CLUSTAL format seed alignment for MF_02224

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D3E3G4_METRM          --------------------------------MIPKTHPRYESLLLRDKVKNAFKEGYLA
A0A366M8K9_9EURY      --------------------------------MIPKNHPRYESLILREKIKEAHKKGYLT
F0T693_METLA          --------------------------------MIHKDHPRYESLRLRAKIVDAYKNGILA
A0A328SIH7_9EURY      --------------------------------MLNKDHPRYESLLLRDKIVKAHKNGILA
PPS_METJA             -------------------------MLSVMRMQIPKTHPRYESLMKREKIIEALDKGILA
PPS_THEKO             ------------------------------MVNIPKSHPRYWSLYYREKIIEGMEKGMTA
G0EC79_PYRF1          -------------MIHVGPSVSRKCCFELREWIIPESHPRRESLLEREKLVEGMCDGVVV
Q8ZT72_PYRAE          --------------------------------MIPPNHPRYRSLLERERLVEGFREGYVV
A0A497LMM7_9ARCH      --------------------------------------------MVREQMVEGLARGLVV
Q97W45_SACS2          ------------------MDKAQDSKPWSIRDLIPENHPRRESLLIREKLIEAMEKSILV
K0IIV1_NITGG          --------------------------MHVNRISIPPNHPRAKSLHTREALVDGYRRGLVV
A0A2E5KF26_9ARCH      MNFIIYSSNLILLVIFCSLQLIIQEQESLTKHNIPKDHPRAHSLKIRNTMIDSYDSGILS
A0A2E4HQX7_9ARCH      ----------------------------MTFITIPKNHPRAKSLKVRETISQSFSDGVVV
A0RXQ6_CENSY          -------------------------------MAVPRSHPRRESLLVREKLVRGLERGLVA
I3D3I5_9ARCH          ------------------------------MQLIPKSHPRAKSLLIREKLVNGFDNGLVA
A0A133U985_9EURY      ------------------------------MNEVNSDHPRAESLRIRKKLSEGFRKGLVT
D2RGD3_ARCPA          ----------------MEELNKFYKTICNLPCMIPKDHPRYESLMMRERIVEGYKMGITV
A8A9N3_IGNH4          ------------------------------MSFVPPDHPRFLSLMYRERLVEKFKEGVVV
I0A1H3_FERFK          ------------------------------MEYVPRDHPRYRSLMEREKIIEGFKNGIVV
L0AAJ1_CALLD          ----------------------------MNIEDIPKNHPRYQSLVTREKLVDFFNKGIVV
Q9YAK3_AERPE          ---------------------------MHGGFDIPRSHPRYESLVAREKLVEMFEKGVVV
B5ID51_ACIB4          --------------------------------MIPKSHPRYESLMKREKIIEGFKKGIVA
T0MQE9_9EURY          -------------------------------MEIPKSHPRYESLKKREALLNFYDKGIVT
A0A1Y3G9W7_9EURY      ------------------------------MLSVPEDHPRYESLLLRERLVRGFEEGLVA
A0A1Q6DXG3_9EURY      --------------------------MKGTAMDIPDDHPRARSLEIREKLEEGYKSGLVT
PPS_METMA             ------------------------------MTDIPHDHPRYESLLAREKVAAGVKMGITS
D5EA45_METMS          ------------------------------MTGIPRTHPRYHSLIARENIVEGVNKGITS
G7WNL2_METH6          -------------------------MGVPLLSDVPPSHPRYASLLTREKLVEGVERGITG
Q0W5X0_METAR          --------------MVDAALISLCLQVLLTMTDIPRDHPRYQSLVTREMLVKGVRDGITS
M0AV68_NATA1          ----------MSDYDTVS-------ADVEHEEEIPADHPRYQDLLTRHRIETGIEKGITH
D3SRF4_NATMM          ----------MSEYDTVS-------ADVQHEEEIPEDHPRYQDLITRHRIENGVEKGITH
Q18KP3_HALWD          ----------MNDSSPTQDPEKETETETETETEIPQDHPRYQSLITRHRIEEGVDTGITS
A2SRY5_METLZ          ------------------------------MSDIPASHPRYKSLITREQLAGYAKSGVVS
PPS_METHJ             --------------------------------MIPESHPRYKSLITREKLAQYTKTGIVS
I7KYV2_METBM          --------------------------------MIPKDHPRYRSLVARERLARCAREGVVA
A0A126QSM2_9EURY      ----------------------------------------------------MVEEGLVT
A0A0A7LDA9_9EURY      --------------------------------------------MVRERLWELVEKGLVT
M9SEY6_METAX          -------------------------------MSTPKDHPRYKSLMVREHLAEMVDEGLVN
R9T7R5_METII          -------------------------------MDISPDHPRYKSLVIREKMSKLSDQGIVA
A0A2E4CYA7_9EURY      ------------------------------MTEIPDSHPRRESLLARGKIVAGTRRGLLA
A0A2D9WH94_9EURY      ------------------------------MAEIPDSHPRKISLIARQNLVDAAAEGLLA
A0A2V3HLR3_9EURY      ------------------------------MGDIPQSHPRRASLLARQRLVDAAAAGLLA
A0A2D9M8K0_9EURY      ------------------------------MGEVPESHPRYASLMSRQRLVDAMKEGLLA
A0A2E6BXG4_9EURY      ------------------------------MGDIPESHPRKESLLARQKLVDAASKGMLA
A0A2E7KQH4_9EURY      ------------------------------MGEVPXSHPRFASLMAXKXXTXAAAAGLLA
A0A2E9B9P7_9EURY      ------------------------------MGEVPRSHPRYNSLIARKLLTDAADDGLLA
A0A2E0BVC2_9EURY      ---------------------------------------------MRHRLEVAAKKGMLA
A0A2E7GZ84_9EURY      ----------------------------MDDIAADPSHPRYASLLMRHRLEVAARKGMLA
A0A2E8V1P1_9EURY      ----------------------------MDDFAANPSHPRYESLLKRHMLEKAAERDMLA
A0A2E2TUQ2_9EURY      ----------------------------MSDFAADPSHPRYQSLRLRHRLEEAEKQGMLA
A0A3A5V4Q7_9EURY      ------------------------MKEMNEEEVVDPSHPRYQSLMIRKKIADAGVKGMLA
A0A3A5WD32_9EURY      -------------------------------MAADPSHPRYASLLRRHLIEEAAAEGLLA
A0A2E6F4I8_9EURY      -----------------------------MSYDVPDSHPRKRSLERRYELEEAASKGLLA
                                                                              .   

D3E3G4_METRM          DSGMIAHGRGETFDYLIGERTTEPARKACEAAVAYILLAENPVLSVNGNTTALAIDEIIE
A0A366M8K9_9EURY      DSGMIAHGRGEAFDYLIGEKTMPPANEAIKVAVATLIQAKNSVISVNGNSTELDIDEFIE
F0T693_METLA          DSGMIAHGRGEAFDYLLGEQSTENAKLAVEAAAAALLLAEHPIISVNGNTAALVPDKIVE
A0A328SIH7_9EURY      DSGMIAHGRGETYDYLIGEKTTENSHNTIKVAAAYFLLAKNPVLSVNGNTTALVAEDVAE
PPS_METJA             KAGLIAHGRGETFDYLIGEKTAPIALEAIKAAAALLILAENPVISVNGNTVALAIDEVVE
PPS_THEKO             KAGLIAHGRGEAFDYLIGERTIEPAERAMRAAVAKFLLAEHPVISVNGNVAALVPKETIE
G0EC79_PYRF1          PQGLIAHGRGECFDYLLGETSIPPALEAERAAAAMFHLAKHPVISVNGNVAVLAAREVVE
Q8ZT72_PYRAE          PQGLIAQGRGECFDYLLGEETQQFALEAITAAAAALLLAKHPVISVNGNVAALTPREVVE
A0A497LMM7_9ARCH      PEGLIAHGRGECFDYLIGEKTEFFALKAIRAAAASFLLAEKPVISVNGNLAALCARELVE
Q97W45_SACS2          PQGLIAHGRGECFDYLIGEKTQDFAEKAIEAAAATLLLAKTPTISVNGNMAALVPEGLIR
K0IIV1_NITGG          AEGLIAHGRGEAYDYLIGECTTKTAQRAIKAAAAMLLLSRHPVISVNGNAAALCPGAIVE
A0A2E5KF26_9ARCH      QYGLIAHGRGEAFDYILGETTNKISLKTIRVATALLLLSN-SVISVNGNSAALCSKELVN
A0A2E4HQX7_9ARCH      SSGLIAHGRGEAFDYILGEKTLPVTMTAIRAAVAELLLYK-SVISVNGNVAALQCKNIIT
A0RXQ6_CENSY          REGLMAHGRGEAFDYLLGEATGRHARKALRAAAAVLLLAERPIISVNGNVAALCAAEAVR
I3D3I5_9ARCH          KEGLLAQGRGEAFDYLLGEKTGKAAIRAIKAAAAQLLLAEMPIISVNGNIAALCPKQIIK
A0A133U985_9EURY      PEGLAAHGRGEAFDYILGERTTKEAEKAIEAAAAEIIKAKNPVFSVNGNVSALVCESIAE
D2RGD3_ARCPA          LQGLIAHGRGEMFDYVLGEKSHDFALKAEKVAVALMMLSKRPVISVNGNTAVLVPEEISE
A8A9N3_IGNH4          AQGLIAHGRGEAFDYILGEQTIPPALEAEKAAAALLKLARKPVISVNGNAAALVPGELVE
I0A1H3_FERFK          INGLISQGRGEAFDYIIGEKTIPLAEDSIEVAVAMLLLSNYPVISVNGNAAALVPDEIIN
L0AAJ1_CALLD          AHGLVAQGRGEAFDYILGEKSHDFALDAEKVTVAYLLLSQSPIISVNGNYAALAGEEIVE
Q9YAK3_AERPE          PQGLIAHGRGECFDYLLGEKSHDFALEAERVAAAYLLLSKRPVISVNGNYAALAAGEIAR
B5ID51_ACIB4          YAGLIAHGRGETFDYLIGERSEDFALEAEEAAVAKMLLAKNAVISVNGNVTALAAKEVIE
T0MQE9_9EURY          VSGLISHGRGEAFDYLLGERSQAFSLNAEKAALEKLLKSERAVISVNGNVAALAGEEIVK
A0A1Y3G9W7_9EURY      KAGLIAHGRGEAFDYLLGEETVEWADKATLAAAHCMYRSDNPVLSVNGNVAAVVPELVGE
A0A1Q6DXG3_9EURY      EMGLIAHGRGEAFDYLIDEKTIKESVYAIKVASKILNDSQNPVISVNGNTAALVPKVISD
PPS_METMA             IQGLIAQGRGESFDYLIGERSTESALYAERAAVAALLLAENPVISVNGNVAALAPDKVVT
D5EA45_METMS          MQGLVAQGRGECFDYLLGERTLPSALLAEKIASALLLLADRPVISVNGNTSALVPEKMVE
G7WNL2_METH6          LNGLIAQGRGEALDYLLGEVTTPPAEEAERAAAALLLLAERPVLSVNGNAAALVPREMVD
Q0W5X0_METAR          MQGLIAHGRGEAFDYLLGEKTTAPALGAEKAAVAMLLLARNPVVSVNGNAAALAAPEMVA
M0AV68_NATA1          LQGMHAEGRGSAFDYLLGEETIPSADTAERAAAAHLLLADQPVLSINGNVAALVPGEMVD
D3SRF4_NATMM          LQGMHAEGRGSAFDYLLGEETIPSADAAERAAAAHLLLAEQPVLSINGNVAALVPGEMVD
Q18KP3_HALWD          PQGLIAEGRGEAFDYLLGEKTTSSADDAARAAAALLLHAEHPVISVNGNVAALVPEAIVE
A2SRY5_METLZ          MEGLTSHGRGEAFDYLFGEKTSASALEAEKLGARVLLAAKHPVLSINGNTAALAAKEIAQ
PPS_METHJ             LEGLTAHGRGEAFDYLLGEETTESALRAEKIAAALLLSANHPVISVNGNTAALAAKEIAQ
I7KYV2_METBM          LEGLAAHGRGEAFDYLIGERTSESALLAARTAAAMLLSARHAVISVNGNTAALAAREVAA
A0A126QSM2_9EURY      PTGLISHGRGEAYDYLMGEKSIPPALEAEKVAAAYLLRAKNPVVCVNGNAAALDPENLIA
A0A0A7LDA9_9EURY      PTGMISHGRGEAFDYLMGEKSQNSSLRAEKAAAAYLLNAKNPIVCVNGNAAALDPKNLIL
M9SEY6_METAX          PTGLISHGRGEAFDYLMGEKTIAPALAAEKAAAAFLLRARNPIVCMNGNSIALDPKGLMA
R9T7R5_METII          RTGLIAHGRGEAFDYLIGEKTTPAAKHAEEAIAAYLLEAQNPVITINGNAAALCAEELLK
A0A2E4CYA7_9EURY      DSAMIAHGRGEAFDYLLGERTTDSAARAIRRVASLLISAERPVISTNGNTVVLAGEDLIR
A0A2D9WH94_9EURY      ASAMIAHGRGEAFDYLLGETTSDSARLAIREMAARLMVASKPAISVNGNTVVLAGHDLIR
A0A2V3HLR3_9EURY      DSALIAHGRGEAFDYLLGERTSDSARLAILEVAARLLAAERPVISVNGNTVVLAGKAAIR
A0A2D9M8K0_9EURY      DSALIAHGRGEAFDYLIGERTVPGAAAAIDEVAARLLVAERPVISVNGNTVALACDELLQ
A0A2E6BXG4_9EURY      DSALIAHGRGEAFDYLLGEETCDSARLAITETAYRLLKSEKCVISVNGNTVALAGPQLIA
A0A2E7KQH4_9EURY      DSALXAHGRGEAFDYLLQERTCDAARQAIRXXAXSLXSAKXPVXSVNGNTVALAGPXLLA
A0A2E9B9P7_9EURY      DSALIAHGRGEAYDYLLGEKTSASALLSIKQAAAVMKNANKCVISLNGNAVALAAENLLR
A0A2E0BVC2_9EURY      DSAMIAHGRGEAYDYLLGERTIXSAHFASQXALQSLQQAEXPVLSVNGNVVALAGDEVLQ
A0A2E7GZ84_9EURY      DSAMIAHGRGEAFDYLLGERTTDSAARAARQALATLQAAERPVLSINGNVAALACDEMLQ
A0A2E8V1P1_9EURY      GSALIAHGRGEAYDYLLGEQTIESSMLATKFALQNLINSKKSVISLNGNTTAIAGIELMK
A0A2E2TUQ2_9EURY      GSAMIAHGRGEAYDYLLGEQTIPSAHEATLHALRALKNAEHPIISLNGNAVALAGEQLLA
A0A3A5V4Q7_9EURY      DSAMIAHGRGEAFDYLLGEQTLPSAKDATREVAARLVNAQRPVLSLNGNAIALAGQDFLT
A0A3A5WD32_9EURY      GSAMIAHGRGEAYDYLLGEQTTLSAASATLEAYARLRAAEHPVISVNGNTVALAGRDLLH
A0A2E6F4I8_9EURY      GTAMIAHGRGEAFDYLLGEKTIPIANEATIQAAIMLKSAVRPIISVNGNTAILAGEELVG
                        .: :.***.  **:: * :   :  :       :          ***   :       

D3E3G4_METRM          LAKATD--SKIEINLFYRTPERVEIIERMFKER-----------------------GWED
A0A366M8K9_9EURY      LAKNTD--SKIELNLFYRNKKRVEIISKLYKDH-----------------------GYEN
F0T693_METLA          LSNELD--IPIEINLFYRTSDRVLKIEKLLRDH-----------------------GAKT
A0A328SIH7_9EURY      LSKLLD--IPVEINLYYRTDERVRNIEKVYRDL-----------------------GVKE
PPS_METJA             LAKELN--GKIEVNLFYRTKERELAIKRAFEEKFKDDIE----------------TGKIK
PPS_THEKO             LAKALN--AKLEINLFYRTEERVRTIAEELRKY----------------------DPEIE
G0EC79_PYRF1          LSEATG--ALIEVNLFYRTRERAKAIADLLYAH-----------------------GARQ
Q8ZT72_PYRAE          LSEAVP--ALIEVNLFYRSREREDKIAEVLKRH-----------------------GAKS
A0A497LMM7_9ARCH      LSKATG--APLEVNLFYRSKLREKTVASALKAA-----------------------GASR
Q97W45_SACS2          LAEESN--AKLEINLFYRDERREKAIAEVLYKG-----------------------GAKE
K0IIV1_NITGG          LAKATG--AAIEINLFYRTEERERAIKAELETH-----------------------GAEN
A0A2E5KF26_9ARCH      LAKLTN--SKIEINLFHKSSTRAKKISQLLKNH-----------------------GAMD
A0A2E4HQX7_9ARCH      LANLTN--SQIEINLFYRTEHRIQKIHELFKKY-----------------------TDNN
A0RXQ6_CENSY          LARAAR--ARMEVNTFYGDGGRRARIAAELERR-----------------------GARG
I3D3I5_9ARCH          LSKQTK--AKIEVNLFYANANRKQAIINALKKN-----------------------GAVE
A0A133U985_9EURY      LSERYD--IDVEVNLFHESEDREKKIAEHLKDC-----------------------GVDR
D2RGD3_ARCPA          LSKLLN--APLEVNVFHFSKERVDRIKKYLERF-----------------------GAE-
A8A9N3_IGNH4          LSKALN--APLEVNLFYRSEERAKRIAELLKAH-----------------------GAEE
I0A1H3_FERFK          LSNIID--AKIEVNLFYRTEERVKKIVDFLKER-----------------------GAKE
L0AAJ1_CALLD          LSNSLN--VPIEVNLFHRSEERIKKIENYLKDI-----------------------GAKN
Q9YAK3_AERPE          LSEALGGRAVVEVNIFYRTEERVRRIHEVLASA-----------------------GVKG
B5ID51_ACIB4          LADSVG--AKIEVNLFYRSEDRIRKIVEEFKTL------------------------GKD
T0MQE9_9EURY          FSRRYG--IPVEANIFYWSRERIEKIVSYFRDL------------------------GLE
A0A1Y3G9W7_9EURY      LS-MLG--VGVEVNLFHRSDERVNRIIEFLEEH-----------------------GAVG
A0A1Q6DXG3_9EURY      FTNETG--INVEVNLFHRTEDRVRKIIKFLKEH-----------------------GAGK
PPS_METMA             LADITG--ARIEVNLFHRTDTRVHLIIEQLKAS-----------------------GAAE
D5EA45_METMS          LASVTG--ASLEVNLFHRTEERVSRIISHLKSF-----------------------GATC
G7WNL2_METH6          LARKIG--APLEVNIFYRTEERVRRIADHLRSF-----------------------GAEE
Q0W5X0_METAR          LAKEVN--AGVEVNLFHRTEERVGKIAGLLRSN-----------------------GCEP
M0AV68_NATA1          LASAVG--ADLEVNLFNRTPERVEAIAEHLREH-----------------------GADE
D3SRF4_NATMM          LADAVD--ADLEVNLFNRTPERIEAIAEHLREH-----------------------GAEG
Q18KP3_HALWD          LAEVVE--ADIEVNLFNRTEKRMNAIADHLYDH-----------------------GAQT
A2SRY5_METLZ          LQKASG--AEVEVNLFHRTDERMTLVTNLLEEA-----------------------GCIV
PPS_METHJ             LQLASK--ARVEVNLFHRTDERVQAISGLLKEH-----------------------GITL
I7KYV2_METBM          LQQASG--ADVEVNLFHRTDERIALITRLLEEH-----------------------GVRV
A0A126QSM2_9EURY      LAKAVP--AKMEVNLFHRTPERMEGLISYLESK-----------------------GAEN
A0A0A7LDA9_9EURY      LAETVS--AKIEVNIFHRTERRMELLISYMEEN-----------------------GAES
M9SEY6_METAX          LSEAVP--ARMEVNIFHRTEERMEALISYMESQ-----------------------GARG
R9T7R5_METII          LASEVG--AKVEVNIFHWSSERLEKLVSYLETF-----------------------GNFE
A0A2E4CYA7_9EURY      VAAVVG--CPIEVNLYYRTPERVAGLISLLQEQRESIAKEVGP--XGFEGDWAEEVRSVR
A0A2D9WH94_9EURY      VAAIVG--CPIEVNLYYRTPERVSGLLSRLEQQAAEVARGPAP--EGWQGDWSAAVASVS
A0A2V3HLR3_9EURY      IAASLS--CPIEVNLYYRTPERIEKLLTGLEEMRAEVASEAPP-NDGTQAQWADSVKAIQ
A0A2D9M8K0_9EURY      IADSLG--CPXEVNIYYRTPERMAGLLERIEARAT-----------------ALDLNHVE
A0A2E6BXG4_9EURY      CAAVLN--CPIEVNIYYRTPKRMEVLLSTLIEQQQLAMK--------LYPQIKNKITDVK
A0A2E7KQH4_9EURY      XAAVLE--CPIEVNIYYRTPERMXALLXKLDXQKVEAGX--------XXPDXVTXIEAVK
A0A2E9B9P7_9EURY      CATILQ--CPVEINIYYRTPERMKALLSRLEKVRQEVMKSKKP--DGWLGNWEEDVLAVP
A0A2E0BVC2_9EURY      LAEKLN--CPVEVNIFYRTPERMHALLSDLNERKERLG------------------IEVE
A0A2E7GZ84_9EURY      LANHLS--CPVEVNIFYRTPERMEAILDHMNERNQALG------------------LTVP
A0A2E8V1P1_9EURY      LASEIN--CPIEVNIFYRTPKRMKALLNHLESINEEFG------------------LDVK
A0A2E2TUQ2_9EURY      LAQQLN--CPVEINIFYRTPERMSALLERLETIKKERS------------------LDVE
A0A3A5V4Q7_9EURY      IASQLG--CPIEINIFYRTPERMGALLGHLKLLNQKLG------------------LDVE
A0A3A5WD32_9EURY      LASMLS--CPVEVNIFYRTQARMDGLMAKLEGWCAEDG------------------LQVD
A0A2E6F4I8_9EURY      CAALLS--CPIEVNIYYRTPERISGLVAHLEKCKKIVSLRPPNNWKRSPEEWEGAVNNVI
                                 * * :     *   :                                  

D3E3G4_METRM          ILGGNDEKLEYIDNLNSPRATASKEGSYIADVMLVPLEDGDRAEVLVQNGKKIICIDLNP
A0A366M8K9_9EURY      LLGIDDKKIRYIDNIDSPRATASEEGIYKSDVVLVSLEDGDRAEVLVDSGKKIIAIDLNP
F0T693_METLA          VLGTDHEKKALIKGLEGPRSSSSAEGIYKADVVLVPLEDGDRAEALVKNGKLLITIDLNP
A0A328SIH7_9EURY      ILGTNDDEFIDTPNLNGPRSPVSIDGISKSDLIFIPLEDGDRAEALHDLGKTIISVDLNP
PPS_METJA             ILGIDDA-NKQIPNLDSLRGKVSEEGIFTADVVLVPLEDGDRAEALVNMGKKVIAIDLNP
PPS_THEKO             ILGINPT--KRIPGLEHERGKVDENGIWKADVVLVPLEDGDRTEALVRMGKFVVTVDLNP
G0EC79_PYRF1          VLGV-DDATARIPGLDSMRGLVSPNGIYKADYVLLGIEDGDRTEALVRIGKTVAAIDLNP
Q8ZT72_PYRAE          VLGVGDDASCTIPELFSERRRVSCEGIYKADVVLVPLEDGDRTQALRRLGKTVIAIDLNP
A0A497LMM7_9ARCH      ILGV--NASKRIPRLKSFRSLAEAKGIIEADLVLLGIEDGNRVEALRKAGKKVVVIDLNP
Q97W45_SACS2          VLGVGEDASEVIPELFSQRRRVSPKGIYKADVVLLGLEDGDRTEALVKMGKKVIAIDINP
K0IIV1_NITGG          VLGVGSRASATIPELQSERRRVDPDGIYSADTVFVPLEDGDRTEALVKMGKKVITIDLNP
A0A2E5KF26_9ARCH      IYGINKKFLTQIPNLKSDRKFIDKRGIFSADVIFVPLEDGDRTEFLKKMNKTVITVDLNP
A0A2E4HQX7_9ARCH      ILGTDKKYLVKIPELQSLRRFADKRGIIKSDVVFIPLEDGDRAESLVNIGKRVLTVDLNP
A0RXQ6_CENSY          VLGANPESRGRLAGTSRSRGAADKEGILAADVVVVPLEDGDRTSALKAAGKQVITFDLNP
I3D3I5_9ARCH          ILGSNINSSIKLSGIDSARRIVDKNGIFVADVVVVPLEDGDRTMALRKAGKSVITFDLNP
A0A133U985_9EURY      VLGVEEEYSTEFSDIKSSRKKVDKRGQKRGDVIVVPLEDGDRTEALVKSGKTVITVDLNP
D2RGD3_ARCPA          VLANC-DAE--LNGLSHGRRIVDRRGIYVADTVLVPLEDGDRCEILKKHGKKVIAIDLNP
A8A9N3_IGNH4          VLWRP-DQE--LPGLSSERRRVSSKGIASADVVLVSLEDGDRTEALKRNGKKVIAIDLNP
I0A1H3_FERFK          VLGLE-YVEG-IPGLSSERRKVDPRGILKADVVLVMLEDGDRTEALKKIGKRVIAIDLNP
L0AAJ1_CALLD          IMGSECNKVK-LPNLEGPRGIVCENGIYKSDFVLLAIEDGDRTQALRNLGKTVSAIDLNP
Q9YAK3_AERPE          LLPPDCEKTR-VPGLESPRGIVCVEGIASADFVLLAIEDGDRTEALVKWGKRVAAIDLNP
B5ID51_ACIB4          ILGANPDAI--IPNLEHSRALCTKEGIYSADVVLVPLEDGDRTKALRDMGKFVITIDLNP
T0MQE9_9EURY          ILGLNQDAH--IPGLESNRGRCESKGIFSADTVVIPLEDGDRAEALKKMGKFIIAIDLNP
A0A1Y3G9W7_9EURY      VLGGDAD--MLIKDLSHDRAFVSREGIYSADTVMVPLEDGDRTVKLRDLGKTVISIDLNP
A0A1Q6DXG3_9EURY      VLGRNPG--KRIPDLSHKRALVTKEGIYEADTVVVPLEDGDRTEKLIEMGKKVISIDLNP
PPS_METMA             VLGKNPD--AS-LELSHDRRLVSSKGIYTADVVLVPLEDGDRCEKLVEMGKTVITIDLNP
D5EA45_METMS          VLGARGN--GR-LDLEHARAIVDQEGIYSADVVLVPLEDGDRCQKLVEMGKTVIAIDLNP
G7WNL2_METH6          VFGETPD--ASVPGLDHARGKASRGGIFDADVVFVPLEDGDRCEALVRMGKRVVTVDLNP
Q0W5X0_METAR          -LGVHPD--RLIPGLSHDRAKASSEGIFTADVVLVPLEDGDRCEALVKMGKKVIVVDLNP
M0AV68_NATA1          VKGLTAD--ARIPKLDHQRAKVDADGIYAADVVLVPLEDGDRAEALQEMDKTEIVIDLNP
D3SRF4_NATMM          VKGLTAD--ARIPNLDHQRAKVDADGIYAADVVVVPLEDGDRAEALQEMEKTEIVIDLNP
Q18KP3_HALWD          VKGLKAD--DQIPGLDHERGTVDADGIGAADVVLVPLEDGDRAAALDAVGKREIVIDLNP
A2SRY5_METLZ          SKGPV----ERCVPLPHARGLCRPDGIGSADVVLVPLEDGDRCEALVSMGKLVITVDLNP
PPS_METHJ             VEGTV----SRYIPLDHDRGLCHFDGMHSADVVLVPLEDGDRAQALIDLGKKVIAIDLNP
I7KYV2_METBM          LSGTA----ERLVPLAHDRGLCLPEGIGDADVVLVPLEDGDRCEALRKMGKAVITVDLNP
A0A126QSM2_9EURY      VLGRVPD--CRIQGLNHDRALCTKEGIFDSDVIVVPIEDGDRAEALVSMGKVVISIDLNP
A0A0A7LDA9_9EURY      VLGREPD--ARIPMLTSDRALCTKEGIFDSDVILVPIEDGDRAKALADMGKIVISIDLNP
M9SEY6_METAX          VLGREPD--ARIPGLTSDRALCSKAGVYDSDVILVPIEDGDRAEALIAMGKTVISIDLNP
R9T7R5_METII          ILGRNQN--AVLENIASDRARCCREGIYSADVVLIPLEDGDRAKALKIAGKTVLAIDLNP
A0A2E4CYA7_9EURY      ILGSEED--FRIEGLEGPRSICTKEGIGLADLVLVPLEXGDRCEALVSLGKKVCVIDLNP
A0A2D9WH94_9EURY      LLGGSPD--DAIPGLEGPRSVCCSGGIGGADAILVPLEDGDRCEALVGMGKQVLVVDLNP
A0A2V3HLR3_9EURY      ILGAESD--GRIEGLEGPRALCSRIGIEAADTVLVPLEDGDRCEALMALGKQVLVVDLNP
A0A2D9M8K0_9EURY      ILGANPD--GKIPGLEGPRSNCCKDGILGADMILVPLEDGDRCEALIAMGKQVFVIDLNP
A0A2E6BXG4_9EURY      ILGGNPD--GRIPNLXGPRAKCHSDGILSADTILVPLEDGDRCEALIAMEKTVCVIDLNP
A0A2E7KQH4_9EURY      ILGDAPD--TRIPNLEGPRANCHHDGIFSSDVILVPLEDGDRCEALVAMGKTVCVIDLNP
A0A2E9B9P7_9EURY      ILGAEPN--GRIQNLDGPRANCCKEGILDADVIFVPLEDGDRCEALMNMGKTVIVVDLNP
A0A2E0BVC2_9EURY      ILGENPD--ATIPGLKGPRAKCESSGILQADVLLVPLEDGDRCEALVAMGKTVIVIDLNP
A0A2E7GZ84_9EURY      VLGHAPD--AQIPGLKGPRAACHRDGLLNSDAVLVPLEDGDRCNALVAMGKSVVVVDLNP
A0A2E8V1P1_9EURY      ILGANPD--SLIPGLEGPRAKCCYEGIFSSEVILVPLEDGDRCEALIAMGKTVIVVDLNP
A0A2E2TUQ2_9EURY      ILGASPN--ARIPGLKGPRAKCTKEGIIDSDVILVPLEDGDRCEALVAMGKTVIVIDLNP
A0A3A5V4Q7_9EURY      ILGGIPD--ARIPGLEGPRGACQQDGLFEADAVLVPLEDGDRCEALMAMGKDVLVIDLNP
A0A3A5WD32_9EURY      VLGRRTD--GRIEGLEGPRAQCEAGGIASADVVLVPLEDGDRCEALVAMGKTVLVVDLNP
A0A2E6F4I8_9EURY      ILGSFAD--GLIPGLSGPRAICDVNGILASDAILVPLEDGDRCEALVNMGLKVIVVDLNP
                                        *      *   .: :.: :* *:*   *         .*:**

D3E3G4_METRM          LSRTSKMSTVSIVDNIVRAVPLMTSMALDFKEKGKDKDKEFLENIIKNFSNEQNLKDSLA
A0A366M8K9_9EURY      LSRTAKMANITIVDNIVRTIPLMIEYAKKLN----SKDESQLKELISDFSNAKNLNESLK
F0T693_METLA          LSRTAKTSSITIVDNIVRAIPNLIDTVINLS----QTDKVTLHQIISNFDNKENIQSSLK
A0A328SIH7_9EURY      LSRTAVTSTLTIVDNIVRAMPLLIKYIKELE----DYSKDDLTKMINNFDNKVNLDNSIR
PPS_METJA             LSRTARKSTITIVDELTRAMPLLIKYVKEFK----NKDREELLKIVEDFDNKKNLKDMID
PPS_THEKO             LSRSARMADITIVDNIVRAYPRMVELAREMK----DYSREELLKIVGEYDNGKTLSDVLL
G0EC79_PYRF1          LSRTSLAASIPIVDHIKRA---LTNIKRYYE----SMSREEASRVINSFNPRKVIADTLL
Q8ZT72_PYRAE          LSRTAQAASITIVDNITRAMPRLVDAVRRMK----NASREELENVLKNYDNKRVLASALL
A0A497LMM7_9ARCH      LSRSAFNASITIIDNVVRALPKLRLEIEKLR----SASKQRLRREASSYDNREALAEALN
Q97W45_SACS2          LSRTSRTATITIVDNIIRAVPRLVEKVKELK----SKSKEELEQIVFNYDNKTILAESLK
K0IIV1_NITGG          LSRTAKAAHITIVDNIVRAMPALAEAAHQLN----GS--KSLKRIVDGFDNKKNLRESLK
A0A2E5KF26_9ARCH      LSRTSIMSDISIIDNIIRVIPEMVKQSENMS----NLSLDDLQKIVNKFNNQKQLQLILR
A0A2E4HQX7_9ARCH      LSRTSKMSNITIVDNIMRAIPVMILECRKMK----QLPINDLKKILSDFDNENQLNLILD
A0RXQ6_CENSY          LSRTARTADITIVDNITRGMDELARLCREYS----ARGAPALSRIVRNFDNGANLAACIR
I3D3I5_9ARCH          LSRTSQTANITIVDNVTRAIDLLIEECKKMS----KK-----------------------
A0A133U985_9EURY      MSRTARAAHITIVDNIVRAMPILIEKIGEIK----NAPPERIEQIIENFDNEENLRRTIE
D2RGD3_ARCPA          LSRTAMMADVTIVDNIVRAIPNMIKFAKKLR----DASREELEEIVKNYDNRKTLRLALE
A8A9N3_IGNH4          FSRTSLTADITIVDNVIRAIPNITKFVKAMS----ER---EAEEALERFDNARNLREVVK
I0A1H3_FERFK          FSRTSMAADVSIMDNVTRAIPLMIDKARIMK----KLPKEELKKKISNYNNRRRLGEYII
L0AAJ1_CALLD          FSRTAQAASITIVDEAIRATKNMIEFSKELS----QLSRCELLKITSMYDNKSILSKAFN
Q9YAK3_AERPE          FSRTAQKASVTIVDEAVRATRNITRFVDELS----GASEEELRSIVAGYSNRETLSRAFK
B5ID51_ACIB4          LSRTAQTAHITIVDELTRAVKNMIKMAQNMNI-------DEARNILKWYDNHAILAKSLE
T0MQE9_9EURY          LSRTSRFGDITIVDDVERTFRNL----NNLSE-------MECAGALNSYENGKNTEMAIR
A0A1Y3G9W7_9EURY      LSRTSKTADISIVDNVVRVFENFIGYWKKIDR-----DSSFKLDVYNSFDNEENLRKMEE
A0A1Q6DXG3_9EURY      RSRTAQESSVTIVDNVVRAMPKLFEFYKEEP----------DVDI-DEFDNEKNLEQIEA
PPS_METMA             LSRTSKTATISIVDNLTRALGNMAKFAQEMKKE----RKEELVKLITTYDNKRTLSEAIS
D5EA45_METMS          FSRTSKTATLTVVDNVSRAMANLIHYSREFENC----NHEELGEIAGDFDNATFLSDAVE
G7WNL2_METH6          LSRTARTSTVTIVDNVVRALPNLISLVGEMGGQ----REAELREIVASYDNRAVLRRSVE
Q0W5X0_METAR          LSRSARTATVTIVDNIVRALPNMVKLAEEMKSL----PRPELEKIAGGFSNETALSAALD
M0AV68_NATA1          LSRSPQVAAVPIVDNIIRAVPNMTEHARDLADA----DEAELRSIVDEFDREQVLEDAEA
D3SRF4_NATMM          LSRSPQVAEIPIVDNIIRAVPNMTAHAEELATA----SEAELRAIIEEFDREHALEAAEE
Q18KP3_HALWD          LSRSALAATVPIIDNVIRAVPNITEHASALKQA----DNVALTTVINRFDADEVRERAEQ
A2SRY5_METLZ          IDRTSKTATLPIIDEVTRALPNIALECDRLKA-------SGETVTMPEIDARYFLSQAVK
PPS_METHJ             LSRTSKVATVPVIDEVTRALANIARFCTELDQ-------DEITGLTREIHGTGFIRDALE
I7KYV2_METBM          LSRTARTATLTIVDELTRALPAITAACATLEP-------GERDRLIASLDNTYLLRAAID
A0A126QSM2_9EURY      LSRTSCKATVPISDEMTRALENIIKFIQELRG-----DEQAMLKIISQYSSQKNRRETVK
A0A0A7LDA9_9EURY      LSRTSRTATVSISDEMTRALENIIAFAEELKG-----NKKAIEETIRTFSNEANRKNAVE
M9SEY6_METAX          LSRTSKAASVPISDEITRALANITMFVRELKG-----KDAEIDAVIASYSSKETRRQTIE
R9T7R5_METII          LSRTSVESDATAVDEITRAVPNIRQAVKDLKD-----DQKRRREIISAFDNRSNLNESVN
A0A2E4CYA7_9EURY      LSRTAMMAGVTIVDEVSRASRSLLTEVL--S----------RPSMEEEWDNRAILREALR
A0A2D9WH94_9EURY      LSRTAMTATVTVVDEVSRAASILLSEVV--A----------GDAVPTNWDNTKALEESLA
A0A2V3HLR3_9EURY      LSRTARRATITIVDEVSRALDLLSAALL--T----------NP-EPADFDNSANLRAALH
A0A2D9M8K0_9EURY      LSRTAKTATICIVDEVQRTVSALFSRLK--N----------PKIPDPKFDADASRRSVLE
A0A2E6BXG4_9EURY      LSRTAQMATVTIVDELTRCIPILLELLMQ-N----------SVRSL-GWNNRENLENVIQ
A0A2E7KQH4_9EURY      LSRTAKMASITIVDELTRCVPILLDDLRN-G----------ADSSFPNWDNQSNLKQVTA
A0A2E9B9P7_9EURY      LSRTAKMASITIVDELMRVGSVLIDELVK-S----------DCKINEKWDNKLVLDAALN
A0A2E0BVC2_9EURY      LSRSSQRGSITIVDELSRCLENMLSMPM--Q----------DLPTPDSYNHSQSLQDALN
A0A2E7GZ84_9EURY      LSRSAQQGTITIVDEVSRALNAMLELARVEG----------EVQVDPSYDHAAVLNEGLA
A0A2E8V1P1_9EURY      LSRSSRKASITIVDEISRVANNMLSLIKEDD----------ISDMEFNYDNNLTIKNSIH
A0A2E2TUQ2_9EURY      LSRSAKMGTITIVDELTRVAENMLFQFDSIK----------MSEVSKTYDNEAALRDALR
A0A3A5V4Q7_9EURY      LSRSSRGCSVAIVDEVSRVAKNLIQFIP-------------EKPSVTEWDNNKALQNALD
A0A3A5WD32_9EURY      LSRTARTATVTIVDEVGRTAAALRAHAMAAE----------SPKPNPDWDNMACLQASLD
A0A2E6F4I8_9EURY      LSRSSLMSTITIVDDVTRFSNNLQEKLLI-F----------QRLKREKWDNKKSLQVALD
                       .*:.        *.  *    :                                     

D3E3G4_METRM          EIKLK----------------
A0A366M8K9_9EURY      YMELSKLSKS-----------
F0T693_METLA          KISKKYTGEDL----------
A0A328SIH7_9EURY      DILKRFE--------------
PPS_METJA             YIAERLKNLSLDEL-------
PPS_THEKO             HIRDRLTRLAEEGIWRRKELE
G0EC79_PYRF1          YIRNRLETLARQLMYDYR---
Q8ZT72_PYRAE          HISKRIEELAKNIRES-----
A0A497LMM7_9ARCH      YIRSRLERLSSNLASGRS---
Q97W45_SACS2          FIANRLTQLSLSL--------
K0IIV1_NITGG          IIRGVI---------------
A0A2E5KF26_9ARCH      FMSKRLIDLST----------
A0A2E4HQX7_9ARCH      HISTRLISLSNK---------
A0RXQ6_CENSY          EMTAGLRRQWIA---------
I3D3I5_9ARCH          ---------------------
A0A133U985_9EURY      SMLNRLKKI------------
D2RGD3_ARCPA          TIRDNLTKIAEEKLRDI----
A8A9N3_IGNH4          WIKKWLDAKTSELL-------
I0A1H3_FERFK          YIKERLENEAKRLMSFP----
L0AAJ1_CALLD          QMFVNLKNAYEKGIIFNL---
Q9YAK3_AERPE          AILDRLSSAADSGVLTQ----
B5ID51_ACIB4          HINRRLENLSRQLQSSSGLKT
T0MQE9_9EURY          FIGERVSSITNWPDL------
A0A1Y3G9W7_9EURY      KMRGVSFEGG-----------
A0A1Q6DXG3_9EURY      KIRRNKFGKD-----------
PPS_METMA             EIQEHLKTMAAETGY------
D5EA45_METMS          ELMENLKNQ------------
G7WNL2_METH6          AMVSHLSRQFSTFEE------
Q0W5X0_METAR          AMMETVQSSKQH---------
M0AV68_NATA1          RIRNGL---------------
D3SRF4_NATMM          RIRNGV---------------
Q18KP3_HALWD          EIRRGELRSS-----------
A2SRY5_METLZ          DIQEFLSHALD----------
PPS_METHJ             YIRERLLNVLD----------
I7KYV2_METBM          EMRERLVHALE----------
A0A126QSM2_9EURY      YICDSLMSGFGTEDD------
A0A0A7LDA9_9EURY      EICSSLMQEFEVENK------
M9SEY6_METAX          CICDSLMAEFKE---------
R9T7R5_METII          CIKDNLTQQQIF---------
A0A2E4CYA7_9EURY      EMSGSEGRI------------
A0A2D9WH94_9EURY      LMARASP--------------
A0A2V3HLR3_9EURY      VMAESAERL------------
A0A2D9M8K0_9EURY      VMLGALERDQTDA--------
A0A2E6BXG4_9EURY      EILRNFNN-------------
A0A2E7KQH4_9EURY      EMLRVLD--------------
A0A2E9B9P7_9EURY      EINSNIQN-------------
A0A2E0BVC2_9EURY      EIVHGMKSKFSEARD------
A0A2E7GZ84_9EURY      EMLASLKR-------------
A0A2E8V1P1_9EURY      XIIKSLSEKYDLSX-------
A0A2E2TUQ2_9EURY      HIATKFSD-------------
A0A3A5V4Q7_9EURY      HILETMSNKFD----------
A0A3A5WD32_9EURY      EIAAHLSHRFE----------
A0A2E6F4I8_9EURY      TINETLQSSIK----------