CLUSTAL format seed alignment for MF_02220

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

XYLB_ECOLI            ----------------------------MYIGIDLGTSGVKVILLNEQGEVVAAQTEKLT
Q6DB06_PECAS          ----------------------------MYIGIDLGTSGVKAILLDETGEVIASHSAALS
D8MVH3_ERWBE          ----------------------------MYIGIDLGTSGVKAILLSESGQLLATHGEPLT
F6CT01_MARPP          ----------------------------MYIGIDLGTSGVKAVLMNKTGQIVATSTAPLS
G0AIZ5_COLFT          ----------------------------MYLGIDLGTSEVKIVLMDQAGKLLADAGSALT
C4LDR3_TOLAT          ----------------------------MYLGLDAGTSEIKGVVIDENGSLLASAGEPLT
B1Y6S9_LEPCP          ----------------------------MYLGIDLGTSEVKFLLLDAAHHIVASVGEPLA
G0ACI0_COLFT          ------------------------MSSPISLGIDLGTSELKAVLLDESGTVLAHTGVRLA
A6X4G4_BRUA4          ----------------------------MYLGLDLGTSGVKALLIDDAQTVIGSAHGELD
Q1YHH9_AURMS          --------------------------MSNYLGLDLGTSSLKALLIGDDQRVIASASVPLT
I7E053_PHAIB          ----------------------------MYLGIDLGTSGLRALMTDAAGKPVASAEAQYD
Q0FM50_SALBH          ---------------------------MAYLGIDLGTSGLRALLVSDTGTPLGSTERHYA
D0CPB5_RUELI          --------------------------MGMFLGIDLGTSGVKAILVDAHQRVLAEGHAALQ
B2JHP3_PARP8          ---------------------------MTFLGIDLGTSEVKVILTDDASTTLATSGARLE
D5QJB6_KOMHA          ----------------------------MFVGIDLGTSAIKAVLVDGSQSVVGACSRSLT
B2IBW2_BEII9          ---------------------------MNFIGIDLGTSSVKTLVIDENENVTADLSEDVV
A9HPF3_GLUDA          ---------------------------MTYLGLDIGTTATKAILVDDRQSVLAAATVASR
A8LIC3_DINSH          ----------------------------MFLGLDIGTSAVKGLVWDGAR-VLGAASAPLK
D3PMG0_MEIRD          ----------------------------MLLGLDLGTGSLKALLLDFNGQVRGEASRPYP
Q1AS19_RUBXD          ----------------------------MLLGLDLGTGSVKALLLDERGAVAGTGSSACA
C6D7F3_PAESJ          --------------------------MSLLMGIDIGTSSVKSMIMDPSGKVLGFAQMEYD
E7GJK6_CLOSY          --------------------------MASLLGIDIGTSGTKVMLLDEKTGVAGIESETYQ
S0FL94_RUMCE          --------------------------MSFLIGIDLGTSGVKTVLFDESGKPVASSTVEYP
E7GIR6_CLOSY          --------------------------MNYLIGIDVGTSATKTVLFDEEGTVIASASKEYG
Q1IT93_KORVE          --------------------------MPKLLGIDVGTGGTRAVLIDDKGRVIASRTAEHQ
A5UXA1_ROSS1          -------------------------MSACLLGLDIGTTGARALLCDEHGRVLSVATAEYP
D9SR75_CLOC7          ---------------------------MKFLGVDLGTSSVKIIMVDEEGKLLSSVSKEYP
F3ZWR6_MAHA5          -----------------------------MLGVDIGTSSCKSVIIDENSQVIADASAGYG
XYLB_BACSU            --------------------------MKYVIGIDLGTSAVKTILVNQNGKVCAETSKRYP
A8FE32_BACP2          --------------------------MKYVMGIDLGTSGVKAILVDEDGKVCGEATKPYR
W4QRU0_BACA3          --------------------------MKYVIGVDLGTSAVKVLLMNVSGEVCKEVSKSYP
E6TXM8_BACCJ          --------------------------MKYVIGVDLGTSAVKIILVNQSGEVVNEISKEYA
G2TH71_BACCO          --------------------------MKYAIGVDLGTSSVKVLLVDQNGQVVSSVSKSYP
F2F597_SOLSS          --------------------------MKYVIGIDLGTSAVKALLMNEQGTIVDEASRSYP
Q03TX2_LEVBA          -------------------------MGKYVLGVDLGTSAVKVSALDHSGQIVAQESFDYD
C2CXH9_LACBR          -------------------------MTECVLGVDLGTSAVKVSAVTKDGDIIAQEGMDFP
C5R8Q7_WEIPA          ------------------------MTKEVVLGVDLGTSAVKVSAVDRQGTIVAQEAYNYP
Q03HN0_PEDPA          --------------------------MEVVLGVDLGTSAVKVSAVDREGKIVAQQSEAYS
XYLB_LACPE            -------------------------MSAVVLGIDLGTSAVKVSAIDKQGNVVAQASAKYA
H7C797_ENTFA          --------------------------MSYVLGIDLGTSSLKGLLVSEIGDVIATSSSDYP
S4D8M2_ENTFL          ---------MPQGLAFEHHLRKVVKSLAYVLGMDLGTSSLKGLVFQENGVLAAEASADYP
XYLB_LACLA            --------------------------MTYVLGIDLGTSSLKGILMDEVGNLITTKSAEYQ
Q49UE8_STAS1          -----------------------MILNEAVLGIDIGTSSVKVIAVSKEGEVLAKVSEGLD
XYLB_STAXY            --------------------------MAYVIGIDIGTSALKTLVVNKSGDVVESYSVSYN
C1CZT9_DEIDV          -------MSESAEVRSVSSGGPAGPGEPVTLGIDLGTSGVKVVALDATRRTVVSVTREYP
D3PP61_MEIRD          --------------------------MSLVLGLDLGTSGLKAVALSARGQKVAEARAGYP
XYLB_ACTM4            --------------------------MALVAGIDSSTQSCKVVIRDAETGALVRQGRASH
A1SM63_NOCSJ          --------------------------MPLVAGVDTSTQSCKVVVCDAESGELVRSGAAPH
C7Q039_CATAD          --------------------------MRLAAGVDSSTQSCKVVIRDVDSGALVRQGSAPH
H6RUW2_BLASD          --------------------------MTLVAGIDTSTQACKVVVRDAGSGKLVRSGRAPH
B2HNZ2_MYCMM          --------------------------MTLVAGIDSSTQSCKVLVCDADTGEVARRGQAAH
A0A1E3S1B9_9MYCO      --------------------------MDLVAGIDSSTQSCKVVICRADTGEIVRSASSPH
C5C1D9_BEUC1          --------------------------MTLVAGIDSSTQSVKVVVRQAGTGALARFGQAPH
D3CZL7_9ACTN          ---------------------------MLVAGVDSSTQSCKVVIREAESGRFVRAGSAPH
A8LDF9_FRASN          --------------------------MALVAGIDSSTQSCKVVIRDADSGALVRQGTAPH
K7SFY6_ACIA4          ---------------MDDVTTQTDRQRPYVAGVDSSTQSCKVVILDPATGRIVRQGRGSH
D6ZJF2_MOBCV          ------------------------------------------MIRDADTGALVRSGMAFH
D4BQ14_BIFBR          -------------------------MQQLVAGVDSSTQSCKVVIRDLHTGKLVRSGAARH
B8DTL1_BIFA0          ------------------------MEPMLVAGVDTSTQSCKVRVTDARTGKLVRFGQAKH
Q8G3P8_BIFLO          ------------------------MTRVLVAGVDTSTQSTKVRITDAATGEQVRFGQAKH
W5IK78_SCAIO          MDRADAINAKNARKTENAKKAGTARKRVLVAGIDTSTQSCKVRVTDAATGQMVRFGQAKH
H0QLE8_ARTGO          -------------------------------------------MLDAETGALVREGRASH
C8XEG8_NAKMY          --------------------------MPLVAGVDSSTQSCKVVIVDADSGALVRSGRATH
G0FXA6_AMYMS          ------------------------MTAELVAGIDSSTQSTKVVVCDAATGEIVRTGRASH
E6SD13_INTC7          -----------------------MSDRTLVAGIDSSTQSTKVVVCDAESGDVVRTARAPH
D2PKF2_KRIFD          -----------------------MSQQKLVAGVDCSTQATKVVVCDAATGEVLREGRAPH
E1VS04_GLUAR          ------------------------MKPTYVLGIDSSTQSCKALLVDAQSGEVVAEQRSSH
G0HEP9_CORVD          --------------------------MAFVLGIDSSTQSCKALLVDAGTGEVVGEGRATH
C7MFT3_BRAFD          -------------------------MTTTVLGIDSSTQATKALLVDAATGEVLEERRASH
F0M3I8_PSEPM          --------------------------MSIVVGVDSSTQSCKVLAVDAHSGDVVASGASAH
XYLB_STRCO            ---------------------MSAAEGPLVVGVDTSTQSTKALVVDAATGRVVASGQAPH
K4RFH8_STRDJ          ---------------------MSAAEGPLVVGVDTSTQSTKALVVDASTGQVVASGQAPH
XYLB_STRRU            ---------------------MSAAEGPLVVGVDTSTQSTKALVVDVATGRVVASGQAPH
A0A059W750_STRA9      --------------------MGAQSAGPLVVGVDSSTQSTKTLVVDAETGQVLARGQAPH
V6KT30_STRNV          ----------------------MPHSQ-VVIGVDSSTQSTKAAFTDAATGRLLAVGRAPH
F2RHK1_STRVP          ----------------------MPTSRSVVIGVDSSTQSTKAAAVDADTGELLAIGRAPH
A6VWT3_MARMS          ----------------------------MYLGVDCGTQGTKVVVLDAEKKNVIAQGYSEH
G8PZN9_PSEF3          -----------------------MANQQLFLGIDCGTQGTKALILDATSGQVLGQGAAAH
S2KNK3_HALAF          -----------------MMNRGLEEERKMYVGVDCGTQSTKVVVVDVEGETILGEARRPH
Q9CL71_PASMU          ----------------------------MYIGIDCGTQGTKVIVVDSQQRQVIGVGYAPH
A0A377ICL0_AVIPA      --------------------------MAIYAGIDCGTQSTKVLLIDTEKGCILAEGNAPH
F5YH07_TREPZ          -------------------------MMRTVAGIDMGTQSIKVVLYDWNAKRIIASSHEPV
F2NRV6_TRES6          --------------------------MKTVAGIDLGTQSMKVVLYDYETRKSLESSSCPM
F5Y8N6_TREAZ          --------------------------MKTVCGIDLGTQSCKIIIYDYEKKTIVDSASAAV
Q5GYQ6_XANOR          ----------------------MGDAMSLYVGLDVGTQSVKLVAYDPQDRAVVATIAAPM
                                                                                  

XYLB_ECOLI            VSR-PHPLWSEQDPEQWWQATDRAMKALGDQH--SLQDVKALGIAGQMHGATLLDAQQRV
Q6DB06_PECAS          ISR-PHPLWSEQAPEDWWQATDQALQALAATH--SLRAVKALGLTGQMHGATLLDAHQNI
D8MVH3_ERWBE          ISR-PQPLWSEQSPAEWWQATDKAMQALAKQQ--DLQQVKAIGLTGQMHGATLLDARQQI
F6CT01_MARPP          VSR-PQALWSEQDPEDWWQATDKAMIELGQEY--DLSDVEALSFSGQMHGATLLDSHGEV
G0AIZ5_COLFT          VSR-PQPRWSEQDPEQWWQATGEAIAKLRAKAPAEFRAVRAIGLSGQMHGAVVLGAQDRV
C4LDR3_TOLAT          VQR-PHPHWSEQDPAQWWQATQQVISRLRNKIGDRWSLIKSIGLSGQMHGAVLLNRDGKV
B1Y6S9_LEPCP          VQR-PQPLWSEQNPAHWWAATDRALTRLAAEQPQAMRAVRAIGLSGQMHGAVLQDARGEV
G0ACI0_COLFT          ISR-PQAGWSEQDPEDWWQACLAGLHQLRQQQPDAYARVCCIGLSGQMHGAVLLDQNDRV
A6X4G4_BRUA4          VSR-PHPGWSEQDPAQWIKACRTAIDGLRAAHPKEFSAIAGIGLSGQMHGATLLDEQDQV
Q1YHH9_AURMS          VER-PHFGWSEQDPQSWIAACETALGELSDTHGAELAAVAGIGLSGHMHGATLLGADDAV
I7E053_PHAIB          VQT-PHPGWSEQDPGDWITALDQAMAQLQGS--PGYSDICGIAVAGHMHGAVLLDGSDQV
Q0FM50_SALBH          AAH-PQSGWSEQDPADWVAALEGAAEELRAAH-PEFAGLRGIGISGHMHGATLLDASGAV
D0CPB5_RUELI          VNR-PHPGWSEQNPDDWIAACETAVNQVRQAVPLEFSGLAAIGVSGQMHGATLLDAQDRP
B2JHP3_PARP8          VSQ-PHPHWSEQSPQAWWQATLDAVAAVRSANPGAFAALRGIGLSGQMHGATLIDANGAV
D5QJB6_KOMHA          ISS-PHDGWNEQAPEDWWNATLAVLDALAAAHPHEMAQVRGIGLSGQQHGAVLLGDGGQV
B2IBW2_BEII9          WSS-PHPNWSEADPESWWDAVARTLDRLAGENPGLLKEIRGIGLSGQMHGAVLLDGAHKP
A9HPF3_GLUDA          IDQ-PAPGLSEQDPDTWIAGVRLALARLRDEAGPAYGAVRAIGLSGHMHSVALLDDGLHP
A8LIC3_DINSH          VQV-PVPGASEQDPEAWWRGILAVCAEL--SAQPGWAEVSAIGLSGQMHGAVCLGPDGAV
D3PMG0_MEIRD          VAA-PHPGWAESDPEDWWRAAAEATQAAVGPL---ASQVVAVGLSGQMHGVVLSDPAGQP
Q1AS19_RUBXD          VRS-PRPGWAESDPEEWWLAAGEACRRALRGR---AGEVAALGLSGQMHGVVLAGEGGRP
C6D7F3_PAESJ          INI-PVSGYAEQNPDEWWELVKKTSAQAMAGAGIDGGALAGIGFSGQMHGLVALDKEGQV
E7GJK6_CLOSY          VSI-PRLGYAEQNPDVWWEAVLCCLSRLREKYGKCYSEVAGIGFSGQMHGLVMVDADGRP
S0FL94_RUMCE          LYQ-PNLGWAEQDPEEWWRGTCESINNVMLKSGVDKREVKGVGLSGQMHGAVLLDKDDKV
E7GIR6_CLOSY          MIQ-PQNGWAEQNPGDWKNAVLETLSEVREQSGVPAGAIKGIGLSGQMHGLVMLDEDNEV
Q1IT93_KORVE          PFASPKTGWAEQDPHDWWRACGESVRAVLVESGVTNSEIAAVGFSGQMHGAVLLDENNQV
A5UXA1_ROSS1          LST-PQPLWSEQNPEDWWRGACDALRAVVAQAGVAPEQIRGLGLTGQMHGSVFLDEQDQV
D9SR75_CLOC7          VSY-PKNGWSEQNPEDWWNGTKEGIRELMEKSKVSGEEVKGIGFSGQMHGLVILDKDNNV
F3ZWR6_MAHA5          VDM-PRLNWVEQNPVDWWNAVILSIKKVLKESRINTDALSCMGLSGQMHGLVAIDSGGNV
XYLB_BACSU            LIQ-EKAGYSEQNPEDWVQQTIEALAELVSISNVQAKDIDGISYSGQMHGLVLLDQDRQV
A8FE32_BACP2          LIQ-DKPGYCEQNPEEWVEQTVAAMKELMARQPVLSKKVGGISFSGQMHGLVLLNESREV
W4QRU0_BACA3          LIQ-EKSGYSEQDPNEWVEKTTEALKELVEQFDGDVASIEGISFSGQMHGLVLLDEEFKV
E6TXM8_BACCJ          LIH-EKTGYSEQRPDDWLTNTINGISDLLNDFGGNKNDIEGISFSGQMHGLVLLDENEEP
G2TH71_BACCO          LMQ-PHPGYSEQDPEQWVEKTIQALKELTEKSGVPRDEIEGLSFSGQMHGLVLLDENLQV
F2F597_SOLSS          LVH-EKPSYSEQNPNDWVTGTKAAIQEIVKRFTGDVSTIIGISYSGQMHGLVLLDENNDI
Q03TX2_LEVBA          LIQ-QQPGYNEQNPEDWVSGTTVAIVRLILNDHLDASDIEGLSYSGQMHGLVLLDENKKV
C2CXH9_LACBR          LRQ-PKPGYAEQDPEDWVSATTVAIVRLILTDKLKPEEIKGISYSGQMHGLVLLDKDNQV
C5R8Q7_WEIPA          LSQ-PAPGYSEQNPEEWVSGTTVAIVRLILNDHLSPDQIKGISFSGQMHGLVTLDKSGKI
Q03HN0_PEDPA          LNQ-PEPGYSEQNPEDWVTGTTAAIDRLIKVDGIKPDEITGISYSGQMHGLVLLDDHNQV
XYLB_LACPE            LQQ-PHPGYSEQDPEDWVTQTTQAIRELLQQSEVTADQIEGLSYSGQMHGLVLLDESATV
H7C797_ENTFA          LFS-SRPGYSEQNPHDWIKAIENVINDLLSEFPEMKKELKGISISGQMHSLVLLDKDNEI
S4D8M2_ENTFL          LAA-PQAGYSEQNPNDWLKAAETVLMELIKKLPSLKTDLAGISFSGQMHSLVLLDEKNEV
XYLB_LACLA            IDT-PKQGYSEQRPEYWIVALESVLTGLSVEISDFGQQLAGISFSGQMHSLVVLDDNNKP
Q49UE8_STAS1          IIQ-LQSGCNEQQPDEWFEATKSCIRQILSASALSDIYIRGLSLSGQMHSLVVLDSTNKP
XYLB_STAXY            TAH-PKSGYSEIDPEIWYEATLESLKYILNHY--THNDLTGISFSGQMHGLVVIDQEGNP
C1CZT9_DEIDV          LLT-PQPGWTEQRPEDWVAATLSALGEVAGQLSETGHTPLALGLSGQMHGAVFLDAHGEV
D3PP61_MEIRD          LHT-PRPGWTEQDPLDWARAAQEALRALCEQLG--GAEVVGIGLSGQMHGAVFLDKAGNP
XYLB_ACTM4            PDGT------EVHPDAWWSALQSAIE--EAGGLD---DVAAASVAGQQHGMVALDENGEV
A1SM63_NOCSJ          PDGT------EVHPDAWWVAFERASA--AAGGLD---EVEAIAVGGQQHGMVCLDEQGAV
C7Q039_CATAD          PAGT------EVDPEAWWRALTAAIE--AAGGPG---GVEALAVGGQQHGMVCLDENGAV
H6RUW2_BLASD          PQGT------EVAPQAWEEAFREAAA--AAGGLD---DVAAVAVGGQQHGMVCLDERGEV
B2HNZ2_MYCMM          PDGT------EIDPAAWESAARAAIA--AAGGFD---DVEAVAVGAQQHGMVCLDMAGAV
A0A1E3S1B9_9MYCO      PAGT------EVDPRLWWTALQSAID--EAGGID---DVAALSVGAQQHGMVCLDASGRT
C5C1D9_BEUC1          PDGT------EVDPAAWWDALGAAIG--IAGGLD---DVAAVAVGGQQHGMVALDAAGEV
D3CZL7_9ACTN          PDGT------ELDPEHWWTALRIAVD--RAGGLD---DVAAISVAGQQHGMICLNKAGDV
A8LDF9_FRASN          PPGT------EIDPEHWWTALLTAVE--RAGGLG---DVAAVSVAAQQHGMIALDRDGRV
K7SFY6_ACIA4          PDGT------EIDPEYWWQGFLTAVD--DAGGLD---DVAALSVGGQQHGMVCLDAHGKV
D6ZJF2_MOBCV          RTGT------TVNPAVWVRAFDEAAQ--QAGGLE---DICAISVAGQQHGLVTLDEDGEV
D4BQ14_BIFBR          RRGT------EIDPQVWRSAFDEAVR--QAGGLD---DVVALSVAGQQHGMVALDERGKV
B8DTL1_BIFA0          PDGS------TVDPQAWWEAFLEASE--QAGGLD---DVSAIAVGGQQHGMVILDEQGRV
Q8G3P8_BIFLO          PDGT------SVNPEFWWEAFTKAAE--QAGGLD---DVAALAVGGQQHGMVILDKQGNV
W5IK78_SCAIO          PDGT------RVNPEAWWQAFQEAAQ--QAGGLA---DISALSVGGQQHGMVLLDEQGQV
H0QLE8_ARTGO          PDGT------EVHPDHWWRALSKAFD--DAGGLA---GVAALSVGGQQHGMVLLDAAGAV
C8XEG8_NAKMY          PDGT------AVPPAAWWDALQTAIA--GAGGLD---DVAAISVAGQQHGMVALDEQGNV
G0FXA6_AMYMS          PDGT------EVAPAAWWDAFKEAT----NGLLD---GVTAIGVGGQQHGMVTLDENDDV
E6SD13_INTC7          PDRT------EVDPERWWEAYRTASG---SGILE---GVSAIAVGGQQHGMVVLDEQDAV
D2PKF2_KRIFD          PDAT------QVDPAEWFKAWEIAS----DGLLD---DVQAVSVGGQQHGMVLLDADGQV
E1VS04_GLUAR          LPGT------QIDPQHWVTALETAT----TGLLE---QASAVSIAGQQHGMVALDEHGQP
G0HEP9_CORVD          PDGT------EVDPRAWIDAMETAT----AGLLE---KADAVAVAGQQHGMVALDESGEV
C7MFT3_BRAFD          PDGT------EVDPRAWLAAVDEAA----GPLLE---RAEAVAVGGQQHGMVLLDAHGEV
F0M3I8_PSEPM          PDRT------AVDPRIWTSALREAWQ--AAGADRLGGSVAGVGIGAQQHGMVALDNTDTP
XYLB_STRCO            TVSS--GTGRESDPRQWWDALGEA----LSQCGEAAREAAAVSVGGQQHGLVTLDARGEP
K4RFH8_STRDJ          TVSS--GAGRESDPRQWWNALCEA----LRQCGDAAHEAAAVSIGGQQHGLVTLDERGEP
XYLB_STRRU            TVTS--GAGRESDPRQWWDALCEA----LRQCGEAAHEAAAVSIGGQQHGLVTLDGHGEP
A0A059W750_STRA9      TVSG--GAAKESDPRQWWRALGEA----LVQCGAAARQASAVSVAGQQHGLVTLDAAGEP
V6KT30_STRNV          RVTGE-GGARETDPEVWWQALREAVAMGLKESGVAASAVTGIAVAGQQHGLVVLDAAGKP
F2RHK1_STRVP          TVTGT-SGARESDPEEWWTALATAVRASVRQAGIPADAVTGIAVAGQQHGLVTLGADGRP
A6VWT3_MARMS          ELISAANGRREQEPKWWIEAFLKAFQKAVESSGIQPCDINAIGVSGQQHGLVVLDEKGEV
G8PZN9_PSEF3          SMISGANGRREQDTQQWLDAFTQATHQALAAAGVDGQAILGIGVSGQQHGLVLLDDQGQV
S2KNK3_HALAF          HLIEGDNGRREQQPSEWLDAFRGAFQEAVTNAGIDSRAIRAIGVSGQQHGMVALDAYGEP
Q9CL71_PASMU          AIIENSEGRREQQPQWWTDALVSAYQQAIKLAQIEPHLIKGIGVSGQQHGLVLLDDNDQP
A0A377ICL0_AVIPA      HLISEATGKREQQPQWWIDALVIAFKQAIAKCGINSQQISGMSVSGQQHGFVPLDRAGKG
F5YH07_TREPZ          DLIALDDGTREQKTEWYDAVLEKCFSAFSVEE---KNSIAAIGVSGHQHGFVPLDADGKA
F2NRV6_TRES6          ELISESDGTREQKTEWYKKGLEVCFSKISSEG---KKSIQAIGVSGQQHGFVPLDSEGNP
F5Y8N6_TREAZ          DMIAENDGTREQKAEWYEEALKSCFGKLDNAA---KKTIAAVGVSGHQHSLVPLDAKGKA
Q5GYQ6_XANOR          ELISRDDGTREQQAQWWIDGIVHCFAQLEGGL---RARVRGISVSGQQHGFVPVAADGSV
                                   .  :                         .  .: *.          

XYLB_ECOLI            LRPAILWNDGRCAQECTLLEARVP------------------------------------
Q6DB06_PECAS          LRPAILWNDGRSAAQCRTLEQLVP------------------------------------
D8MVH3_ERWBE          LRPAILWNDGRSAAQCRELEQAVP------------------------------------
F6CT01_MARPP          LRPAILWNDGRSHQACLSLQQRCP------------------------------------
G0AIZ5_COLFT          LRPAILWNDLRSISECVELTERAP------------------------------------
C4LDR3_TOLAT          LRPAILWNDTRSAEECRLLTEQAQ------------------------------------
B1Y6S9_LEPCP          LRPAILWNDGRSGAECAELEAALP------------------------------------
G0ACI0_COLFT          LRPAILWDDSRALAQAQWLEREHP------------------------------------
A6X4G4_BRUA4          LHPCILWNDTRSYREAAKLDA-DP------------------------------------
Q1YHH9_AURMS          LRPCILWNDTRSHEEAAELD--DE------------------------------------
I7E053_PHAIB          LRPCILWNDTRSAAEAAELDA-AE------------------------------------
Q0FM50_SALBH          IRPCILWNDTRSHAEAARLDA-TE------------------------------------
D0CPB5_RUELI          LRQCILWNDGRAAEECAELEA-RA------------------------------------
B2JHP3_PARP8          LRPAILWNDTRAFAECAELEALVP------------------------------------
D5QJB6_KOMHA          LRPCILWNDVRATAECDEFERRFP------------------------------------
B2IBW2_BEII9          LRPAILWNDGRSHREAAELASLPS------------------------------------
A9HPF3_GLUDA          VRPALLWNDTRGQAQAQRLLQDVP------------------------------------
A8LIC3_DINSH          LRPAILWNDNRAVREAAEM-AALP------------------------------------
D3PMG0_MEIRD          LRPAILWADGRAVRELSALKALPE------------------------------------
Q1AS19_RUBXD          LRPAVLWADTRAADQLDAYRRLPP------------------------------------
C6D7F3_PAESJ          LRPSIIWCDQRSIPQKAILESGLT------------------------------------
E7GJK6_CLOSY          IRPAILWLDQRSTKECNDLNERIP------------------------------------
S0FL94_RUMCE          LRKAIIWCDQRSAAECDQITELIG------------------------------------
E7GIR6_CLOSY          IRPSIIWCDQRTGGQVEEMLQIMP------------------------------------
Q1IT93_KORVE          LRPSLIWCDQRTAEEARELTEQIG------------------------------------
A5UXA1_ROSS1          IRPALLWNDQRTAAECAEITARVG------------------------------------
D9SR75_CLOC7          LRPAILWNDQRTQEECDYLNNEIG------------------------------------
F3ZWR6_MAHA5          LRPAILWNDQRSFQECQSIIEMVGG-----------------------------------
XYLB_BACSU            LRNAILWNDTRTTPQCIRMTEKFG------------------------------------
A8FE32_BACP2          LRPAILWNDTRTTAQCIHITNKLG------------------------------------
W4QRU0_BACA3          QRNAILWNDTRTTEQCQQIYDLVG------------------------------------
E6TXM8_BACCJ          LRNAILWNDTRTTAECEEIYEAVG------------------------------------
G2TH71_BACCO          IRNAILWNDTRTTEQCKKIDQVLG------------------------------------
F2F597_SOLSS          LRPAILWNDTRTTEQCKQIIEQVG------------------------------------
Q03TX2_LEVBA          LRPAILWNDTRSTPQREEIEAKLG------------------------------------
C2CXH9_LACBR          LRPAMLWNDTRSTKQREEIMAKMG------------------------------------
C5R8Q7_WEIPA          IRPAILWNDTRSSKQTREINEKMG------------------------------------
Q03HN0_PEDPA          LRPAILWNDTRTTEQCKEILDTMG------------------------------------
XYLB_LACPE            LRPAILWNDTRTTSQCRELESQFG------------------------------------
H7C797_ENTFA          IRPAILWNDVRTTKQCEDIMNCMG------------------------------------
S4D8M2_ENTFL          IRPAILWNDVRTTEQCKKIMDTLG------------------------------------
XYLB_LACLA            VYPAILWNDVRTSKQCQEITDRLG------------------------------------
Q49UE8_STAS1          LRNAILWNDTRSTHQCTTIEQQFG------------------------------------
XYLB_STAXY            IRPAILWNDTRTSQEVEDIKKNLG------------------------------------
C1CZT9_DEIDV          LRPAPLWNDQRTARQVQDIEARVP------------------------------------
D3PP61_MEIRD          LCPAPLWNDQRTALEVEQIEQAIP------------------------------------
XYLB_ACTM4            VRPALLWNDTRSAGAAADLIAELG--------------------------GGEK------
A1SM63_NOCSJ          VRPALLWNDTRSAQAALDLIEELG--------------------------GPGA------
C7Q039_CATAD          VRPALLWNDTRSAQAADDLVRELG--------------------------A-EA------
H6RUW2_BLASD          VRDALLWNDVRSAPAAAELIRELGDGDEAA--------------------GRRA------
B2HNZ2_MYCMM          VRPALLWNDVRSADAALALIDELG--------------------------GPRA------
A0A1E3S1B9_9MYCO      VRNALLWNDTRSDTAADELVRELG--------------------------GAQQ------
C5C1D9_BEUC1          IRPALLWNDTRSAAAAEDLIDELGDGDRAA--------------------GAAA------
D3CZL7_9ACTN          IRPALLWNDTRSARAARDLVADLGGGDPAA--------------------GAAA------
A8LDF9_FRASN          IRPALLWNDTRSAQAADDLVAELGDGEAVQ--------------------GAKQGAELGA
K7SFY6_ACIA4          IRPALLWNDTRSGQAAADLVDELGEAS---------------------------------
D6ZJF2_MOBCV          VRDAVLWNDTSAGADAKDLITELGQGDAIA--------------------GRKA------
D4BQ14_BIFBR          VRNAILWNDTRSARDAVDLISELGNGNERE--------------------GKRQ------
B8DTL1_BIFA0          IRDAMLWNDISSAPQAVELIDELGAAPAAD-----------GEPEDRHARGISR------
Q8G3P8_BIFLO          IRDAMLWNDTSSAPQAAALIDKLGAAPAEG-----------DEPDDVTARGKQR------
W5IK78_SCAIO          IRDAMLWNDTSSAPQAQALIDRLGLPEQGQGLLAEHEAEFIDPNDAQHVRGIKR------
H0QLE8_ARTGO          LRPALLWNDTRSAGAAAALTEEVGAED---------------------------------
C8XEG8_NAKMY          IRDALLWNDTRSAGAARQLIEEVGAAE---------------------------------
G0FXA6_AMYMS          VRPALLWNDTRSAQAALDLIEELGG-----------------------------------
E6SD13_INTC7          VRDALLWNDTRSAGAAADLTRELGG-----------------------------------
D2PKF2_KRIFD          VHPAVLWNDTSSADATAELVAELG------------------------------------
E1VS04_GLUAR          VREAMLWNDTSSAQQAKELTEELGGAQA--------------------------------
G0HEP9_CORVD          VRDALLWNDTRSARAAEELIEELGGPAA--------------------------------
C7MFT3_BRAFD          VRDALLWNDTRSAPQAETLIEEMGGAEA--------------------------------
F0M3I8_PSEPM          VHDALLWNDTRSAADAARLRDELGQET---------------------------------
XYLB_STRCO            VRPALLWNDVRSAPQARRLIDELGGAKA--------------------------------
K4RFH8_STRDJ          VRPAMLWNDVRSAPQARRLIEELGGPKG--------------------------------
XYLB_STRRU            VRPALLWNDVRSAPQGHRLIEELGGAKF--------------------------------
A0A059W750_STRA9      VRPALLWNDVRPAPESARLIAEGGGPAA--------------------------------
V6KT30_STRNV          LRPALLWNDTRSAPQAAALTEALGGPDA--------------------------------
F2RHK1_STRVP          LRPALLWNDTRSAPQAAALAERLGGPAA--------------------------------
A6VWT3_MARMS          IRPAKLWCDTETAPQNQQLLDALGGDQG--------------------------------
G8PZN9_PSEF3          LRPAKLWCDTETTPENDRLLAHLGGEDG--------------------------------
S2KNK3_HALAF          VHPAKLWCDTETAVANTALVERLGGEAG--------------------------------
Q9CL71_PASMU          LYNAKLWCDTETAAENAEFIRLLGGQEK--------------------------------
A0A377ICL0_AVIPA      LHPAKLWCDTETVQENQELVRQLGGEKA--------------------------------
F5YH07_TREPZ          LYNVKLWNDTSTAEECRIITEAAGGDDA--------------------------------
F2NRV6_TRES6          LYNIKLWNDTSTAKECELITNAAGGQNE--------------------------------
F5Y8N6_TREAZ          LYNVKLWCDTSTQAECEELTKAAGGEAK--------------------------------
Q5GYQ6_XANOR          TAPVKLWCDTSTALECDEIMDAVGGAAG--------------------------------
                           :* *                                                   

XYLB_ECOLI            ---------QSRVITGNLMMPGFTAPKLLWVQRHEPEIFRQIDKVLLPKDYLRLRMTG--
Q6DB06_PECAS          ---------TSRQITGNLMMPGFTAPKLKWVQENESDIFRQIDKVLLPKDYLRWRLTG--
D8MVH3_ERWBE          ---------ASRDITGNVMMPGFTAPKLLWVKQHEPEIFSQIDKVLLPKDYLRWRMTG--
F6CT01_MARPP          ---------DIQAITGNLVMPGFTAPKLVWVQQHEADIFRKIDKVLLPKDYLRYRMTG--
G0AIZ5_COLFT          ---------QLHQIAGNLAMPGFTAPKLLWLAHHEPDVFAAMQMVLLPKDWLRLKLTG--
C4LDR3_TOLAT          ---------ELHDIAGNLAMPGFTAPKLLWVARNEPEIFEQIDTVLLPKDYLRWMMCG--
B1Y6S9_LEPCP          ---------TLHAITGNLAMPGFTAPKLLWVKQHEPELFARMRRVLLPKDWLREQLTG--
G0ACI0_COLFT          ---------DFAGITGSLPMAGLTAPKLLWLREHEPQLFNRISCVLSPKDYLRLRLTG--
A6X4G4_BRUA4          ---------AFRAITGNIVFPGFTAPKLVWVANNEPDIFARIRKVLLPKDYLRLWLTG--
Q1YHH9_AURMS          ---------EARAITGNIVFPGFTAPKIVWVARNEPDVFAGLRRVLLPKDYLRLWLTG--
I7E053_PHAIB          ---------KVRDLSGNIVFPGFTAPKLLWVQRHEPEIFANTAKVLLPAAYLNLHLTG--
Q0FM50_SALBH          ---------GVRALSGNIVFPGFTAPKLDWVRTHEPENFARIDKVLLPTAYLNHYLTG--
D0CPB5_RUELI          ---------DFRGIGGNIVMAGFTAPKLAWVARHEPEILAATCKILLPKDYVNLWLTG--
B2JHP3_PARP8          ---------ASRNITGNLAMPGFTAPKLLWLAKHEPEVFRAASKVLLPKDYLAWKLSG--
D5QJB6_KOMHA          ---------QSRQVCGNVAMPGFTAPKLLWVARHEPEIFAATRHVLLPKAWLRYRLCG--
B2IBW2_BEII9          ---------PLLEQLGVMPMPGLTGPKLLWLHRHEPETLAATRSLLLPKDYIRLKLCG--
A9HPF3_GLUDA          ---------DISRATGVRPMASFSAAKLLWIRENDPAAFAATRHVLWAKDYVRLWLTG--
A8LIC3_DINSH          ---------GLAARVGVPPMPGFPAPKLAWLARTEPELHAATTMVMQAKDWVGMRLHG--
D3PMG0_MEIRD          ---------SLQHRLANPLVVGMAAPSLLWLERNEPRPYAEARWALQPKDWLRLRLTG--
Q1AS19_RUBXD          ---------HLRRALANPPAAGMAGPTLLWLREREPAAYAAARWALQPKDWLRMRITG--
C6D7F3_PAESJ          -------TEQLGHMIQNSVSTGFLILSLMWIKENEPQIYSRIDRVMLPKDYVRYRLTG--
E7GJK6_CLOSY          -------EDLITGSLRNRIFTGFALPSLLWVKKHEPEHFAAIHKVMQPKDYIRYKITG--
S0FL94_RUMCE          -------KERLIEITANPALTGFTASKIMWVKNNEPQIFEKIAKILLPKDYIRLRLTG--
E7GIR6_CLOSY          -------RERWIELTANPPLTGWTAAKILWVKKHEPENYQKCRHILLPKDYIRQVLTG--
Q1IT93_KORVE          -------EKQLIEWTCNPALTNFTLTKLMWVRKHEPKLYERFRRLQLPKDYVRLRLTG--
A5UXA1_ROSS1          -------AERLIAIAGNPALTGFQAPKILWLRNHEPERYARVAQVLLPKDYIRRRLTG--
D9SR75_CLOC7          -------QEKISKYTGNKALTGFTAPKVLWVRKHEKEIFDKIAHILLPKDYIRFKLTG--
F3ZWR6_MAHA5          -------KERLLEMINNNMLPGYTASKILWLAQHQPYIYEKTHIFLNPKDYIRYRLTG--
XYLB_BACSU            -------D-HLLDITKNRVLEGFTLPKMLWVKEHEPELFKKTAVFLLPKDYVRFRMTG--
A8FE32_BACP2          -------E-RLHQITKNQALEGFTLPKLLWVKEHEPEIDQQINMFLLPKDYVRFRLTG--
W4QRU0_BACA3          -------EERLLEITKNPALEGFTLPKLLWVKQNESEILAKSKVFMLPKDYLRYEMTG--
E6TXM8_BACCJ          -------EEKLLQLTKNPALEGFTLPKILWVKKNEPEIFTKVKTFVLPKDYVRLKLTG--
G2TH71_BACCO          -------G-KLLEITKNPALEGFTLPKILWVQQYEPENFRKTRVFLLPKDYLRYRLTG--
F2F597_SOLSS          -------QEDLLRITKNNALEGFTLPKILWVKEYEPEIFKAIKTFLLPKDYVRFVMTG--
Q03TX2_LEVBA          -------D-EFVDITRNQPLEGFTLTKLLWVKENEPDIWAQAKYFVLPKDYVRYRMTG--
C2CXH9_LACBR          -------D-RFIEITHNQPLEGFTLPKLLWVKENQPEIFAKAKTMLLPKDYVRFRMTG--
C5R8Q7_WEIPA          -------D-EFINITRNRAQEGFTLLAILWLKENEPESFARIDKIVTPKDYLRYRMTG--
Q03HN0_PEDPA          -------Q-DFIDITRNVPLEGFTLPKLLWVKENEPELFNNVSVFLLPKDYLRYRMTG--
XYLB_LACPE            -------D-DFIKITGNRPLEGFTLPKLLWVKENEPNIWKRARTFLLPKDYLRYRMTG--
H7C797_ENTFA          -------R-EVQEITKNIALEGFTLPKILWVQENEEKNWTKTRHIMLPKDYLVHWLTG--
S4D8M2_ENTFL          -------E-KVLAQTKNKALEGFTLPKILWVQENEPENWKKTKKMMLPKDYLSFWLTG--
XYLB_LACLA            -------Q-RLLEITKNIALEGFTLPKILWLQENEPEVWSRVKKIMLPKDYLSLWLTG--
Q49UE8_STAS1          -------D----YILSNPVLEGFTLTKLLWIKDNEPNNWNKIATFLLPKDYVRFKLTG--
XYLB_STAXY            -------LNSLLQLTQNTVLEGFTLPKLMWLKNHEQDNYKRIYKFMLPKDYIVYKLTG--
C1CZT9_DEIDV          -------LTDLIARTGNRAVTGFQLPKVLWLKSAEPEVFARLAHVLLPKDYLGYALTG--
D3PP61_MEIRD          -------RSELIRRTGNGAVTGFQLPKLLWLRNQHPALFQRLHKVLLPKDYLAFLLTG--
XYLB_ACTM4            ----------WAEAVGIVPVASFTLTKLRWLARNEPANAAKVAAVCLPHDWLTWKLSG--
A1SM63_NOCSJ          ----------WVDAVGLVPVASFTVTKLRWLARHEPDNAARTAAVCLPHDWLTWKLAG--
C7Q039_CATAD          ----------WAQAIGSVPVASFTATKLRWLAEHEPENAARVAAVCLPHDWLTWRLRG--
H6RUW2_BLASD          ----------WADAVGLVPVASFTASKLRWLADAEPANADRTAAVCLPHDWLTWRLSA--
B2HNZ2_MYCMM          ----------WAQAVGLVPLAAVTVAKLRWLADNEPQHADRTAAVCLPHDWLTWRLRG--
A0A1E3S1B9_9MYCO      ----------WAQRVGVVPVAAITASKLRWLADHEPAHADATAAVCLPHDWLTWRLSG--
C5C1D9_BEUC1          ----------WASAVGTVPVASLTITKLRWLRDAEPEHAARVAALALPHDWLTWKLSG--
D3CZL7_9ACTN          ----------WAGAVGSVPVASFTVTKLRWLADHEPDSAARIAAIALPHDWLTWRLSG--
A8LDF9_FRASN          EHGGGRRAERWAAAVGLVPVASFTVTKLRWLADHEPDAAARIAAVALPHDWLTWRLSG--
K7SFY6_ACIA4          ----------WANATGSVPVASLTVTKLRWLADHEPDNAERIAAICLPHDWLTWRISG--
D6ZJF2_MOBCV          ----------WVAKTGSVPVSSLTVSKLRHLAVNEPENLSRTRAIALPHDYLTWKITK--
D4BQ14_BIFBR          ----------WADRTGSVPVASLTVTKIRWMATHEPDNLSRTTAVALPHDWLTWNLLG--
B8DTL1_BIFA0          ----------WVRAVGSSPVASYTLTKLRWVSEHEPQHAARIAAVCLPHDWLSWRIAGFG
Q8G3P8_BIFLO          ----------WVKAVGSSPVASYTLTKVAWVAENEPENAKKIAAVCLPHDWLSWRIAGYG
W5IK78_SCAIO          ----------WVKAVGSSLVASLTITKLAWVAQNEPDNASRIAAVCLPHDWLSWRIGGNG
H0QLE8_ARTGO          ----------FAQRTGLVPVASFTVTKVRWVRDHEPDIASRVAAVALPHDWLTWRLRGYG
C8XEG8_NAKMY          ----------YVRRTGVVPVASFTATKLRWLRDAEPDNAARVAAVALPHDWLTWRLRGFG
G0FXA6_AMYMS          -------PSAWAKSVGSVPVASFTVTKLRWLAENEPELADRVARVLLPHDWLTWKLTG--
E6SD13_INTC7          -------VSAWVDAVGLVLVGSFTVTKLRWLAQHEPDHAARVARVLLPHDWMTGRILQ--
D2PKF2_KRIFD          -------PEAWAEATGSLPVPSFTVTKLRWVRSAAPDVADRAAAVALPHDWLTHRLAA--
E1VS04_GLUAR          ----------CAEKIGSVPVASLTVTKLRWLRDHEPENASRTTQVLLPHDYLTWHLG---
G0HEP9_CORVD          ----------CVDLTGSRYVASITATKLRWMRDHEPENAARTASVLLPHDYLTRFLS---
C7MFT3_BRAFD          ----------SVEEIGSLMVASFTASKLRWVRDHEPENAQRAARVLLPHDYVSLHLAE--
F0M3I8_PSEPM          ----------WVDAVNLVPVASFTISKLAWLAQNEPELADRVDQVVLPHDWLNGALGG--
XYLB_STRCO            ----------WAERTGSVPSASFTVTKWAWLTEHEPEAARAVKAVRLPHDYLTERLTG--
K4RFH8_STRDJ          ----------WAERTGSVPGASFTVTKWAWLAEHEPDAVRATKAVRLPHDYLTERLTG--
XYLB_STRRU            ----------WAERTGSVPAASFTVTKWAWLAEHEPEAVRATRAVRLPHDYLTERLTG--
A0A059W750_STRA9      ----------WAERIGSVPGPAFTVAKWAWLRAHEPAAAAATTAVRLPHDYLVERLTG--
V6KT30_STRNV          ----------WIARTGSVPVASMTAAKWQWLRENDPASADAASAVRLPHDFLTERLSG--
F2RHK1_STRVP          ----------WLARTGSVPVASMTAAKWQWLRENEPRHAAAATAVRLPHDHLTERLCG--
A6VWT3_MARMS          ----------SIDAVGLVIATGYTASKLLWMKQHEPENFSRIVHILLPHDYLNYWLTG--
G8PZN9_PSEF3          ----------SLERLGVVIAPGYTVSKLLWTREQHPQVFERIASVLLPHDFLNYWLTG--
S2KNK3_HALAF          ----------CLDKLGLVLQTGYTASKVAWLRDVQPDAYRRIDSLLLPHDYLNFWLTG--
Q9CL71_PASMU          ----------AFSQLGIMPQTGYTASKILWFRKQYPEQYRRIAKIMLPHDYLNYWLTG--
A0A377ICL0_AVIPA      ----------CLEAIGLNLATGYMASKILWFKKYYPELYQQLACVLLPHNYINYWLTG--
F5YH07_TREPZ          ----------VIAEVCNLMLPGFTAPKILWLKRHKPEAFAKLRYIMLPHDYLNYRFTG--
F2NRV6_TRES6          ----------VVKEVQNFILPGFTAPKILWLKLHKKELFEKLHYIMLPHDYLNFLLTG--
F5Y8N6_TREAZ          ----------LIKTAGLPMRPGYTAPKVQWLKNHKPKAFAKLKHILLSHDYINFLLTG--
Q5GYQ6_XANOR          ----------SVAAAGNPIMAGYTASKLPWTRKHRPDAYAAMTTVMLPHDYINFWLTG--
                                                                     .   :   :    

XYLB_ECOLI            ------------EFASDMSDAAGTMWLDVAKR----------------------------
Q6DB06_PECAS          ------------EFASDMSDAAGTLWLDVAKR----------------------------
D8MVH3_ERWBE          ------------EFASDMSDAAGTMWLNVRQR----------------------------
F6CT01_MARPP          ------------DFATDVSDASGTLWLDMEQR----------------------------
G0AIZ5_COLFT          ------------NKVSEPSDAAGTLWLDVAKR----------------------------
C4LDR3_TOLAT          ------------EKISDMSDAAGTLWLDVARR----------------------------
B1Y6S9_LEPCP          ------------EAVSEMSDASGTLWLDVAQR----------------------------
G0ACI0_COLFT          ------------ERISDVSDAAGTLWLDVRRR----------------------------
A6X4G4_BRUA4          ------------EYVSDMSDSAGTSWLDTGAR----------------------------
Q1YHH9_AURMS          ------------EAVSEMSDAAGTAWLDTGAR----------------------------
I7E053_PHAIB          ------------RHVADMSDSAGTSWLDVGAR----------------------------
Q0FM50_SALBH          ------------ETFADMSDSAGTSWLDTGAR----------------------------
D0CPB5_RUELI          ------------DYVSDMSDASGTLWLDVRNR----------------------------
B2JHP3_PARP8          ------------DFVSDMSDASGTLWLDVAKR----------------------------
D5QJB6_KOMHA          ------------EMIEDMSDASGTLWLDVGQR----------------------------
B2IBW2_BEII9          ------------ELATDVSDAAGTWMFDQAGR----------------------------
A9HPF3_GLUDA          ------------ALATDMSDAAGSQLFDQQNR----------------------------
A8LIC3_DINSH          ------------RAVTEYSEAAGTLWLDQAAR----------------------------
D3PMG0_MEIRD          ------------QAASEPSDASGTLLYDLLAD----------------------------
Q1AS19_RUBXD          ------------EACSEPSDASATLLYDLAAD----------------------------
C6D7F3_PAESJ          ------------EIGTDTTDASGTSAYDTASL----------------------------
E7GJK6_CLOSY          ------------MFGAEVTDASASLMFDIVKR----------------------------
S0FL94_RUMCE          ------------EYATEVSDASGMQLMNIAER----------------------------
E7GIR6_CLOSY          ------------VFATEVSDASGMQLLDVQGR----------------------------
Q1IT93_KORVE          ------------EFAMDMADGSGTLLLDVARR----------------------------
A5UXA1_ROSS1          ------------ISATDAADAAGTLLLDLRQR----------------------------
D9SR75_CLOC7          ------------EFASEVSDASGTLFFDVENR----------------------------
F3ZWR6_MAHA5          ------------DFATDVSDASGTGLFDVEHR----------------------------
XYLB_BACSU            ------------VIHTEYSDAAGTLLLHITRK----------------------------
A8FE32_BACP2          ------------SVHIDYSDAAGTLLLNIGDR----------------------------
W4QRU0_BACA3          ------------AVHMEYSDAAGTLLLDVGSK----------------------------
E6TXM8_BACCJ          ------------QLHMDYSDAAGTLLFNVSTK----------------------------
G2TH71_BACCO          ------------TIGMDYSDAAGTLLLDIVNQ----------------------------
F2F597_SOLSS          ------------NLHMDYSDAAGTLLLDIEKS----------------------------
Q03TX2_LEVBA          ------------NLAMDYSDATGTVLLDVAKG----------------------------
C2CXH9_LACBR          ------------NLAIDYSDATGTVMLDVEKQ----------------------------
C5R8Q7_WEIPA          ------------KLQMEISDAAGTVALDVAAG----------------------------
Q03HN0_PEDPA          ------------KIAMEYSDAAGTVMLDEENK----------------------------
XYLB_LACPE            ------------KLAMDKSDATGTVLLDITTS----------------------------
H7C797_ENTFA          ------------CYSTDYSDAAGTLMLDVKKR----------------------------
S4D8M2_ENTFL          ------------NYSIDYSDAAGTLLLDVPQK----------------------------
XYLB_LACLA            ------------NIYTEFSDAAGTLLLDIEKK----------------------------
Q49UE8_STAS1          ------------KINMEYSDASSTLLLDPKQK----------------------------
XYLB_STAXY            ------------NVYTEPSDAAGTIMFSVKDE----------------------------
C1CZT9_DEIDV          ------------VLASEPSDASGVGALNLARL----------------------------
D3PP61_MEIRD          ------------ALSTEYSDASGIGALNLAEK----------------------------
XYLB_ACTM4            -------STDIADIKTDRSDASGTLYWSAKTN----------------------------
A1SM63_NOCSJ          -------APSLDALVTDRGDASGTGYWSPSTG----------------------------
C7Q039_CATAD          -------STDISELTTDRSDASGTAYWSPATE----------------------------
H6RUW2_BLASD          -------DRDLRTLVTDRGDASGTAYWSARTG----------------------------
B2HNZ2_MYCMM          -------DTDVATLTTDRSDASGTGYYDAGSD----------------------------
A0A1E3S1B9_9MYCO      -------SSDIAALRTDRSDASGTGYYSAERD----------------------------
C5C1D9_BEUC1          -------GTDVEELTTDRSDASGTGYFDASADG---------------------------
D3CZL7_9ACTN          -------ARSLDTLRTDRSDASGTGYYDAIGTAADAAGAADTFGGAADASGGRPV-----
A8LDF9_FRASN          -------ARSLHTLRTDRSDASGTGYFDA-------------------------------
K7SFY6_ACIA4          -------STDLHDLITDRSDASGTGYMAR-------------------------------
D6ZJF2_MOBCV          -------RNKITDLVTDRSDASGTGYFDPVEN----------------------------
D4BQ14_BIFBR          -------GDDISTLVTDRSDASGTGYYSAQDN----------------------------
B8DTL1_BIFA0          PV-DPGEDAHLDALFTDRSDASGTLYFDAASN----------------------------
Q8G3P8_BIFLO          PV-AEGEDAHLEALFTDRSDASGTIYYDAAHD----------------------------
W5IK78_SCAIO          PV-KSGR-ANLDALFTDRSDASGTAYFNSASN----------------------------
H0QLE8_ARTGO          PAGASPLGPDLGQLTTDRSDASGTGYWNPASG----------------------------
C8XEG8_NAKMY          PAGQSPLGPDLAELTTDRSDASGTAYFSPTTG----------------------------
G0FXA6_AMYMS          ------GDP-----VTDRGDASGTGYFSPSDN----------------------------
E6SD13_INTC7          ------HGNGFERWTTDRGDASGTGYWSAATG----------------------------
D2PKF2_KRIFD          ------GRNGIEDLTTDRGDASGTGWWSPATN----------------------------
E1VS04_GLUAR          ---------GRKEAVTDHGDASGTGYYDPAAR----------------------------
G0HEP9_CORVD          ---------GGLVTATDHGEASGTGYYSTRQR----------------------------
C7MFT3_BRAFD          ---------QGTEPFTDRGDASGTGYYSTRTE----------------------------
F0M3I8_PSEPM          ------------EFTTDRSDASGTGYFSPVTD----------------------------
XYLB_STRCO            ------------EGTTDRGDVSGTGWWASG------------------------------
K4RFH8_STRDJ          ------------QGTTDRGDASGTGWWASG------------------------------
XYLB_STRRU            ------------QGTTDRGDASGTGWWASG------------------------------
A0A059W750_STRA9      ------------QAVTDRGDASGTGWWATA------------------------------
V6KT30_STRNV          ------------TAATDPGDASGTCWYSTA------------------------------
F2RHK1_STRVP          ------------HPVTDPGDASGTCWYGTGVGVGTGVGVGVGTGTGIGFGSGVGVGFGSG
A6VWT3_MARMS          ------------NCVAEFGDASGTGFMDVRTR----------------------------
G8PZN9_PSEF3          ------------RHCSEYGDASGTGYFNVRTR----------------------------
S2KNK3_HALAF          ------------ECVAEAGDASGTGYFDTRTR----------------------------
Q9CL71_PASMU          ------------HFCMEYGDASGTGYFDVVQR----------------------------
A0A377ICL0_AVIPA      ------------IQKMEFGDASGTGLFDIVER----------------------------
F5YH07_TREPZ          ------------EYKAECGDASGMALFNGAKR----------------------------
F2NRV6_TRES6          ------------NYVMEQGDASGTALFNSKEK----------------------------
F5Y8N6_TREAZ          ------------TYTAEFGDASGSALFDVSKR----------------------------
Q5GYQ6_XANOR          ------------ARFAEVGDASGTGWLDVRTR----------------------------
                                      :  : :.                                     

XYLB_ECOLI            -----------------------------DWSDVMLQACDLS---------------RDQ
Q6DB06_PECAS          -----------------------------DWSDALLEACSLS---------------REH
D8MVH3_ERWBE          -----------------------------DWSDELLSACGLS---------------RNA
F6CT01_MARPP          -----------------------------QWSPLILEACGLT---------------IEQ
G0AIZ5_COLFT          -----------------------------DWSDELLTATGMR---------------RSH
C4LDR3_TOLAT          -----------------------------DWSDSLLAACGLT---------------RDN
B1Y6S9_LEPCP          -----------------------------RWSAEVLAACGMD---------------ESQ
G0ACI0_COLFT          -----------------------------DWFEPMLQATGLE---------------RHQ
A6X4G4_BRUA4          -----------------------------HWSRELLDKTNLD---------------ESQ
Q1YHH9_AURMS          -----------------------------DWSARMLEKTGLT---------------RGH
I7E053_PHAIB          -----------------------------DWSEWLLEAGHMR---------------RDQ
Q0FM50_SALBH          -----------------------------DWSEMLLEAGHMR---------------RDQ
D0CPB5_RUELI          -----------------------------RWSDELLQATGLN---------------ISQ
B2JHP3_PARP8          -----------------------------DWSDGMLAATGLT---------------RAH
D5QJB6_KOMHA          -----------------------------CWSDAALAATGLT---------------RHA
B2IBW2_BEII9          -----------------------------CWSEAAIKICGAD---------------PAW
A9HPF3_GLUDA          -----------------------------TWFAPVRDYLGLG---------------PAI
A8LIC3_DINSH          -----------------------------DWDREALAFSGLE---------------RAQ
D3PMG0_MEIRD          -----------------------------TWAWEALERLGLR---------------AEL
Q1AS19_RUBXD          -----------------------------RWSREAVRKLGLR---------------EEL
C6D7F3_PAESJ          -----------------------------RWSDPLIALAGLD---------------SSM
E7GJK6_CLOSY          -----------------------------DWSYELQRMCGFP---------------PSV
S0FL94_RUMCE          -----------------------------KWSDEVVGKLGIS---------------TSM
E7GIR6_CLOSY          -----------------------------CWSEEVLRALDID---------------RSL
Q1IT93_KORVE          -----------------------------RWSSEMANATGID---------------LKA
A5UXA1_ROSS1          -----------------------------DWSDEILAALDIP---------------RAW
D9SR75_CLOC7          -----------------------------QWSKEMMDILGIK---------------EEQ
F3ZWR6_MAHA5          -----------------------------RWSDKLLSILNIS---------------KDR
XYLB_BACSU            -----------------------------EWSNDICNQIGIS---------------ADI
A8FE32_BACP2          -----------------------------AWSEEICQVFDIP---------------FHI
W4QRU0_BACA3          -----------------------------EWSTELCEVVGIN---------------PEL
E6TXM8_BACCJ          -----------------------------KWSNEILNIFGLS---------------NDF
G2TH71_BACCO          -----------------------------SWSTDILRTFDIP---------------ADI
F2F597_SOLSS          -----------------------------EWSQEIAAVLGID---------------LAI
Q03TX2_LEVBA          -----------------------------EWSKKICDTFDIP---------------LSM
C2CXH9_LACBR          -----------------------------QWSQEILDAFDIP---------------MSL
C5R8Q7_WEIPA          -----------------------------TWSKRVQEVFDLP---------------ATM
Q03HN0_PEDPA          -----------------------------TWSTKIADAFDLS---------------QTI
XYLB_LACPE            -----------------------------QWSETLCNQLDIP---------------LTL
H7C797_ENTFA          -----------------------------VWSKTILDKFNIP---------------KEY
S4D8M2_ENTFL          -----------------------------KWAKEILDEFQIS---------------EEL
XYLB_LACLA            -----------------------------QWSEEITDAFNID---------------RRI
Q49UE8_STAS1          -----------------------------SWSKTTGSQFRI----------------HDI
XYLB_STAXY            -----------------------------NWSTELLHRLNID---------------PSI
C1CZT9_DEIDV          -----------------------------EWDADILSALGLA---------------ATL
D3PP61_MEIRD          -----------------------------RWDTDILQALSLS---------------PDL
XYLB_ACTM4            -----------------------------EYRRDLLELGF---------------GRDLV
A1SM63_NOCSJ          -----------------------------QYRRDLLELGL---------------GRDVV
C7Q039_CATAD          -----------------------------EYRRDLLTLAF---------------GRDLV
H6RUW2_BLASD          -----------------------------EYRLDLLERAMR--------------GRRPA
B2HNZ2_MYCMM          -----------------------------RYRFDLLELAMH--------------GRRPN
A0A1E3S1B9_9MYCO      -----------------------------AYQPDLLELAMR--------------GRRPM
C5C1D9_BEUC1          --------------------------GAGAYRPDLLARALG--------------RDDVV
D3CZL7_9ACTN          --------------------------SAGGYRRDLLALALRRTSG---------EAARIR
A8LDF9_FRASN          --------------------------ASGTYRRDLLALALRREPG---------DAERIV
K7SFY6_ACIA4          --------------------------QEPAYRYDILARALHISVD---------ATQQII
D6ZJF2_MOBCV          -----------------------------VYLPDILELAAGKT-----------GTDLI-
D4BQ14_BIFBR          -----------------------------EYCKDLLKLAAGSE-----------FAERVR
B8DTL1_BIFA0          -----------------------------TYRRDLLARGLQSAAADEPAPECLQAAARIV
Q8G3P8_BIFLO          -----------------------------EYRRDLIAMVLAPAEGEEAAKAHADA---IV
W5IK78_SCAIO          -----------------------------QYRTDLIDLALGRHD--------------IL
H0QLE8_ARTGO          -----------------------------TYDLELFSLAFGRPAVEAGTESHTERSGAVV
C8XEG8_NAKMY          -----------------------------DYDRELLVRALGHDAV---------------
G0FXA6_AMYMS          -----------------------------AYRLDVLSHAFGG--------------RTPE
E6SD13_INTC7          -----------------------------DYRLDLLELAFG---------------RRLA
D2PKF2_KRIFD          -----------------------------SYRTDLVERAFG---------------RSLA
E1VS04_GLUAR          -----------------------------RFLPDLAADALG---------------HSVQ
G0HEP9_CORVD          -----------------------------RWLPELAESALG---------------HPVD
C7MFT3_BRAFD          -----------------------------AWAPELAEKAVG---------------SALE
F0M3I8_PSEPM          -----------------------------SYRTDLLERFFG---------------RVPR
XYLB_STRCO            ---------------------------TEAYDEEILARVAL---------------DPAL
K4RFH8_STRDJ          ---------------------------TESYDEETLAHVGL---------------DPAL
XYLB_STRRU            ---------------------------TEAYDEEILGHVGL---------------DPAL
A0A059W750_STRA9      ---------------------------TGAYDAEVLDRVGL---------------APSM
V6KT30_STRNV          ---------------------------TGAYDPELLALVGL---------------DASL
F2RHK1_STRVP          VGTGTGVGAGTGTRTNARSRAATSTAGAGAYDREILDLLGL---------------DPSL
A6VWT3_MARMS          -----------------------------QWSTQVLDIID--GR------------LVDA
G8PZN9_PSEF3          -----------------------------QWDLQLLQHIDPSAR------------LQAA
S2KNK3_HALAF          -----------------------------RWRDDVFAEIAPELD------------AERV
Q9CL71_PASMU          -----------------------------QWHLEAFKLLAPELD------------PHQV
A0A377ICL0_AVIPA      -----------------------------RWNTQILNRIDDSGI------------LQRA
F5YH07_TREPZ          -----------------------------CWSQKICSIIDER--------------IIGL
F2NRV6_TRES6          -----------------------------KWSKKICEAIDES--------------LLKK
F5Y8N6_TREAZ          -----------------------------QWSKKVSGYIDPS--------------VFAA
Q5GYQ6_XANOR          -----------------------------QWSERMLRAVDAQRD------------LRDA
                                                    :                             

XYLB_ECOLI            MPALYEGSEITGALLPEVAK-AWGMA-TVPVVAGGGDNAAGAVGVGMVD---ANQAMLSL
Q6DB06_PECAS          MPTLYEGNQITGYLRPDIAS-RWGMD-PVPVIAGGGDNAAGAIGVGLYQ---TGQAMLSL
D8MVH3_ERWBE          MPALFEGNQITGKLHAELAE-HWGLAGSLPVVAGGGDNAAGAIGVGLYQ---PGQAMLSL
F6CT01_MARPP          MPSLFEGTQVTGYLKQDMAE-HWSIP-AVAVVAGAGDNAAGAIGMGIIE---PQQTMLSL
G0AIZ5_COLFT          MPRLVEGGESSGTLLPEVAS-AWGLSPEVIVAGGGGDGAASAVGIGAVN---PGDGFVSL
C4LDR3_TOLAT          MPRLAEGSEPAGTLKAEIAR-EWGLKDNVIIAGGGGDNAASAVGIGAVR---PGDAFVSL
B1Y6S9_LEPCP          MPRLVEGSEVSGTLKPALAA-RWGLTAGIPVAGGGGDNAASAVGIGAVR---PGEGFVSL
G0ACI0_COLFT          MPRLVEGSAAAADLCAAAAS-QLALQSTVLVAGGGGDNPVSAVGIGAIE---AGQAFVTL
A6X4G4_BRUA4          MPRLAEGTDATGRLRAGLAA-EWGIAGQPVVAGGAGDNAASACGMGTVK---PGHAFVSL
Q1YHH9_AURMS          MPRLVEGTAVSGGLRPELAA-RFGMQEGTVVAGGGGDNAASACGVGVAE---PGTGFLSL
I7E053_PHAIB          MPDLVEGSAAAGTLRPELAV-RWGLTGPVTIAGGAGDNAAAACGTGVMA---PGQGFVSL
Q0FM50_SALBH          MPALVEGSEAGGTLRPDLAA-RWGVNASVVVAGGAGDNAAAACGIGTMN---EGQGFVSL
D0CPB5_RUELI          VPRLVEGSEPAGFLRAELAQ-RWGV-GKVTVAGGAGDNAATACGLGVLQ---PGQGFLSL
B2JHP3_PARP8          MPRLVEGSAPAAQLSDALRR-DWGIAGPVVLCGGAGDNAASAIGTGVAD---AGSAFLSL
D5QJB6_KOMHA          MPALVEGSAPAGRMHPALAR-RWGMKDAPILAGGAGDNAAGAVGLGAVA---AGSAFVSL
B2IBW2_BEII9          LPKIYESNEATGILRKEWVS-RWGLPNDVVIAAGGGDAAMGGVGIGAIS---NGDAFISL
A9HPF3_GLUDA          LPELRDGTDCAGRLRTATAR-DLGLPPGIAVATGGGDTPVGAVGLGRVD---AGQSYISL
A8LIC3_DINSH          MPALGAGTDLAGPLSAAAAA-ALGLKPGVPVIRGGGDAMVGAAGIGVVA---PGQAMISL
D3PMG0_MEIRD          LPPLLPSGTVAGHLTRAAAR-WLGLPEGLPVAAGAADTAAALLGSGL-A---VGQVQLTV
Q1AS19_RUBXD          LPPLRPSAALCGELAPGAAR-HLGLPAGLPVACGGADTACAMLGTGLHA---QGEVQLTV
C6D7F3_PAESJ          FPKIGNPWEIAGYVTRAAES-ESDFIAGTPVVYGGADQAMQAVGNGIIK---PGNLSVTI
E7GJK6_CLOSY          FPECHESGEIQGRVSRECAC-LTGLGESVPVIYGMGDQQAQSIGNGVFS---EGTFICNI
S0FL94_RUMCE          LGKMYESQEVTGKVTASAAA-ITGLNEGTIVVGGAGDQAAGAVGNGIVK---PGVVSSTI
E7GIR6_CLOSY          LGEVYESCEITGTLLPEIAE-RTGLNADTIVVGGAGDNAAAAVGTGVVA---DGAAFTTI
Q1IT93_KORVE          LPPLFESCDVCGVVSKEGAA-ATGLAAGTPVVAGAGDQAAGAVGLGVVS---AGAVHATI
A5UXA1_ROSS1          LPRVFEGPEVTGEVRPDIAA-ALGLPAGLPVVAGGGDNAAAAVGAGIVQ---SGIVSSSI
D9SR75_CLOC7          LPKMYESWEVTGKVTKEVAE-YIGVSSETVVVGGGGDQAAGAIGTGTVD---AGILSVAL
F3ZWR6_MAHA5          LPSCFESIEVTGYVNAKASG-MTGLPKGLPVVGGGGDAVVQTTGTGLIK---EGILGTII
XYLB_BACSU            CPPLVESHDCVGSLLPHVAA-KTGLLEKTKVYAGGADNACGAIGAGILS---SGKTLCSI
A8FE32_BACP2          CPPLVSSEDEVGTLLPHIAR-EAGIEEGAKVFAGGADNACGAIGAGILS---SGRTLCSI
W4QRU0_BACA3          CPPLVESHAHVGNITEDFAA-KTGLALTTKVFAGGADNACGAIGSGILS---EGKTLCSI
E6TXM8_BACCJ          CPPLVGSHEQVGTISSDVAE-KTGLSPHTRVFAGGADNACGAIGAGILE---EGSTLASI
G2TH71_BACCO          CPPLVETEAEVGTLLPDIAA-TCGLSPATKVFAGGADNACGAIGAGILE---EGKALCSI
F2F597_SOLSS          CPPLVSSATEVGQLTEEFAK-STGLTTATKIYAGGADNACGAIGSGVAG---DGKTMVSI
Q03TX2_LEVBA          CPPLIKSVDLAGTVTPAYAE-FSGLTTTTKVFGGAADNAAGAVGAGILH---PNMVLSSI
C2CXH9_LACBR          CPSLVRSIDDTGNIDDWYAE-YSGLSTDTKTFGGGADNACGAVGAGIDS---PTKVLSSI
C5R8Q7_WEIPA          FPEIIQSIDNVGAISAAYAE-FSGLSTDTQVVGGAADNAAGAIGAAILK---PNMVMSSI
Q03HN0_PEDPA          FPPLIESIGFAGTIGDTYAK-FSGLKTTTKIYGGAADNAAGAIGAGILS---SNQVLSSI
XYLB_LACPE            CPPLIESTAYVGHINQTYAQ-LSGLSVNTKVFGGAADNAAGAVGAGILS---SDKALVSI
H7C797_ENTFA          LPTLFESSAKVGNMRSSLIN-RFGLETKVEIFAGGADNACAAIGAGIVN---SEVAMLSI
S4D8M2_ENTFL          LPPLFESTEKTGILRPALQE-ALGFEKEVPIFAGGADNACAALGAGITK---EGSGMLSI
XYLB_LACLA            LPELIESTDRTGFVKAEIAE-RYKLTNEVKVFAGGADNAAAALGVGLIN---EEVGLISM
Q49UE8_STAS1          YPSLVSSGDFIGYVESSLAK-SLGLTGEVAVFAGGGDNACGALGAGVIK---SNDTLCSI
XYLB_STAXY            CPEIIASHQKSGQLTEKVKN-TLGIDSNINVYQGGANNACGALGSGITD---EQKQLVSI
C1CZT9_DEIDV          FPEVRPSTARVGTLHSSLAA-VTGLPAGLPVVAGGGDNAAAAVALGLGSAQ-PEIGSVSL
D3PP61_MEIRD          FPEVGESQRVVGHLSPAWAQ-ATGLQAGIPVVAGAGDNAAAALGLGVSRHR-AGVGSLSL
XYLB_ACTM4            LPEVLGPTGIAGHLP-----------NGAPLGPGAGDNAAAALGTGALPG----DVIVSI
A1SM63_NOCSJ          LPRVLGPAEVAGRTP-----------AGQLLGPGTGDNAASALGLGAVAG----DVIVSI
C7Q039_CATAD          LPRVAGIREAVGHF------------GDIVLGPGAGDNAAAALGLGARVG----DVVVSI
H6RUW2_BLASD          VPRVAGPAERVGALAG----------GSAVLGPGTGDNAAAALGLAARPG----DVVVSI
B2HNZ2_MYCMM          LPRVLGPSARATR-------------GSKTFGAGLGDNAAAALGLGADEG----DVMVSI
A0A1E3S1B9_9MYCO      VPTVLGPRDVAGHLG-----------SGAVLGPGAGDNAAAALGLGAGLG----DGIVSL
C5C1D9_BEUC1          LPRVLAPAERAGTAEGAS--------SPAVLGPGAGDNAAAALALGLGPG----DVALSV
D3CZL7_9ACTN          LPEVAAPGEAVGRGDPGAGL------GHLLLGPGCGDNAGAALGLGLRPG----ECLLSL
A8LDF9_FRASN          LPTVAGPEEIAGRGDTSAGW------GHLLLGPGCGDNAGAALGLGLRPG----EALMSL
K7SFY6_ACIA4          LPRILGPWDAAGHGDPSRGW------GEIVLGPGCGDNAGSALGVDLAPG----QALISI
D6ZJF2_MOBCV          LPKVLGPHTPVGEFSVQG--------KEMLVGPGAGDNAGAALGLDQKPG----HVIISL
D4BQ14_BIFBR          LPRVASPAQRVAEAKIDG--------HNLVIGPGAGDNAGAALGLGLKPG----EVAMSI
B8DTL1_BIFA0          LPAVLGPQEAAKVKASPSIAGG-AVDGGCIIAPGGGDNAMAALGLGMAVG----DVSVSL
Q8G3P8_BIFLO          LPTVLGPREAAAVKADPAIAGK-DVEGGCIIGPGGGDNAMASLGLGMAVG----DVSVSL
W5IK78_SCAIO          LPRVLGPTQVGAV-ADPAIAGS-DIEGDCLIGPGGGDNAMASLGLGMSVG----DVSVSL
H0QLE8_ARTGO          LPRVLAPGESPGQVHPAVAGEALPPGHSVLLGAGAGDNAAAALGLDARPG----DVVVSV
C8XEG8_NAKMY          LPRVLGPGEAAGQVG------------SLIVGPGAGDNAGAALGLGAAEG----DCVVSI
G0FXA6_AMYMS          LPTVLGPADAAGHTP-----------DGVLVSAGTGDNMAAALGLELQPG----DAVVSL
E6SD13_INTC7          VPEVLAPSAPAGRTS-----------DGMLVAAGTGDNMGAALGLALSPG----DVVVSL
D2PKF2_KRIFD          LPRVAEPAETVGETA-----------SGALLAAGTGDNMAAALGLDLQPG----DVAVSL
E1VS04_GLUAR          LPRLAQANEQVGRTST-----------GAVIGAGTGDNMAAALGLDLQPG----DVCISI
G0HEP9_CORVD          LPYLAAPNESLGTVAASVCAGA--ARRGTVIAPGTGDNQGAALGLGLGPG----DVCVSI
C7MFT3_BRAFD          LPRLPAAPQEVMARTA----------RGAAIAPGTGDNMGAALGLSLGPG----DVSVSI
F0M3I8_PSEPM          LPRIVASHERAGTVQSGWGI------DGAVLAAGAGDNAAAALGLGLRPG----EVVVSI
XYLB_STRCO            LPRVVRPGE---VAGTVRDGHGLPFSKGTLVAAGTGDNAAAALGLGLRPG----VPVMSL
K4RFH8_STRDJ          LPRVVRPGE---VAGTVREHHGLPFSKGTLVAPGTGDNAAAALGLGLRPG----TPVLSL
XYLB_STRRU            LPRVVRPGE---VAGTVRDSHELPFSKGTLVACGTGDNAAAALGLGVRPG----TPVMSL
A0A059W750_STRA9      LPRVALPGE---AAGTVR-TDELPLPHGALVAAGTGDNMAAALGLGLRPG----QPVLSL
V6KT30_STRNV          LPAVAPTGGARVGSLTASAAEQLGLPAGIAVAAGTGDNMSAAVGLGLGGAGLLDHPVLSL
F2RHK1_STRVP          LPAVAPGGATRVGTLTPAAAEALGLPRTVAVAAGTGDNMAAAVGLGLGGAGLLDHPVVSL
A6VWT3_MARMS          LPNLIEAHQPAGVIRPELAKSL-GLNENVLVSSGGGDNMMGAIGTGNITPG---VVTISL
G8PZN9_PSEF3          LPELIEAHQPVGRILPAIAAHL-GINPDAVVASGGGDNMMGAIGTGNIQPG---VITMSL
S2KNK3_HALAF          LPRLIESYEPAGVVRPGLAREL-GLSDEVLVASGGGDNMLGAIGTGNIAPG---LVTLSL
Q9CL71_PASMU          LPLLRSAQQKIGKVRAEIAALL-GLSENVIVSTGGGDNMMGAIGTGNIQQG---IVTMSL
A0A377ICL0_AVIPA      LPPLSENTPILGVVTPEVAKLL-DLSPSTFVANGSGDNMMSAIGTGNIQAG---IITMSL
F5YH07_TREPZ          LPPLISSDEPNGFVNAAAAERF-GIPRGIPVSSGGGDNMMSAIGTGTVRDG---FLSMSL
F2NRV6_TRES6          LPKIIASDEPSGFVSKKAADWL-GIPKGAAVSSGGGDNMMSAIGTGAVKSG---TLTMSM
F5Y8N6_TREAZ          LPPLVEAGELAGTVSAAAAALY-GIPEGAIVSAGGGDNMMSAIGTGTVSDG---FLTMSL
Q5GYQ6_XANOR          LPPLVETGAVY-TLSDAAAQAL-NLPAGVRVTTGGGDNMMAAIGTGNVVPG---RLTMSL
                                                       * .:      .               :

XYLB_ECOLI            GTSGVYFAVSEGFLSKPESAVHSFCHALPQRWHLMSVMLSAASCLDWAAKLTGLSNVP--
Q6DB06_PECAS          GTSGVYFAVSDGFLSNPQHAVHSFCHALPNTWHLMSVMLSAASCLDWVARLTHAESVP--
D8MVH3_ERWBE          GTSGVYFAVSDGFRSNPESAVHSFCHALPETWHLMSVMLSAASCLDWACKLTNIRDVP--
F6CT01_MARPP          GTSGVIFSVSEGFVANPAVALHSFAHAVPNTWHSMSVMLSAASCLDWVARLAQFKDVP--
G0AIZ5_COLFT          GTSGVLFVVNDRFRPNPAQAVHAFCHALPGRWHQMSVMLSAASCLRWFCRLVSVD-EA--
C4LDR3_TOLAT          GTSGVLFAVNDQYRPNPQSAVHAFCHALPHRWHQMSVMLTAASALRWLCQLLNTN-ET--
B1Y6S9_LEPCP          GTSGVIFLASDRFRPNPAHAMHAFCHALPGRWHQMSVMLSAANGLRWVKNLLGAHSEA--
G0ACI0_COLFT          GTSAAVVAITDHVAGNPASAVHSFCHALPQRWYTMGAMLAGASCLRWVTQLLGQVNEQ--
A6X4G4_BRUA4          GTSGVLFAANGAYQPKPESAVHAFCHALPGTWHQMGVILSAASALDWYARLVGKTAHE--
Q1YHH9_AURMS          GTSGVLFTASAGYEPAPETALHTFCHAIPGLWHQMGVTLSAAGSVEWLSKLLKEEPAA--
I7E053_PHAIB          GTSGVVLTARDGFRPDPATAVHTFCHAIPDRWYQMGVMLSATDCMNWLGRITGQSPAD--
Q0FM50_SALBH          GTSGVLLAARDGYHPAPETALHTFCHAVPSRWYQMGVMLSATDSLNWLARITGAKPAE--
D0CPB5_RUELI          GTSGVLFCATDRFLPNTGQAVHAFCHALPDSWHQMGVILSATDSLNWLAGIAGQSPAA--
B2JHP3_PARP8          GTSGVLFAGTDRFAPNPAQGVHAFCHCLPARWHQMSVILSAASSLGWLSKVVGREVG---
D5QJB6_KOMHA          GTSGVLWVTTQRFRPHPQGGIHAFCHAVPGMWHQMGVTLSAASSLAWWSRTTGIAEGD--
B2IBW2_BEII9          GTSAQLFVAADQHRPSIHNLVHAFCHAVPQGWYQMAAMLSGASPLAAAARWLEADIPL--
A9HPF3_GLUDA          GTGAVYVTVQDTYAPDEAVGLHTFAHCVPRRWYQMAAMLNGASCLAWVAALCRESDLP--
A8LIC3_DINSH          GTSGQYLVASEAHRPNPAGLVHSFAHCVPGAYIQMAAMLNGAAPMAWLAGVLGRS-VP--
D3PMG0_MEIRD          GSGAQIAVLLDTLQIDPTLRTHRYRATRPQQWYALAAMQNAGLALEWVRNMLHLSWEE--
Q1AS19_RUBXD          GTGAQIVAPRRGFAPDPSLRTHLYRAVSPGLYYAMAAVQNAGLALEWVRELLRVSWET--
C6D7F3_PAESJ          GTGGQLFTAIDQPAYDRKLRTHTYVHAVPNRWYLMGATMSAGLSLKWLASQVLNKQD---
E7GJK6_CLOSY          GTGGQVSAFCGQPSFDPALRTQTFCHGIEGAWTLYGAVLNAGMSLKWLKDNILREQS---
S0FL94_RUMCE          GTSGVVFAYTDKLTIDPLGRVHTFCHAVPNTYHIMGVTQGAGLSLKWFRDTFCMEELMTA
E7GIR6_CLOSY          GTSGVVYAHSSKLAVDPKGRVHTCCCAVPGAWHMMGVTQAAGLSLKWFCGQFCQDYMVEA
Q1IT93_KORVE          GTSGVVFASTDRPAMDPLGRLHTFCHAVPGRWHVMGVTQAAGLSLRWFRDNFGTRVE---
A5UXA1_ROSS1          GTSGVIFAHSDEIALDPHGRLHTFCHSVPGRYHLMAVTLAAGGSFRWFRDTLRTVTG---
D9SR75_CLOC7          GTSGVVFASSDSYAVDDENTLHSFCHG-NGKYHQMGVMLSAASSLKWWVEEINEDSK---
F3ZWR6_MAHA5          GTAGIVAMGLNNYKFNEHGSLQIFCNNYPGTWHAMGVTLGAGASLEWLKDILYDDNC---
XYLB_BACSU            GTSGVILSYEEEKERDFKGKVHFFNHGKKDSFYTMGVTLAAGYSLDWFKRTFAPNES---
A8FE32_BACP2          GTSGVILSYEEDHERALQGNLHLFHHAKKDALYTMGVTLSAGYSLNWVKHLLSPEES---
W4QRU0_BACA3          GTSGVVLSYEERNDRDFGGKVHYFNHGEENAYYTMGVTLAAGYSLSWFKDTFAAEEP---
E6TXM8_BACCJ          GTSGVVLSYEDSDDKDFKGTVHYFNHGAPDAYYTMGVTLSAGHSLSWFKEVFAKEED---
G2TH71_BACCO          GTSGVFLSYESDSNKNFGGKVHLFNHGQKDAYYTMGVTLAAGYSLSWFKDTFAKGED---
F2F597_SOLSS          GTSGVLLSYEESNTKDFEGKVHYFNHVVEDAFYTMGVTLSAGHALSWFKERFAEGQS---
Q03TX2_LEVBA          GTSGVVLKYEDNADVNYHGVLQFEDHAIPDKFYSMGVTLAAGYSLSWFKKTFAPAED---
C2CXH9_LACBR          GTSGVILKYEPNKETNYNGVLQYEDHAIPDAFYSMGVTLAAGFSLSWFKKTFAADED---
C5R8Q7_WEIPA          GTSGVVLKYEDTADVNYHGKVTFFNHAIPNKFYSMGVTLAAGYSLSWFKKNFASEIT---
Q03HN0_PEDPA          GTSGVVLKYEDNADVDYKGALHFFNHAIPNKFYTMGVTLAAGYSLSWFKKTFSADQD---
XYLB_LACPE            GTSGVVLKYEDNAQTDYRGVLQYERHAFPGKYYSMGVTLAAGYSLNWFKQTFAPDED---
H7C797_ENTFA          GTSGVFLSMEDDAENEYQGNLHLFNSALPNSYYSMGVTLAAGNSLKWFRDTFAKDVE---
S4D8M2_ENTFL          GTSGVFLSFESSAKAEYAGELHLFNHTLKDSYYSMGVTLAAGNSLNWFKETFAPESN---
XYLB_LACLA            GTSGVVSAYEPKI-ADYKGKLHFFNHTVPGACYSMGVTLAAGNSLNWYKETFGKGLS---
Q49UE8_STAS1          GTSGTLLTCESGEGKTYRHNLHYFNHVVEDKSYVMGVTLAAGDSLNWLKKHVFPGLT---
XYLB_STAXY            GTSGVALSIENSTDYENDGNVHYFNHCVPNQKYIMGVTLSAGYSLEWLKQLISADEN---
C1CZT9_DEIDV          GTSGVLFAPLSSPTPDPRGRVHLFAHA-DGGYHLLGVTLACAGALQWLRDRLCPEVS---
D3PP61_MEIRD          GTSGVIFIPTEQPTPEPEGRVHLFAHA-DGGYHLLGVTLSAAGSLEWLRG-LFPEVG---
XYLB_ACTM4            GTSGTVFVSSDVAPVDGRGTVAGFADT-TGRFLPIVVTLNAARVLDAAAKLLGVDHDE--
A1SM63_NOCSJ          GTSGVACAVAEQPVGDVSGAVAGFADA-TGRFLPLVATMNAARVLAAAERILRVDHSE--
C7Q039_CATAD          GTSGTVFAVCDTPTAEPTGTVAGFADA-TGRHLPLVCTLNAARVLDAAAGMAGVDLHE--
H6RUW2_BLASD          GTSGVVSAVTPTAVADVTGTVAGFADA-TGNHLPLVATLNAARVLDAAAALLGVDHET--
B2HNZ2_MYCMM          GTSGVVCAVAADPVRDETGLVAGFADG-TGRYLPLVCTLNGARVLDAAAAMLRVDHDE--
A0A1E3S1B9_9MYCO      GTSGVVSAVSAAAPHDPEGLVAGFADA-TGRHLPLVCTLNGAPVLAAVARMLDVDFAE--
C5C1D9_BEUC1          GTSGVVSAVVDHPVADPTGLVAGFADA-TGRYLPLAVTLNASQVLDRVAGLLGVDHGG--
D3CZL7_9ACTN          GTSGVVAAVSRVGTRDASGAVAGFADA-TGHHLPLACTLNASRVLDVTRRLLDVDRDT--
A8LDF9_FRASN          GTSGVVAAVATAATRDATGAVAGFADA-TGHHLPLACTLNASRVLDATGTLLGVGHDE--
K7SFY6_ACIA4          GTSGVAAAVSKESVADPSGLVTGFSDA-TGHWLPLACTLNASRIIDAIGSIIGADYAE--
D6ZJF2_MOBCV          GTSGVVSLVSKKPTCDENGEVTGFADA-TGNYLPLVCTLNASRVLDTTAAALGVNYER--
D4BQ14_BIFBR          GTSGVVSLVSAVATHDPEGYVTGFADA-SGNYLPLVCTLNASRVVDTFRALLNMSHAE--
B8DTL1_BIFA0          GTSGVAAAVSERPAYDLNGSVSGFADC-TGHFLPLACTINASRILDAGRAVLDVDYEE--
Q8G3P8_BIFLO          GTSGVAAAIAENPVYDLTGAISGFADC-TGHYLPLACTINGSRILDAGRAALGVDYDE--
W5IK78_SCAIO          GTSGVAAAVSPAPAYDMTGAVTGFADC-TGHWLPLACTINGSRILDAGRRALGVDYDG--
H0QLE8_ARTGO          GTSGTVFAVSDEPVGDPSGTVAGFADA-SGLFLPIAVTLNAARVLTSVAGLLGVDFDE--
C8XEG8_NAKMY          GTSGTVFAVTPEPVRDATGTVAGFADA-SGVFLPLVATLNAARVLDAIAGLLGVDHAG--
G0FXA6_AMYMS          GTSGTVFGVAETGAADVSGEVAGFADA-TGRFLPLACTLNAARVLTATAAMLGATLSE--
E6SD13_INTC7          GTSGTVFTPHDHAIRDESGAVAGFADA-TGRHLPLMCTLNAARVLTAAAGMLGVDLDT--
D2PKF2_KRIFD          GTSGTAFAVSTHPTSDPSGLVAGFADA-TGRYLPLVCTLNAARVMSATAQLLGMDLAE--
E1VS04_GLUAR          GTSGVASAVVEDSVHDGSGMVTGFVAA-NGKFLPLACTLNGAPVLDFGARMLGVGKQE--
G0HEP9_CORVD          GTSGVASAVVEDSVHDSAGVVTGFADA-SGRYLPLVATLNAARVLDLGRRLLGVDWEE--
C7MFT3_BRAFD          GTSGVCAMVSASRPGDASGAVTGFADA-TGRFLPMATTINASRILEAARALLGVSHEE--
F0M3I8_PSEPM          GTSGTVFTTTPSPMPDHTGAIAGFADA-AGGHLPLLAMLNSARVMAATASMLGVGLAQ--
XYLB_STRCO            GTSGTAYAVSQRRPADPTGTVAGFADA-RGDWLPLACTLNCTLAVDRVASLLGLDRE---
K4RFH8_STRDJ          GTSGTVYAVSRHRPADPSGTVAGFADA-HGDWLPLACTLNCTLAVDRVAALLGLDRE---
XYLB_STRRU            GTSGTVYAVTQRRPADPTGTVAGFADA-RGDWLPLACTLNCTLAVDRVAALLGLDRE---
A0A059W750_STRA9      GTSGTAYAVTTRRPADPTGTVAGFADA-RGDWLPLACTLNCTLAVDRVAALLGRDRE---
V6KT30_STRNV          GTSGTVFAATRTRPASAA--LSGFAAA-DGTFLPLGCTLNCTLAVDKVAELLRLDRD---
F2RHK1_STRVP          GTSGTVFAATRTRPADPA--LAGFAAT-DGTYLPLGCTLNCTLAVDRFATLLGLDRE---
A6VWT3_MARMS          GTSGTLYAYSDKSPMLDHASVAPFCSS-SNGWLPLICTMNLTGVMNQFRGLFSLDILQ--
G8PZN9_PSEF3          GSSGTVYAYAAEPAVSPQPSVATFCSS-SGGWLPLICTMNLTNATGAIRELLALDIDT--
S2KNK3_HALAF          GTSGTVCAYSREPVRAESAMVANFCAS-HGGWLPLICTMNVTSATTLVRELFGLDLAA--
Q9CL71_PASMU          GTSGTLYAYTDKPLTDLPMEIANFCSS-TDGWLPLVCVMNMTSANKNLMDLLQIDVAK--
A0A377ICL0_AVIPA      GTSGTLFAYSDTPIRPASKLIANFCSA-NGGWLPLICTMNITSATSHIQKCLKQDLTL--
F5YH07_TREPZ          GTSGTLYGYSQTPIADPKNGLSGFNSS-TGGYLPLLCTMNCTVATEEVRRLFNLDVRE--
F2NRV6_TRES6          GTSGTLYGFTDSSVADPAEGISGFCSS-SGGYLPLLCTMNCTVASEEIRTLLNLDVKE--
F5Y8N6_TREAZ          GTSGTLFGFSKTPVIDPSGDLAAFCSS-SGGWLPLLCTMNCTVASEEFRALFGLDVKA--
Q5GYQ6_XANOR          GTSGTLFAYADHPVVDDQARWAAFCSS-SGGWLPLICTMNCTVATEAVMHMFSITRAQ--
                      *:..                                                        

XYLB_ECOLI            ----------ALI--AAAQQADES---AEPVWFLPYLSGERTPHNNPQAKGVFFGLTHQH
Q6DB06_PECAS          ----------ALLQEVASMPADDT---ITPVWFLPYLSGERTPHNNPDAKGAFWGLTHQH
D8MVH3_ERWBE          ----------TLL--TLAEQAKPV---DAPVWFLPYLSGERTPHNNPQAKGAFWGLTHQH
F6CT01_MARPP          ----------SALV-AASSRTHSN---QDSLFFLPYLSGERTPHNDANAKGVFWGMTYET
G0AIZ5_COLFT          ----------TLLNEIAELDSAAL---ENAPLFLPYLSGERTPHNDPYAQGVFHGLSHAH
C4LDR3_TOLAT          ----------TLLSEVATLSLSEQ---QQSPIFLPYLSGERTPHNDPQATGAFHGLTHAT
B1Y6S9_LEPCP          ----------ALLDTVAALTPLQR---AQAPVFLPYLNGERTPHNNPHAQGVFFGLNNEH
G0ACI0_COLFT          ----------ALLQLAQEQVPLGQPVPAATPLFLPYLAGERTPHNDPLLRGGFMNLAYET
A6X4G4_BRUA4          ----------LDKALGDTLNAPGS------ATFLPYLSGERTPYNDAKIRGVFSGLEHES
Q1YHH9_AURMS          ----------LTGALGETVQAPGR------LTFLPYLSGERTPHNDSEIRGVFAGLEADT
I7E053_PHAIB          ----------LTAGLGEELQPPGP------VTFMPYLSGERTPHNSASLRGGFQGLSIAT
Q0FM50_SALBH          ----------LTAPLGESLQAPGR------VRFLPYLSGERTPHNDAGIRGSFTGLGADT
D0CPB5_RUELI          ----------LSRMVSQDAQGPAP------AIFLPYLSGERTPHNAPDMAGAFVGLRRDH
B2JHP3_PARP8          ----------ILPELASTANAATA------PIFLPYLSGERTPHNDANARGVFWGLTGAH
D5QJB6_KOMHA          ----------LLAELPERVERPSP------VIFLPYLSGERTPHNDGAIRGVFAGLSSGT
B2IBW2_BEII9          ----------LLQEAEQSFRGPSK------LIALPYLEGERTPHNDPFARGVIFGLDNSA
A9HPF3_GLUDA          ----------ALLRRVEAR-GPGP----SRILFQPYLRGERTPHDDALARGAFIGLDASC
A8LIC3_DINSH          ----------DLLAAAETA-DPA-----HVPLFLPYLTGERTPHGDPEARAGFEGLSHGS
D3PMG0_MEIRD          ----------AYREAQQAPAGCEG------LCFLPYLTGERTPHLNPQARGVWAGLRLNH
Q1AS19_RUBXD          ----------LYEEAAAVPPGSGG------VTFLPYISGERTPHLDPAARGAWVGLGLGC
C6D7F3_PAESJ          -------YKALDRMAKEVPAGSEG------LLFLPYLTGDRTPHMDPQASGMFFGLKLEH
E7GJK6_CLOSY          -------FEKLSEMAGEIPSGSEG------LIFLPYLTGERTPHMDTAARGMFFGLHLSH
S0FL94_RUMCE          ELSDIDVYKLLDAEAETIKPCSDG------LIYLPYLMGERTPHLDPNAKGVFFGLTAKH
E7GIR6_CLOSY          ERQGRDVYDLVNEAVQEIKPGSDR------LIYLPYLMGERTPHLDPDCRGVFFGLSAIH
Q1IT93_KORVE          --DRRDPYDRLMDEAASAPPGCDG------VLWAPYLMGERTPHVDPNARAALVGLAANH
A5UXA1_ROSS1          ---QHLGYDDLTNLAESVPPGAEG------LIFLPYLSGERTPHLDPLARGAFIGLTARH
D9SR75_CLOC7          ------DFNKLLADAEKSTVGSNG------VIFLPYLTGERTPYSDPNAKGVFFGLNITT
F3ZWR6_MAHA5          ----DNIYKRMNENAAASPPGSRS------LIFLPYIFGERCPYADPLARGAFIGITYQH
XYLB_BACSU            -------FEQLLQGVEAIPIGANG------LLYTPYLVGERTPHADSSIRGSLIGMDGAH
A8FE32_BACP2          -------FQSLLEGAVDVAPGANG------LLFTPYLVGERTPHADSIIRGSLIGLDSRH
W4QRU0_BACA3          -------FEQLLTGLDEVPVGANG------LLFTPYIVGERTPHADAVIRGSFIGMDASH
E6TXM8_BACCJ          -------FNELLAEVDTIPPGANG------LLFTPYLVGERTPHVDSTIRASFIGIDSAH
G2TH71_BACCO          -------FATLLEEAAHSSIGANG------LLFTPFIAGERTPYADAKIRGTFTGIDSSH
F2F597_SOLSS          -------YDELFAGIDTITPGSNG------LLFTPYIVGERTPYADSTIRGSYIGIDASH
Q03TX2_LEVBA          -------FTEVVASAAKSTVGANG------LLYTPYIVGERAPYADADIRGSFTGVDGTH
C2CXH9_LACBR          -------FTSVVESAAKSTVGANG------LLFAPYIVGERAPYADADIRGSFIGIDGIH
C5R8Q7_WEIPA          -------FNEMVDSAQSSTIGANG------LLFTPYIVGERG---DGDIRGVFIGVDGTQ
Q03HN0_PEDPA          -------FTEFVNAAGDSTVGANG------LLFTPYIVGERTPYPDGDARGSFIGIDGTH
XYLB_LACPE            -------FGTVVASAEQSTIGANG------LLFAPYIVGERAPYADATIRGSFIGVDGSH
H7C797_ENTFA          -------FSDLLANIDEVIVGSEG------LIFTPYIRGERTPYQDSQIRGSFIGIDSRH
S4D8M2_ENTFL          -------FSELLAEVHEVSPGADG------LLFTPYIVGERTPHTDSQIRGSFIGIDTRH
XYLB_LACLA            -------FNELLSEVYTVSPGSEG------LLFTPYIVGERTPHFDSKIRGSFIGISAHH
Q49UE8_STAS1          -------FNQILSLASNSTIGSEG------LLFAPYLSGERTPHGDSQIRGSFIGLSTLH
XYLB_STAXY            -------FTTFLKDINQSEVGANG------LMYTPYLLGERTPHNDASVRGSFIGLDANT
C1CZT9_DEIDV          -------FETLLREAEKAVPSEEN------VLFLPFLAGERSPHMRSDLRAAWLNLSLAH
D3PP61_MEIRD          -------LETLLEEALQAPLGCEG------LYFLPFLAGERSPYLAPHLRGAFLGLSLAH
XYLB_ACTM4            ----------LSRLALSAPAGADG------MVLVPYLEGERTPNRPDATGAIHGLTLKTS
A1SM63_NOCSJ          ----------FSELALSAPAGAGG------MVLVPYLEGERTPNRPDATGALHGMRLETT
C7Q039_CATAD          ----------LSDLALSAAPGADG------LTLIPYLEGERTPNLPDAAGSIHGLRLANA
H6RUW2_BLASD          ----------LSELALSAPSGADG------LVLVPYLEGERTPNVPHATGSVHGLTLRTS
B2HNZ2_MYCMM          ----------LSRLALSAPPGSAG------LVLVPYLEGERTPNRPKATGALHGLRLANA
A0A1E3S1B9_9MYCO      ----------LDRLALSAPAGAQG------LTLVPYLEGERSPNLPGAAGALHGVTTRNL
C5C1D9_BEUC1          ----------LAELALAASPGAGG------LVCVPYLAGERTPNKPLATGAFHGLTLGNA
D3CZL7_9ACTN          ----------FDALALRAEPGAGG------LVLVPYLEGERTPNLPTATGSLHGLSLAST
A8LDF9_FRASN          ----------LSRLALSARPGAAG------LVFVPYLEGERTPNLPTATGSLHGLTPASM
K7SFY6_ACIA4          ----------LNELALSV-PDAGG------LTLTPYFEGERTPNLPDATASITGMTLANS
D6ZJF2_MOBCV          ----------FSEFALSAPPGSEG------LVMVPYLTGERTPNAPLATGSLLGIRGDNL
D4BQ14_BIFBR          ----------FSRAALCAPPGAEG------LVVVPYFEGERTPNCPDATGSIHGVTCENL
B8DTL1_BIFA0          ----------LTDLALAARPGAGG------ITLVPYFDGERTPNRPDATATLSGMTLRNT
Q8G3P8_BIFLO          ----------LAELAFKAEPGAGG------ITLVPYFDGERTPNRPDATASLTGLTLHNT
W5IK78_SCAIO          ----------LAQLAEKAEPGAGG------ITLIPYFDGERTPNRPDAKASLRGMTLANT
H0QLE8_ARTGO          ----------LSRLALEAEPGAGG------VVLVPYFEGERTPNLPHATASFSGLTIAST
C8XEG8_NAKMY          ----------LAELAAQSQPGAHG------AVLVPYFEGERTPNLPDATAGLTGLTLAST
G0FXA6_AMYMS          ----------FDRLALTAEPGAGG------LTFLPYLDGERTPNLPGATGSLSGLTRDNM
E6SD13_INTC7          ----------LDRLALEADSGAGG------LSLLPYLDGERTPDLPLATGTLSGLTRTNA
D2PKF2_KRIFD          ----------LDEAALTS-SGSNG------LVMLPYLDGERTPDLPHSTGLVYGLTRATM
E1VS04_GLUAR          ----------FSDLALAAEPGSGG------VVLLPYLGGERTPNRPEATGLLQGLR-GTT
G0HEP9_CORVD          ----------FDRLALASVPGAGG------LVLQPYLDGERTPNRPDATGIIQGLT-TAT
C7MFT3_BRAFD          ----------LSQLALASVPGAHG------VTLLPYFDGERTPNRPDARATLTGMS-TAT
F0M3I8_PSEPM          ----------LDALALDAASDAGG------LTFLPYLDGERSPNLPHASGSLAGLTRGNM
XYLB_STRCO            -----------------AVEPGTD------VTLLPFLDGERTPNLPHSSGLLHGLRHDTT
K4RFH8_STRDJ          -----------------AVEPTAD------VTLLPYLDGERTPNLPNASGLLLGLRHDTT
XYLB_STRRU            -----------------AVEPGHG------VTLLPFLDGERTPNLPRSSGLLHGLRHDTT
A0A059W750_STRA9      -----------------AVEPGGS------AVLLPFLDGERTPNLPHATGLLHGLRHDTT
V6KT30_STRNV          -----------------DVAPGGE------AVLLPYLDGERTPDLPTSAGLLTGLRHDTT
F2RHK1_STRVP          -----------------DAAPGGE------VVVLPYLDGERTPDLPHAAGLVTGLRHGTE
A6VWT3_MARMS          ----------MNEAIANTPIGAEG------ITALPFLSGERVPALPDANGSILGLNSDNL
G8PZN9_PSEF3          ----------FNALVAQAPIGAEG------VCMLPFLNGERVPALPHATGSLLGLTTTNL
S2KNK3_HALAF          ----------FGERIDNAPIGAEG------VTILPFFNGERVPALPHASASFLGLTSVNT
Q9CL71_PASMU          ----------FNELIQQSSIGAEG------ITILPFFNGERVPPLPQAKASILGLDAANF
A0A377ICL0_AVIPA      ----------FNQALAKSEIGANG------IVILPFFNGERVPDLPQAKASIHNLDSSNF
F5YH07_TREPZ          ----------LDALAEKSKPGAEG------IVFLPFFNGERTPNLPNGRADICGITATNF
F2NRV6_TRES6          ----------FDAEAEKSSPGCEG------VFVLPFFNGERTPNLPHGKASITGLTVANC
F5Y8N6_TREAZ          ----------FDAEAAKSPIGADG------VAVLPFFNGERTPNLPHGRASINGITASNF
Q5GYQ6_XANOR          ----------TEAMIADTAPGADG------LVLLPFFNGERTPDLPAARGCLFGMDLHNT
                                                        *:: *:*                   

XYLB_ECOLI            GPNELARAVLEGVGYALADGMDVVHA-------CGIKPQSVTLIGGGARSEYWRQMLADI
Q6DB06_PECAS          GRAELAKAVLEGVGFALADGMDALHM-------TGLKPDSITLIGGGARSDYWRQMLADI
D8MVH3_ERWBE          GAEHLARAVLEGVGFALADGMDALHA-------SGLQPRSITLIGGGARSAWWRQMLADI
F6CT01_MARPP          TAADLVQAVLEGVSFALLDGLDAVCS-------VQKIDSTIDVVGGGARSEYWLQMLADI
G0AIZ5_COLFT          GRAALGYAVIEGVTFGMADGLAALHT-------AGTEVTELSLVGGGSRSPYWAQLIADA
C4LDR3_TOLAT          NRAMLGYAVLEGVTFGIADGLKVLEE-------AGTHLNECSLIGGGSRSPWWAQLIADT
B1Y6S9_LEPCP          DAAALAYAVVEGVTFGLLDGWHSLGT-------APGEVQSLSLVGGGARSALWAQLLADA
G0ACI0_COLFT          TPAMLGYAVLEGVGFGLLDAMAAVQS-------AGAEVSTCSLVGGGARSNYWAQLLANI
A6X4G4_BRUA4          DQRALTQAVLEGVAFAIRDNLAALQS-------AGTDIKSLTAVGGGSRSTYWLKAIATA
Q1YHH9_AURMS          DREAMTRAVLEGVAFSMRDCLEAGGE-------AARP-QRLIAVGAGSRSAYWLQLLANV
I7E053_PHAIB          TAEDLARAVMEGVCYGLRDCLEALRK-------TGAEIDSCLVIGGGSKSAYWVKLLATI
Q0FM50_SALBH          TRDDMARAVLEGVAFGLRDSQRALGA-------TGLRLERLMAIGGGARSRYWLKLIATA
D0CPB5_RUELI          GLPEIVHAVMDGVAFAFADCADALRQ-------GGSCPEDVWVAGGGSRSRRWLEIISAC
B2JHP3_PARP8          STGDLAYSVMEGVAFAMADGYAALQS-------AGTTLKSASFIGGGSRSPFWANLCATA
D5QJB6_KOMHA          TRADMTQAVLEGVAFSFRDVVDVLAD-------AHSPLTQADVIGGGSRSRLWISIIATV
B2IBW2_BEII9          TRADITQAVLEGVAFMLVDALDTLKA-------AGASIETAAFIGGGARSSFWAKLIASA
A9HPF3_GLUDA          DVVDLARAVLEGVAFSLRQGQDLLAC-------QQAISGPVPLIGGGARSPEWARIMATV
A8LIC3_DINSH          GPGEMMRAVVDAIAYSFADAQAVLGE-------AGVRAASPLAIGGGARSDLVLQTLADV
D3PMG0_MEIRD          QRGHLMRAALEGVAYSLREGLEALGA-------VIPPQAPLRLSGGGSQEPFWQQMLSDV
Q1AS19_RUBXD          GRGHLLRAALEGVAFALRDALEALEG-------AGVEAPALRLAGGGSLGESWRRMLADV
C6D7F3_PAESJ          KDAHLIRAVLEGVCYSLRDGVE-IIRS------LGVELERIIISGGGAKSLLWSQILADI
E7GJK6_CLOSY          TAKHMARAVMEGVTFALRDSME-ILEQ------AGNPCSRMISSGGGAASPVWLQIQADV
S0FL94_RUMCE          TKPHFVRAIMEGVTYSLKDCLE-IIRD------MGVRVSEVRASGGGGKSGIWRQMQADV
E7GIR6_CLOSY          TKSHLLRAVMEGVAYSLFDCSK-ILGD------TGVKITEMMACGGGGKSPVWRQMLADL
Q1IT93_KORVE          GRAHILRAILEGVAFSLRDSLS-IFAE------MGVPVSSIRLGGGGQRSPLWRQIQADV
A5UXA1_ROSS1          TLAHMARAVMEGVVFALRDGLE-IMRN------LGMAPDQIRATGGGGKSPLWRQMQANI
D9SR75_CLOC7          KREDMTRAVLEGVAFGLRDSLE-ILKS------LNVPIEEVRVSGGGAQSPLWKQILADV
F3ZWR6_MAHA5          HVPDLIRAVLEGVVFSLRHVSELIINC------SDVPISEIRTSGGGSRSMLWRQIQADV
XYLB_BACSU            NRKHFLRAIMEGITFSLHESIELFRE-------AGKSVHTVVSIGGGAKNDTWLQMQADI
A8FE32_BACP2          ERAHVVRAVLEGITFSLNESIALFRQ-------AGKHIDSIVSIGGGARSRTWLQMQADI
W4QRU0_BACA3          KRIDFARAVIEGITFSLNESIDIFRE-------SGKTIDTIISIGGGAKNETWLQIQADV
E6TXM8_BACCJ          ERKDFVRAVLEGITFSLNESVEIFRN-------QGKRIDTVVSIGGGAKNEVWLQMQADI
G2TH71_BACCO          TRRDFTRAVMEGIAFSINESVEIFRN-------YGKNIDTVISIGGGAKSDLWLQIQADI
F2F597_SOLSS          TKQHFARAVMEGIVFSLRDSLEIFRA-------SGKDITEMVSIGGGAKSPVWLQMQADI
Q03TX2_LEVBA          QRYDFVRAVLEGIIFSFRDLFDIYEE-------NGGDFDTVVSIGGGAKSPLWLQIQADI
C2CXH9_LACBR          KRYDFVRAVLEGIIFSFRDLMDEYEA-------KGSQFDTVVSIGGGAKSPLWQQIQANI
C5R8Q7_WEIPA          NRADFVRSVLEGIIYSFKDLFEIYEA-------AGANFDTVVAIGGGAKSPLWLQIQADI
Q03HN0_PEDPA          NKADFTRAVLEGIVFSFKDIMRIFAE-------KGSNFDTVVSIGGGAKSPLWLQIQADV
XYLB_LACPE            QRADFVRAVLEGIIFSFEDLIKLYQH-------NGAEFKTIVSIGGGAKSALWLQIQADI
H7C797_ENTFA          SLKHFTRSVIEGITFSLKESKVIMEQR------KNLKIKKIISVGGGTKNQQWLQIQADI
S4D8M2_ENTFL          RMKHFSRAVLEGITFSLKDSQVIMEKT------ANRTFKKIISVGGGAKNPDWLQMQADI
XYLB_LACLA            EQKHFSRAVLEGITFSLRDSKDIMEKT------KNKKFKRLISVGGGAQNPDIMQMQADI
Q49UE8_STAS1          TNADIARSVIEGITYSLYETLVHLRE-------QGKDITHITSIGGGARNDFWLQLQADI
XYLB_STAXY            TQLDMKRAVIEGITYSINESIHIMKN-------NAININEIVSIGGGAKNNQWLQIQADI
C1CZT9_DEIDV          SRGHLVRAVLEGTAFALAETHDVMRQ--------HTQLQSLLATGGGARSDLWLGLMAQG
D3PP61_MEIRD          RRGHLVRAVLEGVALSLGEVYRVMRP--------LAGAQRLLATGGGSASDLWLALAGGA
XYLB_ACTM4            DPAHLARAAVEGMLCALADGLDALV-------AHGAEANRIVLVGGGARSEAVRRIAPAL
A1SM63_NOCSJ          DPAHLARAAVEGMLCGLADAVDAVR-------ALGTPVERIILVGGAARSRAVREIASAV
C7Q039_CATAD          TSAHLARAAVEGMLCGLADGLDALT-------EVGVPVSRILLIGGGARSEAVRTIAPAV
H6RUW2_BLASD          TPAHWARAAVEGLLCGLADGIEAVV-------AQGVTVERVLLIGGAARSPAVQQLAPGI
B2HNZ2_MYCMM          TPAHLARAAVEGLLCALADGLAQLT-------EHGVVARRVLLIGGGARSQALREIAPLI
A0A1E3S1B9_9MYCO      LAANVARAAVEGVLASMAYCIEKIC-------AQGVDVARLILVGGAMRSEAVRRIAPAV
C5C1D9_BEUC1          TRENLARAAFEGVLCSLADGLDAVR-------TQGLDVASIQLVGGAARSRALTAIAPTV
D3CZL7_9ACTN          TRENLARASVEGLLCLMAECVDVLR-------ARSVDVGRVTMVGGGARSRAVRTLAPEV
A8LDF9_FRASN          TPANLARAAVEGVLCLLAGCLDALR-------AQGVRIDRVSLVGGGARSRAVQEIAPAI
K7SFY6_ACIA4          DRAHMARAAVEGLLDLMRGALDAVR-------NLGVPVDKALLVGGGAQSKAVQVLAAER
D6ZJF2_MOBCV          TASNIARAAVEGMLCLVGYGLEIFK-------RLGVEVNAVSLIGGGAKSEAVRRIAPSV
D4BQ14_BIFBR          TTSNIARAAIEGMLCGVGVGIRAFQ-------QLGIPVTKINLIGGGAQSEAVRRIAPSV
B8DTL1_BIFA0          NRANFARAFVEGLLCSQRDCLELIR-------SLGAAIERILLIGGGAKSRAVRTLAPTV
Q8G3P8_BIFLO          TKENLARAFVEGLLCSQRDCLELIR-------SLGAEINRILLIGGGAKSVAIRTLAPSI
W5IK78_SCAIO          KKENLARAFVEGLLCSQRDCLEMVR-------GLGARINRILLIGGGARSQAVRDLAPCV
H0QLE8_ARTGO          TRSNFARAAVEGMLCGLAGGLDALR-------ALGHPAERLFLIGGAVQNPAVQRIAAQV
C8XEG8_NAKMY          TRPHLARAAVEGMLCGLADGLDAVI-------AQGVQPRRLLLIGGAALNPAVQTTAAQL
G0FXA6_AMYMS          TPANLARSAVEGMLCGLAAGLDAVR-------AHGLDVQRVLLIGGGAQSRAVRAVAPLV
E6SD13_INTC7          TPANLARAAVEGMLCNLVAGVDALR-------DQSVRVERVLLIGGAAASRAVRAIAPAL
D2PKF2_KRIFD          QPATMARAAVEGMLCGLADAVDALR-------AQGLPVQRVLLLGGAARSRAVQALAPAL
E1VS04_GLUAR          TREQIARAYVEGLLCSMKDAVAALEA------STKVATKRILLIGGGAQAEAVRVIAPQI
G0HEP9_CORVD          TREDFARMTVEGLLCSMKDAVEALVG------ATGEKVRRVLLIGGGARSAAVRAIAPSI
C7MFT3_BRAFD          TREDVARAYVEGLLCSLADGISALED------RTGTAPARITLIGGAARSQAVQQLAPAI
F0M3I8_PSEPM          TPENLARASVLGVLNSLADAIDLMK-------QSGGTPDKVLLIGGGSKSNSLRQAAASI
XYLB_STRCO            AGQLLQAAYDGAVHSLLGALDLVLDA-------DADPSAPLLLIGGGARGTAWQQTVRRL
K4RFH8_STRDJ          AGQLLQAAYDGAVHSLLGALDLVLDA-------DADRSAPLLLIGGGARGTAWQQTVRRL
XYLB_STRRU            GGQLLQAAYDGAVYSLLAALDLVLDE-------DADPSAPLLLIGGGARGTAWQQTVRRL
A0A059W750_STRA9      AGQLIQAAYDGAVFTLLRALDRLPGV-------DAAPDAPLLLIGGGARGHAWRETVRRL
V6KT30_STRNV          PQQLLGAAYEGAAYTVLRALDEVLRACGLDPAGPGAASRPLRLVGGGAQGRTWVETVRRL
F2RHK1_STRVP          PRAVLGAAYEGAAYTVLRALDGLLAACGLDPADPAVRDRPLRLIGGGARGRAWTETVRRL
A6VWT3_MARMS          SAGNILRSVMEGTTFGLRYGMDLLR-------ESGIKSTELRLIGGGAKSPLWRQMIADV
G8PZN9_PSEF3          TRANLCRAVVEGTTFGLRYGLDLLR-------ANGLQAQSIRLIGGGSKSAEWRQIVADT
S2KNK3_HALAF          TQANLCRAVVESATFGMRYGLELLG-------DLAKGASQIRLIGGGAKSPVWRQMVADI
Q9CL71_PASMU          TQPNLCRAMMEAASFTLRYGLDLFR-------QAGLSTSQIRLIGGGAKSAVWRQMIADI
A0A377ICL0_AVIPA      TDENLCRAIVESATYTLRYGLDLFR-------QAGIQPRQIRLIGGGAKSHHWRQIVADV
F5YH07_TREPZ          TRENIARSALEAAIFGMRCGLEAFQ-------GLGFRPQEIRITGGGSKSSVWRQMAADI
F2NRV6_TRES6          NRANIARAALESAIYSMRTGLDSFK-------KHGFTPKELRLTGGGAKSKVWRQIAADI
F5Y8N6_TREAZ          KRENLARAALESAIFGMRIGLEGFK-------KLGFKAKEIRLTGGGSKSPLWQSIAANV
Q5GYQ6_XANOR          TAAHFYRAAMEGATYSLRNGFDAFV-------AAGLQFDTILLTGGGSKSAQWRQMVADI
                                 .                                *..             

XYLB_ECOLI            SGQQLDYRTG--GDVGPALGAARLAQIAANPE-K----------------SLIELLPQLP
Q6DB06_PECAS          SGQTLEYRTG--GDVGPALGAARLAQIAMHPH-T----------------PLAELLPPLP
D8MVH3_ERWBE          CGHALEYRTG--GDVGPALGAARLAQIAINPH-K----------------PLSEMLPELP
F6CT01_MARPP          FARPLVYREG--GEVGPALGAARLAAIGVLPE-G----------------ALSDICRKPD
G0AIZ5_COLFT          LNVRMVTHVG--SETGGALGAARLAWLAANDQPG----------------KEAVICAKPP
C4LDR3_TOLAT          LNLPIVTHLG--GEAGGALGAARLGWLATG---G----------------AEAEVCKKPD
B1Y6S9_LEPCP          IGVPMVTRQG--GEAGGALGAARLAWLADG---A----------------RIEDVCLAPP
G0ACI0_COLFT          LDREICTLSG--SELSACIGAAKLGFLAYG---R----------------GRDLPGLGMP
A6X4G4_BRUA4          LNVPIALPEE--GDFGGAYGAARLGLIAATGV------------------DPFAVCTPPR
Q1YHH9_AURMS          LDTEIALPEA--GDFGAAFGAARLGLCAATGD------------------DPKAVMTEPP
I7E053_PHAIB          LDLPLQLPKD--GEFGAALGAARLARLAVTGD------------------DPADVLTAPE
Q0FM50_SALBH          LDVTLELPAG--GEFGAALGAARLGMVASGDA------------------SVGEVMTAPA
D0CPB5_RUELI          TGLRLMIPAT--GEKGAALGAARLAQW-STGM------------------LPDTTDKADA
B2JHP3_PARP8          TGITMHRHEG--SDVGAALGAARLARLAVTGE------------------AVNQVCVAPP
D5QJB6_KOMHA          TGVSLHRLAH--GEQGGAFGAARLARLAVTGE------------------SVRDVCLAPQ
B2IBW2_BEII9          TGLRLQKFVV--AERGPAFGAARLARLAVTGE------------------NPRTILLPPK
A9HPF3_GLUDA          LGRDLVIPRN--AEHACALGAARLGMVADGWT-------------------MADAMPAFE
A8LIC3_DINSH          LEVPVQRPAS--ADLGPALGAAKLAAVGSG------------------------AMPAAR
D3PMG0_MEIRD          LGRPLVSTP---TPSASARGAALLAGMAVGIT------------------------LEVA
Q1AS19_RUBXD          LGRPLAILPDEVASVASARGAALLAGMALGLYG-------------------GPEGLPAP
C6D7F3_PAESJ          LHQDVYVSM---TEEQACVGAAIMAGVGAKLYDS----------------VEQACQTVVK
E7GJK6_CLOSY          FNREIQVCR---VSEQACLGACMLAGVSAGIFKS----------------LEEAGRRFVT
S0FL94_RUMCE          FGTGINRIK---SDEGPALGVAILAGVGAGVYSS----------------VPEACEAVIQ
E7GIR6_CLOSY          YGCPVKTVK---QQEGPALGAAILAGVGCGIYNS----------------VETACGRLLR
Q1IT93_KORVE          YKHKVETIL---VDEGAAHGAALLAGVGAKVWPT----------------VDAACAETVQ
A5UXA1_ROSS1          YATPVATLA---AEEGPAYGAALLAGVGAGLFRD----------------VADAVDRCVT
D9SR75_CLOC7          FNVKVSMIN---SKEGPAYGAAILAIVGCGVYPT----------------VDEACKNLIK
F3ZWR6_MAHA5          FQLPVKTVNG--SEYGGAFGAALIAGVGSHIWTD----------------IYQAIE-MLK
XYLB_BACSU            FNTRVIKLE---NEQGPAMGAAMLAAFGSGWFES----------------LEECAEQFIR
A8FE32_BACP2          FQAEVIQLD---NEQGPALGAAMLAAVGCGWYPS----------------LEACADQFIH
W4QRU0_BACA3          FNATIVKLK---SEQGPAVGAAILAAYGCGWYES----------------LEKCADTFIQ
E6TXM8_BACCJ          FNAKIVKHA---SEQGPGMGAAMLAAYGCGWFSS----------------MKECADTFLK
G2TH71_BACCO          FQAKVIKLQ---NEQGPGMGAAMIAASGLGWFSS----------------LKDCAAAFIR
F2F597_SOLSS          FNVTVYKLK---NEQGPSIGACMIAAVGANIYTD----------------FEEAVQVCVQ
Q03TX2_LEVBA          FNRKVVSLT---NEQGPGMGAAMIAATGLGWFDS----------------LQDCAETFVH
C2CXH9_LACBR          FNTRVVSLK---NEQGPGLGASMLAAVGLGWFKS----------------VSECTKVFVQ
C5R8Q7_WEIPA          FDTKVVALQ---NEQGPGMGAAILAAVGLSWFDS----------------VQEAANTFMS
Q03HN0_PEDPA          FNKKVVTLK---NEQGPGLGAAMIAAVGVGWFDS----------------LSDCAQKFVS
XYLB_LACPE            FNCKVVSLK---NEQGPGMGAAMIAATGLGWFKT----------------LADCAQTFVH
H7C797_ENTFA          FGLPITTLE---TEQGPSLGAAILAVIGCGMCAN----------------IDSCIKMFVK
S4D8M2_ENTFL          FDTTIATLT---TEQGPGMGAAMLAAIGSGLFKD----------------AQSCAETFVS
XYLB_LACLA            FNSEMIRLT---VEQGPGLGACMIAAFGCGLFDS----------------LEAVTKAFVH
Q49UE8_STAS1          FNAKVSKLK---YEEGPCMGAAMLAIVGLSWYES----------------LEDVVDQFIV
XYLB_STAXY            FNTTITTRT---EEQGPAYGAAMIAAMGEQWFNT----------------FNEMSEAWIA
C1CZT9_DEIDV          LDLDIYRTA---STAGAAEGAALLAMPEAGLYAS----------------LQEAMGTASL
D3PP61_MEIRD          LGVPIHRVV---GDEGAARGAGILALVGAGVYPS----------------LREALEATAP
XYLB_ACTM4            FGKPVLVPPP---GEYVADGAARQAAWVARGG-----------------DTPPAWS----
A1SM63_NOCSJ          LGLPVTVPQP---GEYVARGAARQAAWVLSGA-----------------AEPPAWP----
C7Q039_CATAD          LGHSVTVPPP---GEYVADGAAAQAAWVLEGS-----------------EEPPRRV----
H6RUW2_BLASD          FGRPVLVPPP---GEYVADGAARQAAWVLSGA-----------------EAAPEWS----
B2HNZ2_MYCMM          FGVPVLVPDP---AEYVALGAARQAAWALRGS-----------------TRPPSWQ----
A0A1E3S1B9_9MYCO      WGAPVDVPAP---AEYVALGAARQAAWTLTQQ-----------------DSPPVWS----
C5C1D9_BEUC1          LGRPVVVPQP---SEFVADGAARQAAWVLAGG-----------------EAPPEWT----
D3CZL7_9ACTN          LGVPVATPAP---GEYVADGAARQAAAVLL-------------------GCQPAWP----
A8LDF9_FRASN          LGVPVAVPAP---GEYVADGAGRQASAVLARSD---------------GAAPPSWH----
K7SFY6_ACIA4          LDAEVEIPET---GEYVAIGAAKQAAQVVGM-----------------------------
D6ZJF2_MOBCV          LGVKVTIPEI---GEYVADGAARQAAWVLNGG-----------------TRPPVWS----
D4BQ14_BIFBR          LGLPVCVPEY---SEYVADGAARQAAWVYEGG-----------------AEPPVWT----
B8DTL1_BIFA0          LGMEITCPAT---DEYVAIGAARQAAWVLSG-----------------VDDAPDWP----
Q8G3P8_BIFLO          LGMDVTRPAT---DEYVAIGAARQAAWVLSG-----------------EAEPPTWQ----
W5IK78_SCAIO          LGMNVQLPQP---DEYVAIGAARQAAWLLEEGRNAADAEEAANPGQVPQHQEPHWP----
H0QLE8_ARTGO          FELPVLVPSP---GEYVARGAAVQAAWALTGE-------------------RPAWD----
C8XEG8_NAKMY          FGVPVHVPTP---GEYVAMGGAVQAGWVLAGR-------------------RPAWV----
G0FXA6_AMYMS          FGVPVQLPEV---AEYVALGAARQAAWALSSQAQAS------------SAEPPSWQENQK
E6SD13_INTC7          FRAPVVVPRP---AEYVGVGAARQAAWALSGAAQ-----------------PPAW-----
D2PKF2_KRIFD          LGAPVVLPEP---GEYVALGAARQAAWALTGTLP-------------------TWE----
E1VS04_GLUAR          FGVAVDVPRT---AEYVALGAARQAAWALGGQ-----------------EQPPVWD----
G0HEP9_CORVD          FGVEVLVPDP---AEYVALGAARQAAWTLSGA-----------------DAPPEWT----
C7MFT3_BRAFD          FGREVTIAPE---GEYVALGAARQAAWALAGT-----------------EEPPAWT----
F0M3I8_PSEPM          FNLPVEVPAS---REYVALGAAKQAAWAATGE-------------------LPDWK----
XYLB_STRCO            SGRPVQIPEA---RELVALGAAAQAAGLLTGEDA--------------AAVARRWNTA--
K4RFH8_STRDJ          SGRPVQVPEA---KELVALGAAAQAAGLLTGEDP--------------AAVARRWNTA--
XYLB_STRRU            SGRAVQVPRA---AELVALGAAAQAAGLLTGEDP--------------AAVARRWETA--
A0A059W750_STRA9      SGRPVVVPEA---DELVALGAAAQAAGLLLGEDP--------------AAVARRWGTA--
V6KT30_STRNV          SGRPVIVPES---GELVALGAAALAASAASDEDP--------------VAIAASWKTG--
F2RHK1_STRVP          SGRPLVVPAA---EELVALGAAALAAGAVTGADP--------------VALTTAWGTG--
A6VWT3_MARMS          MNTKVVCPEL---PEAAAVGAAIQAQWCHAS------------------HLGKDVSLLDL
G8PZN9_PSEF3          MDTTVICTEQ---SEAAALGAAIQAAWCHS---------------------GSQAGLAEL
S2KNK3_HALAF          TGTQVICPEI---TDAAALGAALQAAWCHQ---------------------RGATSLEAL
Q9CL71_PASMU          MNTEVVCLKE---DEAAALGGAIQAMWAN-----------------------GEGDLADL
A0A377ICL0_AVIPA      TNCEVITLKH---QEAAALGAAIQAAWAERATQL--------------SKAEADAALRSL
F5YH07_TREPZ          MNIPVKRPVN---AESAAMGGAIQALWCLLK------------------KEGKGVDIAFL
F2NRV6_TRES6          MNLPVKVPVS---SEAAAFGAALQALWCLKK------------------LQGTPVSMESL
F5Y8N6_TREAZ          MNLPVRVPKG---AEAAALGGAIQGLWALER------------------QKTPKLAIDAI
Q5GYQ6_XANOR          FNLQVVVPTQ---PEGAAFGAALQALWACER------------------ADGGDAALADV
                          :              *    .                                   

XYLB_ECOLI            LEQS-HLPDAQRYAAYQPRRETFRRLYQQLLPLMA--------------------
Q6DB06_PECAS          MEQV-HQPNTQRHADYAERRRTFKTLYQQLSPLM---------------------
D8MVH3_ERWBE          LEQR-HTPDAENHQHYAQQRETFRQLYQALLPFMTEE------------------
F6CT01_MARPP          AIKH-FDPNPEHADYYQQKRATFQTLYHRVKGL----------------------
G0AIZ5_COLFT          LREA-FTPNAQRHAALQPRLAAYREIYRCRPERNADAALPGH-------------
C4LDR3_TOLAT          IQHR-YIPDAGRHQQLMPRLSQFRLLYQQQVLARKTLN-----------------
B1Y6S9_LEPCP          VAAV-FEPDAARAAQLLPRHRRFRRLYAALREEFSATSATGAAG-----------
G0ACI0_COLFT          VKAR-FVPAAGQQEMLQERYRKFRDLFAAAHALHG--------------------
A6X4G4_BRUA4          TERT-IEPEAALLPAYEEAYQRYHALYPALHALAGS-------------------
Q1YHH9_AURMS          IARR-FRPDNAHGRAFDDAYLFYRRLYPALRAAMAD-------------------
I7E053_PHAIB          SAMT-VAPDPLLRDGYEAGYAAFRRRGAELT------------------------
Q0FM50_SALBH          ISEE-IAPDTALTPAFDDAYTRFRAAYGPTREIQ---------------------
D0CPB5_RUELI          PVET-IEADPEMRHRYQARLADFRRLAGVGRRASV--------------------
B2JHP3_PARP8          TLES-CEPDRAQAPLLAHRLARYRSIYQALKTSFAESA-----------------
D5QJB6_KOMHA          RVET-VHPDAALSGAYDVSLARYRALYGGVRDAMRYGAAT---------------
B2IBW2_BEII9          VQSV-IEPDPALHRAYQSSIDRFRRLYQALKPVFRPASESR--------------
A9HPF3_GLUDA          IAQA-IAPDHEAIPLYDAQYAQFERLYPAIRSIGQGTAAGL--------------
A8LIC3_DINSH          LADP-PEIGAVFHPRPSARHGARLARYRALYSELRGVCARP--------------
D3PMG0_MEIRD          RSET-PVAEPQ-SSVYEEGYQRYKQLYRQLSSWF---------------------
Q1AS19_RUBXD          RPER-AVRPGEGAGRYEEAYRRFRELYPRLRGL----------------------
C6D7F3_PAESJ          LHESPVRPDPMNQAIYDRYYTVYSKLYEINRELFPMLNNNTNVNGVSK-------
E7GJK6_CLOSY          MEERTYKPDKERAAVYESAFGKYRELYRRTKALL---------------------
S0FL94_RUMCE          VKDTLA-PIEANINRYNDFYKLYTKLYKSMKEDFTQLNNILK-------------
E7GIR6_CLOSY          MSSSTE-PEEENTVLYRQFHCLYQRLYSSLKEDFKELAGL---------------
Q1IT93_KORVE          VGETIA-PDLTNSAVLQQQYERYRRIYPALRSIGMAATSTVA-------------
A5UXA1_ROSS1          LTASVV-PDDHAVAQYDRVYAIYRDMYAALRDGMHRLAGVSA-------------
D9SR75_CLOC7          VTETVH-PIAENVAKYEKPYEVYRKLYPALKDSFKAINNI---------------
F3ZWR6_MAHA5          VESETD-PDYRNKDLYDELYDNYKSVYPALKSIFDRLSSLT--------------
XYLB_BACSU            EAAA-FYPKAQNVQKYKTLFDLYKNIYTHTKDLNTALKSFRKN------------
A8FE32_BACP2          QAGV-YEPEQKHANLYADLFHLYQQIYTQTRDIHAGLAQYRSI------------
W4QRU0_BACA3          QAQT-YSPNPENVEKYQQLFKLYKQVYVQTKELNEGLNQFRKH------------
E6TXM8_BACCJ          VDKE-FLPIEENVKQYEELFQLYKKVYTETKELNMDLVKFRK-------------
G2TH71_BACCO          TGRT-FEPIPKNVKRYRDFYQVYKDVYPHTVAINHQLFDLRRVNESRFGGKTDEI
F2F597_SOLSS          VEGK-FEPNPENVEIYNQLYAVYQQIYIQTKALNEQLKLFR--------------
Q03TX2_LEVBA          FGKA-YEPNPENVKKYEKMHAIYKQVYQQTKTISEQLLDYRRAEL----------
C2CXH9_LACBR          FKDV-FLPEPANVKKYQKLHEIYKKIYPSTKEMTHELVDYRRENQEK--------
C5R8Q7_WEIPA          FGQT-YEPIPENVAKYHKYYELYKQIYGQTAKLSHDLLALRRK------------
Q03HN0_PEDPA          YDQE-YVPGSGNVEKYEKMYQLYKQVYGQTAEISHKLMEYRRNNL----------
XYLB_LACPE            YGKA-YYPVTAHVAQYQEMYRLYQQIYVQTQPITAGLLEQRKQH-----------
H7C797_ENTFA          YKKV-YQPIEKNVLLYNKFFQVYSKVYSTTKEICYQLQE----------------
S4D8M2_ENTFL          YDKE-ITPDPENVKKYKKIYKTYQKAYQRTAELCHELAEWRS-------------
XYLB_LACLA            YKEASFIPNPKNVARYEQIYQIWKQVYKNTSEISHQLVEFNDEG-----------
Q49UE8_STAS1          YDRT-FLPNEVHHERYVKYFEIYQEVYRQTRPITARLLELSL-------------
XYLB_STAXY            YHQK-VYPIETNTKSYQDLFNIYKTIYD---------------------------
C1CZT9_DEIDV          AGLPV--PRVPSHAPRTAYSAAFQRLYG---------------------------
D3PP61_MEIRD          AEQPATPPLEGLEPLRKGYAQAVEKVLELYKN-----------------------
XYLB_ACTM4            ----AASPEVYEDDPVPLIREQYAAAQNAVIDRTR--------------------
A1SM63_NOCSJ          ----LADVVATEVEPTPQVRARYAEVRDLTATRP---------------------
C7Q039_CATAD          ----TQGTETYEAKPLPEVRERYHAYRDRAA------------------------
H6RUW2_BLASD          ----QPGLAEFDAPAATAVRERYAEVRGRTDGQ----------------------
B2HNZ2_MYCMM          ----PPATDEYTGEPSPAVRQRYGQVRELTEGVASVPGPGETPPAPDTSR-----
A0A1E3S1B9_9MYCO      ----FGVTTPYTAEPTPQVLDQYRAAQPLTLR-----------------------
C5C1D9_BEUC1          ----ASRSRTYEAAQAPEVRERYARARELTVERS---------------------
D3CZL7_9ACTN          ----AVDAATHTASPRPEVRERYRAAAALAAADATAGAV----------------
A8LDF9_FRASN          ----RPDAVTRTAEPLPSVLDRYREVAATVAATIKSQRG----------------
K7SFY6_ACIA4          -------------------------------------------------------
D6ZJF2_MOBCV          ----PRLTSSYTAQSQPFIMERYQEVNGLFADTTQLELE----------------
D4BQ14_BIFBR          ----PHLSSDYICDYAPFILERFQEVSSRFMLRSEARADVGRHGDGVQL------
B8DTL1_BIFA0          ----ISIDAVQTGTPTPQVYDAYVQARG---------------------------
Q8G3P8_BIFLO          ----LTIEGVETGEPTEAVYEAYAKARG---------------------------
W5IK78_SCAIO          ----VTIEKTLTGQNQPQVYHQYVAYRG---------------------------
H0QLE8_ARTGO          ----VALDGHPEPDFQPAIAEQYRAEQRKVEQVAG--------------------
C8XEG8_NAKMY          ----VDTAAELAADPQPVIREQYARARSAY-------------------------
G0FXA6_AMYMS          LRLELDEPTEAQRAEGHRIQQRHLEAREAAYGVRRNLGED---------------
E6SD13_INTC7          -GLRVDSEYQVPAGDTSDVLERYAALLAQMHGR----------------------
D2PKF2_KRIFD          VASGKPETAILTDAEAADIRARYAAVLNGTRPLLAQPRP----------------
E1VS04_GLUAR          ----IAESTRYQARPRPEIYAGYAKLRDATEGWN---------------------
G0HEP9_CORVD          ----VPATAPASAPFNGRTVRSYAHLRTATAGWNWGLE-----------------
C7MFT3_BRAFD          ----ITGSRTVDAEATPEVLETYRALKNRTESWG---------------------
F0M3I8_PSEPM          --RSIEAAYEPEGDWGAGVRERYAAARRNVYGV----------------------
XYLB_STRCO            -----AGPVLDAVERDEATLNRITGVLSDAAPLLERDAASR--------------
K4RFH8_STRDJ          -----AGPVLDAVERDEATLARIAGVLSDAAPLLERGSQDR--------------
XYLB_STRRU            -----AGPVLEAVERDEETLDRLAGVLSDAAPLLERGTGAG--------------
A0A059W750_STRA9      -----RGAAHPARERDGDAWERLAATLTDGAALLGG-------------------
V6KT30_STRNV          -----DGPELPPVARDMETWERVGSVLDRAAPSLLS-------------------
F2RHK1_STRVP          -----AGEVLPPVRRDEETWDRIAAVLTAAGPTLLR-------------------
A6VWT3_MARMS          CDRYISIDASSSVSPIPNNVTAYESAYQRYRSHLSVLFPDSE-------------
G8PZN9_PSEF3          CERCVKLDPTSETRPIAAHVAASQQAYERYRQHVATL------------------
S2KNK3_HALAF          CKRLVHLDEGSLANPEPMRVEAYQEIYTRYRQALAARHEIPA-------------
Q9CL71_PASMU          CHAFVHLDTTSLVQPNPKSAVEYERVYQRYLVLLQQHY-----------------
A0A377ICL0_AVIPA      CEQFVVLEEENTHFPQPENVRHYAKFYQDYLDVLNKMYAEA--------------
F5YH07_TREPZ          TDEHVDISEAESIKPDSITVAAYNKAYAEYNKYLKALSPIFV-------------
F2NRV6_TRES6          AEIHVALDESKTTLPNEKNALEYSKAFEEYKILVNQLSPLYK-------------
F5Y8N6_TREAZ          TEAHVAMEGGATVKPDAKAVKAYNEAYGVYSRYLGALSPLYK-------------
Q5GYQ6_XANOR          VLEHLQVDDALAAQPNPQRVAQYQQHYQTFLKHLHVVSPLYAS------------