNLIADYQICPNCGEKLKYNYLRYHHIGD--VVCPKCGLHSPDK----KYL
A0A1G4SKQ8_9FIRM      --DTDVIECENLLNDMRICPICGSKLVYDYRRYHHIGK--AHCSKCDFRSPEY----DYE
R5KFY8_9CLOT          --PSDREECINLINDMRICPKCHHKLKYNYVRYHHIGK--AVCEFCGYTSPEG----DYK
H6LDB0_ACEWD          --EESFI--KEADYPTQGCPKCHHDIIFDYYNVDSIGA--FHCEHCSFASNKTT---AYE
E3GNJ9_9FIRM          --SESFE--KDETYPTCACPKCYHKVDFDYYTIDSVGP--FTCTNCGYSSEAAP---HYA
K9Z1X9_CYAAP          ---ELYLDEIPHAVDSIYCPKCGTSLQYKGVYISHLGD--YDCPSCDFTKS---------
E0UKE0_GLOV7          ---SLYLKEIPHAVDSIYCPSCGHPLNYQGVYLSHLGD--FHCPSCGFSKS---------
K9ZP66_ANACC          ---KHYLEAIPHAVDSIFCPKCGHSLDYEGVYLSHLGD--FTCPSCGFTKS---------
K9U9A2_CHAP6          ---ELYLDEIPHAVDSIYCPSCGTALEYKGVYLSHQGD--FDCPKCDFTKS---------
B1XIK7_SYNP2          ---DLYLEAIPHAVDSIYCPRCGAPLTYKGVYLSHLGD--YHCDSCGFAKN---------
A5UQM1_ROSS1          ---RHAAGSAAQIGDARFCRRCGAPYRYTALFYAHVGH--YRCEACGAARPIPVYALERL
D3FEX1_CONWI          ---TMALPQMQHASDSKHCRRCGHAYEYDAIYLGHLGR--YHCPNCGQRRPEPAVVGERI
Q0S8X7_RHOJR          -----------WASDAASCPRTGEPIVW-EGSH-------WRSTGSD----------FAR
E9SXE2_RHOHA          -----------WANDSVSCPRTGEPIVW-DGPH-------WRSTGSD----------FAR
U5EEB7_NOCAS          -----------WAVDSTSCPRSGEPIIW-EGEN-------WRSTGAD----------FHR
G8RQS2_MYCRN          -----------WANDSVSCPRSGEIIVR-DGAH-------WYSTGTGSDVGPEGPPAFKR
Q6NJX8_CORDI          -----------WTGDSVSCPRTGSHIVR-QDDH-------WYATKPLPN-----GETFQR
C3PJQ7_CORA7          -----------WMGESVTCPRTGGHIVR-EGED-------WHAVKPLAD-----GRAFRR
F8DXS6_CORRG          -----------WVGDSTSCPRTGGSIIQ-DGQD-------WYATKKLPD-----GREFRR
G0G5G4_AMYMS          -----------WTGDSTACPRCEGRVET-HERH-------WSCECGL-----------AR
A8KY78_FRASN          -----------WTADAMVCPQCARLLHR-NATG-------WWCECGL-----------AR
A0LVL8_ACIC1          -----------WRADAAVCPGCGAVLQW-ADDV-------WSCSCGL-----------RR
G2NNC6_STREK          -----------WKDDAWSCPSCGGVMQR-PGDD-------WFCGECG----------FRR
F2RA08_STRVP          -----------WKDDAWSCPACGGVMQR-PGDD-------WFCGECG----------FRR
K4RE05_STRDJ          -----------WKDDAWSCPSCGGVMQR-PGDD-------WFCGECG----------FRR
Q9FCA1_STRCO          -----------WKDDAWSCPSCGGVMQR-PGDD-------WFCGECG----------FRR
S5VC22_STRC3          -----------WKDDAWSCPSCGGVMQR-PGDD-------WFCGECG----------FRR
E2Q9G2_STRCL          -----------WKDDAWSCPACGGVMQR-PGDD-------WFCGECG----------FRR
E4N655_KITSK          -----------WKEDAWSCPSCGGVMQR-PGDD-------WFCGECG----------FRR
Q47LC5_THEFY          -----------WKEDSWCCPECGGHLKRDPDPH-------WECPECG----------LSR
F4FHS3_VERMA          -----------WHDDSWVCPECGSTIQR-SGEQ-------WWCTGCP----------LRR
I0H146_ACTM4          -----------WLDDSFVCPESGHPIER-ANGD-------WWCTGCP----------LRR
D7GCQ2_PROFC          -----------WTQDAALCPNCGSVLIYQTDD--------WHCPGCP----------LRM
F5XQ41_MICPN          -----------WTQDASLCPQCGALLLHDQPDETGGQGGGWRCSGCE----------LAQ
A0JXB6_ARTS2          -----------LLSTFPNDDDLRAGPGSPLPA-----------------------MPEKP
F0M2I5_PSEPM          -----------LLSTFPNDDDMRAAPGSPAPAT----------------------LPEKP
A1R729_PAEAT          -----------LRSTFPNDDEMRTTAIGPSPSGT-------SVAAETGD------DVDLP
B0RC12_CLAMS          -----------LLGDSKHGLASAPRFGSEDPD------------------------PVHV
Q6AFF8_LEIXX          -----------IIESSPNGLANVRDFSGDDAG------------------------ALPV
A0A2T0VG40_9MICO      -----------ITAAAKRTASAPR--FSEDSA------------------------TTPR
A0A0Q5E0Y2_9MICO      -----------VLEASPRGLGYSS--TAPD--------------------------RVDA
E4Q3C5_CALOW          ----VLSRRINVTLDSRFCPLCNARLEYLFYNVGHLGK--YKCLVCGYKNPES--RFVIT
A0A0A8W970_PAESO      K----DSKKTSESMEGRFCPRCKERLSYDYYNYSHIGR--FHCENDGFGK-------NSF
Q83MU4_TROWT          -------------SDILNSIPPTGLLPHLRGQFSPPGR-------------------IES
G4KZB7_OSCVS          --SISTEEPSGIYHDGAYCPICKSPMEYRYYHFNHIGS--YHCPSCEFGKP------AHV
                                                                                  

MURT_STRR6            LTKLVELTNNRSRFVIDGQ----EYGIQIGGLYNIYNALAAVAIARFLGADSQL-----I
T1ZDJ2_STRIT          LTQLTSLHHNSSEFVIDDQ----DYHINIGGLYNIYNALAAVSVAQFFEVDSAT-----I
A4VWE8_STRSY          LTKLKEITNTSSTFVIDGQ----DYKINIGGLYNIYNALAAVSVAEFFGVSPEK-----I
F9VD98_LACGL          VSELTEITNTSSQFVIDNH----SYKINVGGLYNIYNALAAVSVAEFYGVPAET-----I
C9AB20_ENTCA          LTEMTAMDNTSADFVIDGN----DYRIEVGGMYNVYNALAATAVAEYYGVAPAK-----I
G4L4D1_TETHN          LTDLRNMTNTSAEFTIDNN----DYKLEVGGMYNIYNALAATAVAEYYHVAPEK-----I
C2D415_LACBR          LNKITELTPKSSSFEIDGE----PIKIDIGGVYNIYNALAAYTVGRFMGVSPAQ-----A
F9UQS7_LACPL          LNALTAMTPTSSDFEINGQ----AMHLNIGGQYNIYNALAAYAVGRFMDVTPAK-----I
Q74K27_LACJO          VNQIIDQTPNSLKFKMGEK----EYSIGIGGTYNIYNALAAYSVAREFGLSEEE-----V
F8HZ51_WEIKK          VTNINKLTPRYSNFDLDGE----TYQIEIGGLYNIYNALTAYAVGQWLGVTKQQ-----I
C5R966_WEIPA          VTKLNKLTPISSNFDIDGK----TFQIEIGGMYNIYNALAAYAVGRYMGVSVAQ-----I
D9SST9_CLOC7          VDAVLESSTQGSLVKLNDN----EFFINQPGTYNIYNAVCAYAVAKTVGISDTV-----I
A5HYV5_CLOBH          LDEVEDLTPEGSLVIIDNQ----EYYINQPGLYNVYNALCAYSMAKTLGIEKSI-----I
Q8XL54_CLOPE          VEEIVELTPESSKVVINGG----LFTITQPGTYNIYNGLCAYSVAKELHINDEV-----I
MURT_STAAC            ISSFDVAPFLYLNINDE------KYDMKIAGDFNAYNALAAYTVLRELGLNEQT-----I
Q2FWZ9_STAA8          ISSFDVAPFLYLNINDE------KYDMKIAGDFNAYNALAAYTVLRELGLNEQT-----I
MURT_STAAN            ISSFDVAPFLYLNINDE------KYDMKIAGDFNAYNALAAYTVLRELGLNEQT-----I
F6B3J3_DESCC          ADEVETAGTMSRCRVSYPGGAAILS-LKTQGFYNLYNALAAFTVGHLLEITTET-----I
F4LWL4_TEPAE          AFIEDKSGKRKLIVWGKDKDFIVETDININDTYSIYNTLAAASCGALAGNTPET-----V
R5VS95_9FIRM          ATDIDREKMTITIQEGDKK---TVYPLIHTALFNIYNEVTVISALREI-GLSAE-----R
A0A1G4SKQ8_9FIRM      GHDIDFENRTITIKDHGED---GVYHISNDSIFNIYNTCLVVTLFREL-GVERD-----K
R5KFY8_9CLOT          A-DVDYENKVITVTHNESR---EQYPMISNSTFNLYNELTAVTALREF-GLTGE-----Q
H6LDB0_ACEWD          VNNIDFAKKTFTLKD-------VVYQMPYDLPFMFYNYAGALAICEEICGVPAV-----A
E3GNJ9_9FIRM          VKDVDFENKTFTVED-------ESFNMPYDLPFMLYNYSGALALCERFAGVSVK-----D
K9Z1X9_CYAAP          ------------KLSVNSK----EWPQILIGVYNKYNTLAAGLTAETIGIERDI-----I
E0UKE0_GLOV7          ------------QPAFHSR----DWPQILIGVYNKYNTLAAGLVAQEIGVNTEA-----I
K9ZP66_ANACC          ------------KPTLESG----EWSQILVGLYNKYNTLAAATAAQELGVDEIT-----I
K9U9A2_CHAP6          ------------KLSIDSK----EWPQVLIGVYNKYNTLAAITVMESIGISKSV-----I
B1XIK7_SYNP2          ------------PLDIHSP----DWGQILIGVYNKYNTLAAALLAETLGIHRDI-----I
A5UQM1_ROSS1          DLHGADHATLCLTFPGGAM----EVHLPLPGLYNAINALAATAACLELGVAAAR-----I
D3FEX1_CONWI          ELRGTRGARFTLRTPEGSA----RVELPLPGLYNVYNALGAAALCLSLGVPLAE-----V
Q0S8X7_RHOJR          PTPDWWLDDE--NLYGPDGLKI-PMTLALPGRANRGNAAQAVAAAV-AMG-----AKAED
E9SXE2_RHOHA          PTPDWWLDDD--NLYGPDGLVI-PMKLTLPGKANRGNAAQAVAAAV-AMG-----ARAED
U5EEB7_NOCAS          PQPDWWLEGE--DLCGPDGFRA-PLHLALPGRANRGNAAQAVAAAV-ALG-----AEPAK
G8RQS2_MYCRN          PSPQWWYDET--HIYGPDGLSL-PMQLALPGNVNRGNATQAVAAAV-TLG-----ADPAA
Q6NJX8_CORDI          PTPAWTITPD--GILTPGHAEPVPLSLALPGNANRGNATQAIAAAV-TCF-N---VPLDD
C3PJQ7_CORA7          PTPTWAVTED--GLVSPEGVDK--LRLSLPGRANRGNAAQAVAAAV-EAF-G---VDRHK
F8DXS6_CORRG          PAPEWTVTPD--GLRDPHGNVH-PLNLTLPGDANRGNALQALVGAL-KLNPA---VDVAP
G0G5G4_AMYMS          PEPAWTLDGE--LVLTPGGRQV-DLDLRLPGEANRANAALALAAAH-RLG-----VPPHT
A8KY78_FRASN          PEPIVSVAGL--GELMWFGRRI-PAHIDLPGRVNLANAAMAAAAAR-EFG-----VDVED
A0LVL8_ACIC1          PEPTWSLDG---DHLLHGDLRL-PLTLALPGRANRANAAVAAAAAD-LAG-----IPPAQ
G2NNC6_STREK          PAPSWALNG--DYVLDPHGSAW-PIHLQLPGRANKANATSSAAVAA-VFG-----VPPQV
F2RA08_STRVP          PAPSWALSG--DHVLDPHGSAW-PIRLQLPGRANKANAATSAAVAA-VFG-----VPPQV
K4RE05_STRDJ          PTPSWALSG--DHVLDPHGSAW-PIHLQLPGRANKANAASSAAVAA-VFG-----VPPQV
Q9FCA1_STRCO          PTPSWALSG--DHVLDPHGSAW-PIHLQLPGRANKANAASSAAVAA-VFG-----VPPQV
S5VC22_STRC3          PTPTWALSG--DHVLDPHGSAW-PIHLQLPGRANKANAASSAAVAA-VFG-----VPPQV
E2Q9G2_STRCL          PTPSWVLNG--DYVLDPHGQAW-PIRLQLPGRANKANAASSAAVAA-CFG-----VPPQV
E4N655_KITSK          PNPHWALQG--THVIDPHRGAW-PIQLQLPGRANLANATSSAAVAA-VFG-----VAPQV
Q47LC5_THEFY          PYTTWSLDNATDTVTDPEGKTH-RLQLRLPGDANRSNAVIALATAA-AYG-----LRPEQ
F4FHS3_VERMA          PQPQWTVDD--QGVLDPTGAWY-KVKLQLPGKVNVGNAATALAVAA-EFG-----VRPFD
I0H146_ACTM4          PRAHWSVED--EGVIDPRGDWH-MVKLQLPGKVNIGNAATALAVAA-EFG-----VRPIE
D7GCQ2_PROFC          HQPDFTVRGD--DISTPQGQHW-TLHLQVPGRFNRGNATCAFAAAI-IMG-----VDPQI
F5XQ41_MICPN          PAASYRVVDG--RIVDPDGKSF-DPELQVPGAFNISNAACAMAAAA-QLG-----VPSAT
A0JXB6_ARTS2          HADVVLRRVGTDDADFEYDGATVTTGMKLRGVYNIFNAAAALALARCIAGNGATPTDHDG
F0M2I5_PSEPM          AADVVLRKVGADTAEFEYDGVTVTTGMKLRGVYNIFNAAAALTLARSICGSGAATANHET
A1R729_PAEAT          AADVVLRRVGAQDADFEFDGETVTTTMKLRGVYNIFNAAAALSLARAILGTG--PVDTPK
B0RC12_CLAMS          DAGVEAVALAGRDAVFRLASGDLPVTLPSRGLHYAVDAAGALATARRVLGDR---FDPAR
Q6AFF8_LEIXX          PS-VFVSTLEQQSAQLTIGDESVQIGLPARGLHYAVDAVGATAMARRLLGAQ---FRPAA
A0A2T0VG40_9MICO      PADSVVVSVDGSEALISINGTDLQVALPSAGTHIASDAAAAIEGARALLGDR---FDAET
A0A0Q5E0Y2_9MICO      DAGTVVQSLAGDEVVIAHKGETARFRLPARGVHYAVDAAAAISGAAAVLGPE---FRLAT
E4Q3C5_CALOW          NIKENLEGFVFDFVDRETDIHIENIRWKMGGVYNLYNVCAAISVAILIGVEEKR------
A0A0A8W970_PAESO      SVFCEDIDENTNQITVNGQ----KLSLFKNNIYTVYNCIAVLNVLKVLDVNWNY------
Q83MU4_TROWT          LCHIEHYSARTAHFSIQGVDRLQEIQLRTEGVHHAQNAAAAFALCMKILGDEFD---PNK
G4KZB7_OSCVS          DYAATDLDLEQGLLTIGQEL---TIHLAFRSIYNVYNILAAYAVCRECGVCAEH------
                                                          :                       

MURT_STRR6            KQGFD-KSRAVFGRQETFHIGDKECTLVLIK--NPVGATQAIEMIKLA------------
T1ZDJ2_STRIT          KAGFD-KSRAVFGRQETFKIGNKECTLVLIK--NPVGATQALEMIKLA------------
A4VWE8_STRSY          KAGFD-KSKAVFGRQETFKLGDKDCTLVLIK--NPVGATQAIEMMKLA------------
F9VD98_LACGL          KAGFE-QSKAVFGRQETFTIGDKSATIVLIK--NPVGANQALEMMKLA------------
C9AB20_ENTCA          KSGLA-YDEKVFGRQEVIRIGDKECTLVLVK--NPVGLNQVIDMIGLS------------
G4L4D1_TETHN          RKGIG-FDEKVFGRQEVVDIDGKKCTLVLVK--NPVGLNQVIDMIGLS------------
C2D415_LACBR          KQAFE-KDKRIFGRQEEINVDGKLVTLILVK--NPVGLNQVIDMISTD------------
F9UQS7_LACPL          AHALSDNDEQVFGRQETFHVGEKDVTLILVK--NPVGLNQVLQTISTD------------
Q74K27_LACJO          AQSFA-ENKRIFGRQELINYADKEIDLILVK--NPVGLDEVLHMLNTE------------
F8HZ51_WEIKK          HHAFE-SNAQIFGRQELIHVGDKEVTIVLIK--NPVGANQVIDMMKTD------------
C5R966_WEIPA          QRAFS-SNAQIFGRQEAVKVDDKEVTIVLIK--NPVGANQVIDMMKTD------------
D9SST9_CLOC7          EKSLK-HQASSFGRQEILNIDGKKVKIILVK--NPAGYDEAVNTVTFS------------
A5HYV5_CLOBH          FNSLK-SQKSSFGRQESINIEGKDVKIILVK--NPAGYDQAINTIVLD------------
Q8XL54_CLOPE          QKSFS-NQSSSFGRQETIKIGDKEARIILVK--NPAGYNQALDTLLLN------------
MURT_STAAC            KNGFE-TYTSDNGRMQYFKKERKEAMINLAK--NPAGMNASLSVGEQL------------
Q2FWZ9_STAA8          KNGFE-TYTSDNGRMQYFKKERKEAMINLAK--NPAGMNASLSVGEQL------------
MURT_STAAN            KNGFE-TYTSDNGRMQYFKKERKEAMINLAK--NPAGMNASLSVGEQL------------
F6B3J3_DESCC          LVGLL-NYTPAIGRMETFIYKNKPAILNLVK--NPTGYNEGLATLLNI------------
F4LWL4_TEPAE          LKGIE-TYRPQVGRMEKF-YIQKPITLNLAK--NPIGFNESMKVVSRD------------
R5VS95_9FIRM          VKELMGQIHIPDSRHNETTVNGVTVIQALSKGQSAVSSSRTFEYVANE------------
A0A1G4SKQ8_9FIRM      LAEVMKSVKIPDTRFNVKKSGSISVVTQLAKDKNALAVSRATDYVRQQ------------
R5KFY8_9CLOT          IRNAIQNLNIVESRYSRSTVDGITIVTNMAKGQNPIACSCVFDYVSKE------------
H6LDB0_ACEWD          TAKAFENFKNIGGRFEVLKYKNKTIKYMRIKQENPDTLQSALNIMASD------------
E3GNJ9_9FIRM          AVPAFNSFKNIGGRFEVLHYKDKTIKYMRIKQENPDTLQSALNIMASD------------
K9Z1X9_CYAAP          NDTIH-NFKAAFGRAEELTIQDKNIRILLSK--NPVGMNETIRAVNDI------------
E0UKE0_GLOV7          FETVG-NFKAAFGRAEELTVNGKHIRILLSK--NPVGMNETIRAVNDI------------
K9ZP66_ANACC          RETIS-TFQAAFGRAEDLVIDGKKVRILLSK--NPVGTNETIRVVTES------------
K9U9A2_CHAP6          LDTIG-NFQAAFGRSEELVYNGKKVRILLTK--NPASMNETIRAVSQV------------
B1XIK7_SYNP2          NEQIQ-SFKAAFGRAEELTVQGKSVRILLSK--NPVGMNETVRAVTDL------------
A5UQM1_ROSS1          RTSLE-CFDAAFGRIERIDAGGRPLLIALIK--NPVGATETVRMLTEARKFHTSTAPEVS
D3FEX1_CONWI          VSGLE-QVAAAFGRAETIALDGRDLSILLIK--NPAGANEVLRTL---------------
Q0S8X7_RHOJR          AVAAAATVQEVAGRYSTVEVG--SHSVHMLLAKNPAGWQEALSMIDPTV-----------
E9SXE2_RHOHA          AVAAASIVDEVAGRYSTVQVG--AHSVHMLLAKNPAGWQEALSMIDHSV-----------
U5EEB7_NOCAS          ATDATGTVREIAGRYRTVTVG--EHDARLLLAKNPAGWQEALSMIEPTS-----------
G8RQS2_MYCRN          AVAAVSGVDEVAGRYSTVQLG--RHTVRMLLAKNPAGWQEALSMVDTDA-----------
Q6NJX8_CORDI          AVRAVETVDDVAGRYSTITLG--EHQIHLLLAKNPAGWQEALSMVDRTA-----------
C3PJQ7_CORA7          AIAAAEGVDDVAGRYSTITLG--KRTIRLLLAKNPAGWQEALSMVDREA-----------
F8DXS6_CORRG          AIEQIEKVDNVAGRYSTVQFG--QHQVRLMLAKNPAGWQEALSMVDRTA-----------
G0G5G4_AMYMS          AAARLRTITDIGGRYRTIRRS--RHSVRVMLAKNPAGWVETLRVLDEDT-----------
A8KY78_FRASN          ALAAMRGIGDVQGRYQEVPLGPDGKLARLLLAKNPAGWVEMMELLNSAP-----------
A0LVL8_ACIC1          AVAAFASVASVGGRYEVREYA--GRRIRLLLGKNPAGWTEIFDVL-APP-----------
G2NNC6_STREK          ALERMYQVQAVAGRYDVITFM--GRELRLLLAKNPAGWLETFSLIDPP------------
F2RA08_STRVP          ALERMYQVQAVAGRYDVVSFQ--GRELRLLLAKNPAGWLETFSLIDGP------------
K4RE05_STRDJ          ALERMYQVQAVAGRYDVVQFQ--GRDLRLLLAKNPAGWLETFSLIDPP------------
Q9FCA1_STRCO          ALERMYQVQAVAGRYDVVQFQ--GRDLRLLLAKNPAGWLETFSLIDPP------------
S5VC22_STRC3          ALERMYQVQAVAGRYDVVQFQ--NRDLRLLLAKNPAGWLETFSLIDPP------------
E2Q9G2_STRCL          ALERMYSVQAVAGRYDVVTFQ--NRELRLLLAKNPAGWLETFSLIDPP------------
E4N655_KITSK          ALQRMQSVAAVAGRYDVVQYR--GRDIRLLLAKNPAGWLETFSLIDGP------------
Q47LC5_THEFY          ALPRMREIESVAGRYTSIVTK--GVEVRLLLAKNPAGWLESFAILDPP------------
F4FHS3_VERMA          AVPRLADVTSVAGRYAQVVRD--GRTVRLLLAKNPASWLEAFDMAE--------------
I0H146_ACTM4          ALPRLSRVASIAGRYAQVDRD--GRNIRLLLAKNPASWLEAFDMAE--------------
D7GCQ2_PROFC          ALDAMAGVRAPAGRFSVGTFG--ETRARLLLAKNPAGWAESILIMDSD------------
F5XQ41_MICPN          AIAGMRTVTAPAGRFATTRFG--DTTARLLLAKNPAGWAEALPLAQSD------------
A0JXB6_ARTS2          LLKALSQVAPAFGRGESLVVD--GLPLDLVLVKNPSGFRLGLKSFPAG------------
F0M2I5_PSEPM          LLEALSHVAPAFGRGESLTVD--GQPLDLVLVKNPSGFRLGLKSFPAG------------
A1R729_PAEAT          LVKSLGEVAPAFGRGESLTVD--GQPLELVLVKNPSGFRLGLKSFPAG------------
B0RC12_CLAMS          AAEGLGSVAAVYGRGEMLRAG--DEDIEIIMMKNPASLQMNLDALGDP------------
Q6AFF8_LEIXX          VAAAMGALRTVYGRGETLRVG--DEDIEIIMMKNPPSLQLNLDYLSDT------------
A0A2T0VG40_9MICO      TRLAFQSMPGVSGRNERVTIG--GHTVDFVFTKSPASMQLNLDLLDDT------------
A0A0Q5E0Y2_9MICO      AAASFEALTPVFGRGEVTTVR--GVEVEFVLVQNPASFQLNIDSLAPD------------
E4Q3C5_CALOW          IKERIETFENKLGRLEKKEVGGKKVIISLVK--NPIGMSETLSVISQDP-----------
A0A0A8W970_PAESO      ACDVFKNFDLNQGRNEKFIKGNKYVVLNLIK--NPVGTNEVLKDISRDL-----------
Q83MU4_TROWT          ASSAVSLSTPAFGRDQVISLAGQPVRILLMK--NPRSMQVNLESIAAG------------
G4KZB7_OSCVS          IGKVVNNYILKNGRMVRFLLGAHHGMLLTSKHENSIAYDTNLRYVRSTE-----------
                                   *                   ..                         

MURT_STRR6            ---------------PYPFSLSVLLNANYADGI---DTSWIWDADFEQITD--MDIPEIN
T1ZDJ2_STRIT          ---------------PYSFSLSVLLNANYADGI---DTSWIWDADFEKILD--MDISHII
A4VWE8_STRSY          ---------------PYDFSLSVLLNANYADGI---DTSWIWDADFEQITQ--MDIPQVF
F9VD98_LACGL          ---------------DYPFTLVSLLNANYADGI---DTSWIWDANFELVHD--MDIDQIF
C9AB20_ENTCA          ---------------PYPFSLVSLLNANYADGI---DVSWIWDGDHEAFAD--MGIPQVI
G4L4D1_TETHN          ---------------PYNFSLVSLLNANYADGT---DISWIWDGNYEAFSN--TEIPKVI
C2D415_LACBR          ---------------KDPFTFIGLLNANYADGI---DTSWIWDGDFERLPK--MNIKQYI
F9UQS7_LACPL          ---------------DRPFSFAALLNANYADGI---DTSWIWDGNFEKLPA--LNIPAYI
Q74K27_LACJO          ---------------KDNYSLVTLLNANHADGI---DTSWIWDADYEGLNK--DQIKKVI
F8HZ51_WEIKK          ---------------PEPISVLGLLNANYADGI---DTSWIWDAEFEDLMD--MNVKAIA
C5R966_WEIPA          ---------------DQPFSIIALLNANYADGI---DTSWIWDANFESLHD--TGIQAVA
D9SST9_CLOC7          ---------------ENSLNIAFLLNDNYADGT---DVSWIWDVNFEKLTS--KTIDDII
A5HYV5_CLOBH          ---------------KKKLNLALLLNDNYADGR---DVSWIWDVKFEKLKS--LDIDNIL
Q8XL54_CLOPE          ---------------SESFAAAFLLNDNYADGK---DVSWIWDVDFEKLNS--MDLNEIF
MURT_STAAC            ---------------EGEKVYVISLNDNAADGR---DTSWIYDADFEKLSK--QQIEAII
Q2FWZ9_STAA8          ---------------EGEKVYVISLNDNAADGR---DTSWIYDADFEKLSK--QQIEAII
MURT_STAAN            ---------------EGEKVYVISLNDNAADGR---DTSWIYDADFEKLSK--QQIEAII
F6B3J3_DESCC          ---------------KGTKNVFMAVNDNDADGR---DISWLWDVDFEYLAEHHHNIEGFV
F4LWL4_TEPAE          ---------------SSLKTVAIGINDLPQDGR---DVSWLWDTNFEILQEVDETIYCYI
R5VS95_9FIRM          ---------------EGKKAILLAMDDLEDRQKSIEFSGWIYDLEYEQFNR--DDVVQVI
A0A1G4SKQ8_9FIRM      ---------------PGHKKMFLLISCYKDEHHWSENTCWIYDADFEMMND--PLMDQII
R5KFY8_9CLOT          ---------------PGNKEVILLLEDIFDRKNSSENMTWIFDTDFEFLNQ--PNITNIV
H6LDB0_ACEWD          ---------------TNEKMVALGLYVVNDFVPHYINTFYAFDCDFKPLIE--SKVERYL
E3GNJ9_9FIRM          ---------------QEEKMVCFGFYAVSDFIPFYTNTFYSFDCDFKPLAE--SNVEKYF
K9Z1X9_CYAAP          ------------REINPQSTILMVLNDRTPDGT---DVSWIWDVDTEKLVA----GGGNI
E0UKE0_GLOV7          ------------KAKGKASTTLIVLNDRIPDGT---DVSWIWDVDTEKLVN----LGGTL
K9ZP66_ANACC          ------------TDK----TTLLILNDRTPDGT---DVSWIWDVDTEKLVE----RGGTL
K9U9A2_CHAP6          ------------KQAGNGAVSLMVLNDRTPDGT---DVSWIWDVDTEKFVN----SGGTI
B1XIK7_SYNP2          ------------QQQGKTSTVLVVLNDRTPDGT---DVSWIWDVDLEKLTQ----SPGKI
A5UQM1_ROSS1          PAPSHHDSPLIASNTNHNLHLFILINDRHADGT---DVSWLWDAEFERLTG----CVAHV
D3FEX1_CONWI          ------------ALEDGAVDLLAVLNDNTADGR---DISWVWDADFELLAG----RVRRV
Q0S8X7_RHOJR          -----------------DG-LVIAVNGQVPDGE---DLSWLWDVRFEHFEGV------KV
E9SXE2_RHOHA          -----------------DG-LVIAVNGQVPDGE---DLSWLWDVRFEHFEGV------KV
U5EEB7_NOCAS          -----------------AG-LVIAVNGQVPDGE---DLSWLWDVRFEHFEGV------QV
G8RQS2_MYCRN          -----------------GS-VVISVNGQVPDGE---DLSWLWDVNFEHFVNH------PV
Q6NJX8_CORDI          -----------------EG-LVIAVNGQVADGE---DLSWLWDVKFEELEEL------SV
C3PJQ7_CORA7          -----------------DG-LVIAANGHVADGI---DMSWLWDVRFEDFEGI------PV
F8DXS6_CORRG          -----------------DS-LVISVNGQVADGQ---DLSWLWDVKFEKFESQ------YV
G0G5G4_AMYMS          -----------------P--VVVAVNAQEADGR---DLSWLWDVHFERLRGR------QV
A8KY78_FRASN          -----------------PRPVLIDFNSQTADGR---DPSWIWDVPFERLAGR------QV
A0LVL8_ACIC1          -----------------PAPVVIAINARAADGR---DPSWLWDVPFERLAGR------FV
G2NNC6_STREK          -----------------PTPVILSVNARGADGT---DTSWLWDVDYTQLYGH------PI
F2RA08_STRVP          -----------------PAPVILSVNARGADGT---DTSWLWDVDYGRLAGH------PI
K4RE05_STRDJ          -----------------PTPVILSVNARGADGT---DTSWLWDVDYTRLTGH------PI
Q9FCA1_STRCO          -----------------PAPVILSVNARGADGT---DTSWLWDVDYTRLSGH------PI
S5VC22_STRC3          -----------------PTPVILSVNARGADGT---DTSWLWDVDYTRLTGH------PI
E2Q9G2_STRCL          -----------------PTPVILSVNARGADGT---DTSWLWDVDYPRLAGH------PI
E4N655_KITSK          -----------------PAPVILSVNAMDADGT---DTSWLWDVDYERLAGH------PI
Q47LC5_THEFY          -----------------RVPVILSVNAQVADGR---DTSWLWDVDYTVLRGR------RV
F4FHS3_VERMA          -----------------LAPTLLSINARDPDGL---DTSWLFDVDFAPLRGR------QV
I0H146_ACTM4          -----------------QAPTLLSINARDPDGF---DTSWLYDVDFSPLRNR------PV
D7GCQ2_PROFC          -------------------PVILAIDSAIADGA---DVSWLWDVDFEQLAGK------HV
F5XQ41_MICPN          -------------------VVVLAIDSAAADGR---DVSWLWDVEYEQLAGR------TV
A0JXB6_ARTS2          -----------------GYATMVAINDNYADGR---DMSWLWDVEFDSLREGG-----VD
F0M2I5_PSEPM          -----------------GYATMIAINDNYADGR---DMSWLWDVEFDSLREGG-----VD
A1R729_PAEAT          -----------------GYATMIAINDNYADGR---DMSWLWDVEFDSLREDG-----VE
B0RC12_CLAMS          -----------------PEQVLLAVDDGTPDP------SWIYDTDLSALTH-------AD
Q6AFF8_LEIXX          -----------------PEQVFVAVDEGTPDP------SWVYDIDLSKLGH-------VD
A0A2T0VG40_9MICO      -----------------AEQVMLAVGKDIYDT------SQLWLVDWSTLPD-------VA
A0A0Q5E0Y2_9MICO      -----------------TEQILVAVGSDVRDP------SYLWPVDTARLGR-------VA
E4Q3C5_CALOW          ----------------DPKAIVFILNDNAADGK---DISWIWDADFDILSRI--ENIKAL
A0A0A8W970_PAESO      ----------------NLKTVLISINDNIQDGI---DVSWLWDSNFEIIFKQ---NVDKI
Q83MU4_TROWT          ------------------SRVMIGIDGGTPDPS------WLYDVNLSAIKRA--------
G4KZB7_OSCVS          -----------------DPCTVVIIVDAVSRKYYTSETSWLWDIDFGRLNCS---HVQKI
                                                               :      .           

MURT_STRR6            A-GGVRHSEIARRLRVTGYPAE------KITETSNL--EQVLKTIENQDCK---------
T1ZDJ2_STRIT          A-GGVRHSEIARRLRVTGYDAK------QINEVADL--SQVFEEIKHQKTR---------
A4VWE8_STRSY          A-GGVRSSEIARRLRVTGYPEN------QITETPKL--EDIMTLIEQSSSQ---------
F9VD98_LACGL          V-GGVRHSEMARRYRVSGFDES------KIHEFESL--PKILDALKNEADQ---------
C9AB20_ENTCA          A-GGDRHKDMALRLKVAGIPEE------KIIETPEL--DDVIKQIADLPTE---------
G4L4D1_TETHN          S-GGERHEDMTKRLKVAGISED------KITETQNL--DEVIEQIKQLPSE---------
C2D415_LACBR          T-GGQRYKDITYRLQVAGVDPS------KHLVEPDL--DKVVEMIPNAPTR---------
F9UQS7_LACPL          S-GGERYRDITFRLKVAGVPED------QLTIIPDL--TNMTTAIQKLPTK---------
Q74K27_LACJO          V-GGKRWHDMGFRLEVSGFEPG------LMTTATNN--EALLDEISKLPTK---------
F8HZ51_WEIKK          T-GGERYRDLYVRLKMAGF--G------DHPYYQDM--NQVVDAIQKMPTK---------
C5R966_WEIPA          T-GGERYKDLYVRLKMAGF--G------DHPVYQDL--KQIVTAIKSMPTK---------
D9SST9_CLOC7          I-GGLRKYDMAVRLKVAGLNVD------KFTLVNNY--EDLIEKIKSIAGE---------
A5HYV5_CLOBH          I-SGVRLYDMAIRLKIAGLPNE------KFKISQNH--DDLLEDIKSCREE---------
Q8XL54_CLOPE          I-SGMRAYDMAVRLKIANLPVE------KFLIKEDF--EGLTEAIKNSKEN---------
MURT_STAAC            V-TGTRAEELQLRLKLAEV--E------VPIIVERD--IYKATAKTMDYKG---------
Q2FWZ9_STAA8          V-TGTRAEELQLRLKLAEV--E------VPIIVERD--IYKATAKTMDYKG---------
MURT_STAAN            V-TGTRAEELQLRLKLAEV--E------VPIIVERD--IYKATAKTMDYKG---------
F6B3J3_DESCC          C-SGLRGEEMALRLKYAGVPLE------KISVIKDM--EQAIKEALKGPGQ---------
F4LWL4_TEPAE          L-FGQRRYDVALRLKYAGVEPE------KLIIAENL--EDVVDGIVKSESD---------
R5VS95_9FIRM          C-TGPRCYDHKVRCLLAGIPEE------KILTNLSE--VAAADDVTIDGVD---------
A0A1G4SKQ8_9FIRM      C-TGPRAPDFYMRMLFAGIPEE------KIFFELDE--RKAAREFELNKDD---------
R5KFY8_9CLOT          I-GGLRTKDYKLRLMMAGVPEE------KIKETTDE--AGAYKSLNLDGTD---------
H6LDB0_ACEWD          CFSEHVSYDTANRLIYEGVNKE------AITIMDSDDIKTIFSEIDKAKTD---------
E3GNJ9_9FIRM          CFSQNVCYDTANRLIYEGVESS------KIVIKDTDDIKTIFEEIEKADTS---------
K9Z1X9_CYAAP          VVSGDRLYDMALRLKYSLDTLN---SNLNLIIEEKLSQAINKALELTAVGE---------
E0UKE0_GLOV7          IVSGDRVYDMALRLQYSQEFVKEETTKVNLMIEEDLQKAINIALDKTPEDE---------
K9ZP66_ANACC          VVSGDRVYDMALRLRYSQKSAQ---SNLNLIVEEDLRKAITTALEHTPANE---------
K9U9A2_CHAP6          VVSGDRVYDMALRLEYSKIDRD---KGCKIIVKEDLKDAIDTALELTATTE---------
B1XIK7_SYNP2          IISGDRTYDMALRLRYCEGAAE-------LIVEPDLTKALDQAIALSPADQ---------
A5UQM1_ROSS1          TVSGTRAADMAVRLKYAGVEPE------RMTIADDPSHALDAALNRLPPGA---------
D3FEX1_CONWI          TCSGTRAAELALRMKYAGVDEE------RLVVVPELEAALDEA--RRDGDG---------
Q0S8X7_RHOJR          VAAGERGTDLAVRLTYAGVEHTLDPNPLRA--------------IASCPPG---------
E9SXE2_RHOHA          VAAGERGTDLAVRLTYAGVEHTLEHDPMRA--------------IASCPPG---------
U5EEB7_NOCAS          VAAGERATDLAVRLTYAGVEHTLIPDPLRA--------------IASCPAG---------
G8RQS2_MYCRN          VAAGERGTDLAVRLGYAGVEHTLVHNAVEA--------------ITSCPPG---------
Q6NJX8_CORDI          KAAGERGTDLSVRLTYASVDHELVRDPLAA--------------IKACPAG---------
C3PJQ7_CORA7          KAAGERGTDLAVRLVYADISHELIADPLAA--------------IQSCPEG---------
F8DXS6_CORRG          VAAGERGTDLAVRLGYASVVHDLVKDTVEA--------------IKQCPPG---------
G0G5G4_AMYMS          VVTGERGADLSVRLCYAEVAHWAEPDPVTA--------------IDALPPG---------
A8KY78_FRASN          LVTGGRKEDMSVRLAYAEVPHTVHADAEDA--------------ATAANDK---------
A0LVL8_ACIC1          VATGERRYDLAVRLLYAGVSHTTVENPGEAWPPEIGT-------AGLDDAP---------
G2NNC6_STREK          FVLGDRKLDLAVRLEVAGLDFRVCESLDEA--------------VQMAPPG---------
F2RA08_STRVP          MVIGDRKLDLAVRLEVAGVDFRVCETLDEA--------------VTMAPPG---------
K4RE05_STRDJ          CVIGDRKLDLAVRLEVANQQFQVCENLDQA--------------VQLCPPG---------
Q9FCA1_STRCO          CVVGDRKLDLAVRLEVANQQFQVCEDLDQA--------------VQLCPPG---------
S5VC22_STRC3          FVIGDRKLDLAVRLEVANQHFQVCENLDQA--------------VQQAPPG---------
E2Q9G2_STRCL          IVIGDRRLDLAVRLEVAGLDFRVCDTVDEA--------------VTMCPPG---------
E4N655_KITSK          FVMGQRKLDLAVRLEVANLQFQVVDSLAQA--------------VDAAPGG---------
Q47LC5_THEFY          FVMGERRTDLALRLETDEVPFEIADSVDQA--------------LTRLKTEQPDIT----
F4FHS3_VERMA          LITGDRAYDLAVRLDVNDVPFQHVRTFDDA--------------VRAVPPG---------
I0H146_ACTM4          LITGDRAYDLAVRLQVNQVPFRHVQRFDEA--------------LAAVPPG---------
D7GCQ2_PROFC          VCTGPRAQDLAVRLSYAEVEHSIVPDLSEA--------------LHGDYPG---------
F5XQ41_MICPN          VATGPRAQDLAVRLAYAEVACRCVPDLAEA--------------LDG-HPE---------
A0JXB6_ARTS2          QLTGSRAYDMALRLQYDDVAVGAVNPEIAPALAAFIQGAKGK------------------
F0M2I5_PSEPM          QLTGSRAYDMALRLQYDEVPIGNVEPDIAPALAAFIREAQGK------------------
A1R729_PAEAT          VLTGVRAYDMALRLQYDDVHFGVVEPDITAALRAFIDGSRGK------------------
B0RC12_CLAMS          VVSGTKGYQLAVRFGYEGLEVGRVEPDLRRAVQAFLAMEKPSRG----------------
Q6AFF8_LEIXX          IVSGTKAWQFATRFAYAGIEVDQVLPELKPALQAFLALPKPARG----------------
A0A2T0VG40_9MICO      VVSGWQAWDAALRLAYDEVAVDAVEPDVRIATREFLDRQNSSEG----------------
A0A0Q5E0Y2_9MICO      VVSGSKAWEAALQLGYDGVEIDRIEPDLGAALDAFLALPAPGVG----------------
E4Q3C5_CALOW          YFGGKRKEDMALRVKYSEYMLANFEFIDYKEELDKV--------FELKDIE---------
A0A0A8W970_PAESO      ICSGSRGYDVGLMLKYKGYKGKLIFENNIEKAIDKI----------DLEKE---------
Q83MU4_TROWT          VVTGSMAWQVALALSYAGVVIDLVEPNLFRATNYFLRHSSSDKFQSFYNKKSEVLRKSNF
G4KZB7_OSCVS          LLCGQYASDLAVRFSFTDVPQE------KIELHPDITEACNSLKAGGAE-----------
                              :                                                   

MURT_STRR6            --HAYILATYTAMLEFRELLASRQIV-RKEMN----------------------------
T1ZDJ2_STRIT          --HAYILATYTAMLEFRELLAERQVV-RKEMN----------------------------
A4VWE8_STRSY          --HAYILATYTAMLEFRDLLAQRQAV-GKEMK----------------------------
F9VD98_LACGL          --HIYILATYTAMLEMRELLAQNKMI-GKEMH----------------------------
C9AB20_ENTCA          --KVYILATYTAVLQLRKKLAEKGYI-KGGMSRD--------------------------
G4L4D1_TETHN          --QVYILSTYTAVLQLRKKLADMGYI-KGGMDRG--------------------------
C2D415_LACBR          --KVYILATYTAMLSLRKTFATKGFI-EGGMG----------------------------
F9UQS7_LACPL          --QVYVVATYTAMLQLRKQLASQGII-DGGMA----------------------------
Q74K27_LACJO          --KVYILATYTAMLSLRKTMGEKKII-KAGM-----------------------------
F8HZ51_WEIKK          --RVYVMATYTAMLQLRTRLAQKGFIKNKKMGDA--------------------------
C5R966_WEIPA          --RVYILATYTAMLQLRAELKQQNYI-HTGMGE---------------------------
D9SST9_CLOC7          --EIYILATYTAMTSFRKFLHGKGYIKKLW------------------------------
A5HYV5_CLOBH          --TVYILATYTAMTSFRKFLNSKGYIKKLW------------------------------
Q8XL54_CLOPE          --KVYILATYTAMINYRKYLHSKGYIDKLW------------------------------
MURT_STAAC            --FTVAIPNYTSLAPMLEQLNRSFEGGQS-------------------------------
Q2FWZ9_STAA8          --FTVAIPNYTSLAPMLEQLNRSFEGGQS-------------------------------
MURT_STAAN            --FTVAIPNYTSLAPMLEQLNRSFEGGQS-------------------------------
F6B3J3_DESCC          --TTYLFSTYTALWATQKILLGL-ADKEVPHAQGLSSVS---------------------
F4LWL4_TEPAE          --AGYILLNYSLLFDIQKILKERNEDNETYHVPSVS------------------------
R5VS95_9FIRM          --RIYILYDCENYGMSCEMKKKIIKRLEGDK-----------------------------
A0A1G4SKQ8_9FIRM      --TVYIFCGIDAFDLVDDCRNIILKRAEEEGL----------------------------
R5KFY8_9CLOT          --SVYILHDIHENDTALVLRDNLKQYLKEREA----------------------------
H6LDB0_ACEWD          --NIYLITWISTFEKMKKFIEGGQN-----------------------------------
E3GNJ9_9FIRM          --NIYLITWLETFNKMKKYIEEGN------------------------------------
K9Z1X9_CYAAP          --TLYIIPTYSAMLEVRKILLGREIL----------------------------------
E0UKE0_GLOV7          --TLHILPTYSAMLEVRGILTGRKIL----------------------------------
K9ZP66_ANACC          --TLHILPTYSAMLEVREVLTGRQIL----------------------------------
K9U9A2_CHAP6          --TLHIIPTYSAMLDVREILTGKKIL----------------------------------
B1XIK7_SYNP2          --TLHILPTYSAMLEVRQMLTGRKIL----------------------------------
A5UQM1_ROSS1          --TLYVLPTYTAMLDLRAELVRRGWVRPFWEH----------------------------
D3FEX1_CONWI          --TLFALPTYTALLALKELLARRGLAPEYWR-----------------------------
Q0S8X7_RHOJR          --RVEVLANYTAFRDLNTAI--------------------AKEARNA-------------
E9SXE2_RHOHA          --RVEVLANYTAFRDLNTAI--------------------AKENSRDV------------
U5EEB7_NOCAS          --HVEVLANYTAFRDLNRDL--------------------EGRA----------------
G8RQS2_MYCRN          --HVEVVANYTAFLALQRVL--------------------ARHG----------------
Q6NJX8_CORDI          --RVEVLANYTAFRDLKRAI-------------------TAATKEA--------------
C3PJQ7_CORA7          --RIEVLANYTAFRDLKKAL-------------------TAAAAKEHSND----------
F8DXS6_CORRG          --RVEVLANYTAFRDLKRVLDREGTVIDTPRGADGSSQSTAGTGDDTANHIAHRPSSHNS
G0G5G4_AMYMS          --AVELVANYTAFRDLVGRL--------------------PGG-----------------
A8KY78_FRASN          --ALDVVANYTAFRDLLVRT--------------------TR------------------
A0LVL8_ACIC1          --PLDVVATYTAFRDWLRRT--------------------GGDTDVRG------------
G2NNC6_STREK          --RIEVIANYTAFQDLRRRV--------------------GN------------------
F2RA08_STRVP          --QIELIANYTAFQDVRRRV--------------------GN------------------
K4RE05_STRDJ          --RIEVIANYTAFQDLRRRV--------------------GN------------------
Q9FCA1_STRCO          --RIEVIANYTAFQDLRRRV--------------------GN------------------
S5VC22_STRC3          --RIEVIANYTAFQDLRRRV--------------------GN------------------
E2Q9G2_STRCL          --RIELIANYTAFQDVRRRV--------------------GN------------------
E4N655_KITSK          --RIEAIANYTAFQQLRKAV--------------------VA------------------
Q47LC5_THEFY          --KVDVIANYTAFQQIRTAY--------------------GRVQ----------------
F4FHS3_VERMA          --RLEVIANYTAFQDIRAEL--------------------DRVN----------------
I0H146_ACTM4          --RLEVIANYTAFQDIRAEL--------------------DRVN----------------
D7GCQ2_PROFC          --QVDVLATYTAFLNLCRMG--------------------GVTW----------------
F5XQ41_MICPN          --PVDVIATYTPFQRLRKMG--------------------GV------------------
A0JXB6_ARTS2          --PKRIFCTYTAMLAIRRELSKIT----------------TVEVVS--------------
F0M2I5_PSEPM          --PKRIFCTYTAMLAIRRELSKIT----------------TVEVVS--------------
A1R729_PAEAT          --PKRIFCTYTSMLAIRRELAKIT----------------IVEVVS--------------
B0RC12_CLAMS          --VKTMIVNYEQMMAIRRILGYTD----------------LEGGPA--------------
Q6AFF8_LEIXX          --TKTMIVNYEQMMLIRKQLGFLD----------------LEGGEK--------------
A0A2T0VG40_9MICO      --HSTIIYTPESMRVMRRNLRLKW----------------ADS-----------------
A0A0Q5E0Y2_9MICO      --RKTVIFTADSMRRTRAHLGLAS----------------NDQDDA--------------
E4Q3C5_CALOW          --KVYILPTYTALFEVKEIVDKLSKRMG--------------------------------
A0A0A8W970_PAESO      --YSYVLSNYSGLSKIRKLIERRV------------------------------------
Q83MU4_TROWT          DNNQCVTATHLDADFNRDQFGAKDDSAMVMILNYEMSMRLLRHYRYLDSSCY--------
G4KZB7_OSCVS          --DVYVLTCFSDRDKLLTQVEKEAV-----------------------------------
                                                                                  

MURT_STRR6            --------
T1ZDJ2_STRIT          --------
A4VWE8_STRSY          --------
F9VD98_LACGL          --------
C9AB20_ENTCA          --------
G4L4D1_TETHN          --------
C2D415_LACBR          --------
F9UQS7_LACPL          --------
Q74K27_LACJO          --------
F8HZ51_WEIKK          --------
C5R966_WEIPA          --------
D9SST9_CLOC7          --------
A5HYV5_CLOBH          --------
Q8XL54_CLOPE          --------
MURT_STAAC            --------
Q2FWZ9_STAA8          --------
MURT_STAAN            --------
F6B3J3_DESCC          --------
F4LWL4_TEPAE          --------
R5VS95_9FIRM          --------
A0A1G4SKQ8_9FIRM      --------
R5KFY8_9CLOT          --------
H6LDB0_ACEWD          --------
E3GNJ9_9FIRM          --------
K9Z1X9_CYAAP          --------
E0UKE0_GLOV7          --------
K9ZP66_ANACC          --------
K9U9A2_CHAP6          --------
B1XIK7_SYNP2          --------
A5UQM1_ROSS1          --------
D3FEX1_CONWI          --------
Q0S8X7_RHOJR          --------
E9SXE2_RHOHA          --------
U5EEB7_NOCAS          --------
G8RQS2_MYCRN          --------
Q6NJX8_CORDI          --------
C3PJQ7_CORA7          --------
F8DXS6_CORRG          NPTPDTKE
G0G5G4_AMYMS          --------
A8KY78_FRASN          --------
A0LVL8_ACIC1          --------
G2NNC6_STREK          --------
F2RA08_STRVP          --------
K4RE05_STRDJ          --------
Q9FCA1_STRCO          --------
S5VC22_STRC3          --------
E2Q9G2_STRCL          --------
E4N655_KITSK          --------
Q47LC5_THEFY          --------
F4FHS3_VERMA          --------
I0H146_ACTM4          --------
D7GCQ2_PROFC          --------
F5XQ41_MICPN          --------
A0JXB6_ARTS2          --------
F0M2I5_PSEPM          --------
A1R729_PAEAT          --------
B0RC12_CLAMS          --------
Q6AFF8_LEIXX          --------
A0A2T0VG40_9MICO      --------
A0A0Q5E0Y2_9MICO      --------
E4Q3C5_CALOW          --------
A0A0A8W970_PAESO      --------
Q83MU4_TROWT          --------
G4KZB7_OSCVS          --------