CLUSTAL format seed alignment for MF_02228

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A3SJU4_ROSNI          MARDYLKKAHLTSRSDASDVHDTVRKILADIEAGGDQAALDYAAKFDKYDGNVMLTAEEI
A0A0L6CTD6_9RHOB      MALEYLKKASLTSTSNAGDVHDTVIAILNDIEAGGDTAALEYAAKFDRYEGNVLLTSAEI
A4ESX9_9RHOB          MTRVYLKKAALTPKSDASETHVIVQDILNDIEAGGDAKALEYAAKFDQYYGNVLLTPEEI
D0CV87_RUELI          MSREYLKKATLTAQSHASEVHDTVKTILADIEAGGDAKALEYAAKFDKFDGNVLMTPEEI
HPSN_RUEPO            MTIEYLKKASLTSKSDASDVQETVRAILADIEAGGDQVALDYAAKFDRYEGSIILSPEEI
A0A1H3NFF4_9RHOB      MTREYLKKATLTAASGASDVHDTVVSILKDIEEGGDAKAMEYAAKFDKYEGNVILTQAEI
B6B377_9RHOB          MTREYLKKATLTSSSGASEVHDTVKGILDDIEAGGDAKALEYATKFDRFEGSVLLTQAEI
Q28SJ7_JANSC          MTREYLKKAPLTSASDASDVQETVRTILADIEAGGDDKAREYAAKFDKYEGNIILTAEEI
U4V193_9RHOB          MTVEYLKKAPLHSRSDATETREIVRNILDDIEAGGDAKALEYAAKFDNYDGEIILTDEAI
B9NNL9_9RHOB          MPREYLKKATLTSKSDASETKKIVREILDEIEAGGDAKALEYAAKFDQYEGEIILSPEAI
A8LPR9_DINSH          MSREYLKKATLTPKSDAGETKKIVRAILDEIEAGGDDAALAYARKFDNYEGEILLSQDAI
E2CFU8_9RHOB          MSVEYLKKATKTSRSDASDTTAIVQEILDRIEAGGDEAALEYAAKFDKYEGNIVLPAEEI
A6FK01_9RHOB          MAREYLKKAALTAQSGASDVHQTVQTILDDIEKGGDQAALDYAAKFDQYDGNVVLTRDEI
Q161S1_ROSDO          MAREYLKKAEKTAMTDAGDVREIVQNILSDIEAGGDAAAMRYAEQFDKYAGNVILTDDEI
A0A2Z2NUL7_9GAMM      MTRKYLKKATKTATSDATDVGETVRTILSDIEAGGDEAALRYAEKFDRYEGNVLLTEEEI
A0A2R8A8E0_9RHOB      MSVTYLKKAPKTSATDAGDVQETVRGILNDIEAGGEDAARKYAAKFDRYDGNILLTRDEI
A9CXT5_HOEPD          MSRIYLKKAEKTASTDSGSVRDTVQSILDAIEAGGEASAREYAEKFDRYTGNIIVTREEI
A0A073J3R7_9RHOB      MPREYLKKATKTAQTGEAEVSRTVATMLADIEENGESAARRYAAQLDGYEGPVVLSADAI
A3JST3_9RHOB          MARIYLKKAEKTAATSADTTQNIVRNMLSEIEAGGDARAQAYAAELDKYTGPALLDDEGI
Q0FFD7_9RHOB          MARVYLKKAEKTAKTDAGSTQDIVRGILSDIEEGREKVALEISAKFDKYSGNAILSRDEI
A0A0K8P5H8_IDESA      MSTTYLKQASRTPETETATAQKVVTEMLARIGADGEAAVRDYARTLDGWTGPIVVERAEI
A1WFZ2_VEREI          MTVRYLKKADKTPETETASAQQVVSAMLAEIGAHGEAAVRAYARRLDQWDGDIVVTRAEI
HPSN_CUPPJ            -MISYLKKAEKTPQTETATAQKVVTEMLAEIQARGKDAVRQYAKQLDGWSGDIVLTPDQI
A0A2N0GCX7_9GAMM      MAITYYKKAEKNASTGHDQTQELVARMLSEIEAGGESKAKEYCLSLDNWQGDIVVSREQI
S2KEX9_HALAF          MAISYYKKADKNASTGYDQTQEIVSRMLAEIEAEGEAKAKEYCRTLDGWEGDVVVSREQI
D0I9Q1_GRIHO          MAVNYLKKAEKTAATGEDDVRAIVADMLKEIEQGGEETCIAYTRKFDNWHGDIVVSQQEI
                          * *:*   . :    .   *  :*  *    .         :* : *  ::    *

A3SJU4_ROSNI          DAACALVPEKLKADIRFAHDNVKRFAEQQKSTVANVEYEIVPGVIAGQKAIPVDAAGCYA
A0A0L6CTD6_9RHOB      EAACALVPEKLKADIRFAHDNVRRFAEMQKSTVANVEHEVVPGMIAGQKAIPVDAAGCYV
A4ESX9_9RHOB          EAACAQVPEKLKADIRFSHDNVRRFAELQKSTVHDVETEISPGFITGQKAIPVDAAGCYV
D0CV87_RUELI          EAACARVPEKLKADIRFAQDNVRRFAEAQKATVSDVQLEIVPGFIAGQKAIPVDAAGCYV
HPSN_RUEPO            EAACAKVPEKLKADIRFAHDNVRRFAETQKATLTDVELEVVPGVITGQKAIPVDAAGCYV
A0A1H3NFF4_9RHOB      EAASALVPEKLKADIQFAHDNVKRFAELQKSTVADVEMEIQPGYVAGQKAIPVDAAGCYA
B6B377_9RHOB          DAAIALVPEKLKADIRFAHDNVRRFAEKQKSTLTDVEMEIEPGFIAGQKAIPVDAAGCYV
Q28SJ7_JANSC          EAASALVPDKLKADIQFAHDNVRRFAEAQKATVSDVEVEIVPGLIAGQKAIPVDAAGCYV
U4V193_9RHOB          AAASELVPEKMKRDIEFAHANVKKFAEAQKSTVSDFETEVVPGLIAGQKAIPVNASGCYI
B9NNL9_9RHOB          EAASALVPDKLRRDIQFAHDNVRRFAEAQLSTVADFEVEVVPGLIAGQKAIPVSAAGCYV
A8LPR9_DINSH          DAAIAQVPEKLKHDIDFAHANVKRFAEAQRDTVANFEIEVVPGLIAGQKAIPVHAAGCYV
E2CFU8_9RHOB          EAASALVPAKLKQDIEFSHANVKRFAESQKESCGNTEVEIIPGLIAGQKCIPVDTAGCYI
A6FK01_9RHOB          EAAKALVPEKLRQDIQFAHANVRAFAEAQKETLRDIEIEVVPGLIAGQKSIPVHGAGCYV
Q161S1_ROSDO          EAASAKVSQKLKDDIAFAHDNVRRFAEVQKSTMKDVELEIVPGLIAGQKAIPVRAAGCYV
A0A2Z2NUL7_9GAMM      AAASDAVPQQLKEDIIFAHDNVRRFAEVQKQTMQNVELEVVPGFTLGQKVIPCRAVGCYV
A0A2R8A8E0_9RHOB      DAAAAKVPQVLKDDIRFAHDNVRRFAEAQKSTIQDMEYEIHPGLIAGQKAIPCNAAGCYA
A9CXT5_HOEPD          ERAAASLPQKLKDDIRFAHDNVRRFAEAQKGTLGDVELEIVPGLVAGQKTIPIESAGCYV
A0A073J3R7_9RHOB      AEACARVPQGLRDDIAFAHDNVRRFAEAQKQSVRDVQTEVVPGLIAGQRTIPCNAAGCYI
A3JST3_9RHOB          AEASAKVSQKLKDDIHFAHDNIRRFAEAQKGTMKDMEYEITPGLIAGQRMIPVRAAGCYV
Q0FFD7_9RHOB          DEAKEKIPQKLRDDMHYAHDNIMRFALAQKGTMSNMEMELHPGLITGQKLIPVNAAGCYV
A0A0K8P5H8_IDESA      DRRAAEVPAQVRRDIDFAIAQVSRFAEAQRASLQEFATELHPGVQAGQRVLPVNVAGCYA
A1WFZ2_VEREI          GRRSAEVPAQVRRDIDFAIAQVREFALAQRQSLHEFSVALHPGVTAGQRVIPVNVAGCYA
HPSN_CUPPJ            REQTKDVPAGVRADIDFAIRQVTDFALAQRESLKEFSVELHPGVTAGQRVLPVNVVGCYA
A0A2N0GCX7_9GAMM      DAAKSKVPEQLKKDIEFAYERVSRFAVAQRDSIKEFETELSPGLFAGQKLIPMETAGCYV
S2KEX9_HALAF          EAAKAKVPDQLKQDIHFAYERVSRFATAQRDSIQEFETELSPGLFAGQKLIPMETAGCYV
D0I9Q1_GRIHO          DNAAAKVPEQLKKDIQFAYERVRDFAQAQRNSLSEFETELSPGLFAGQRLIPMQAAGCYV
                            :.  :: *: ::  .:  **  *  :  :    : **   **: :*    *** 

A3SJU4_ROSNI          PGGRYSHVASAIMTVTTAKVAGCKHITACSPPRPGVGVNPAIVYAAHICGADKIMAMGGV
A0A0L6CTD6_9RHOB      PGGRYSHIASAIMTVTTAKVAGCRHITACSPPRPDVGVNPAIVYAAHICGADQILAMGGV
A4ESX9_9RHOB          PGGRYSHIASAIMTVTTAKVAGCKHITACSPPRPGVGVAPAIVYAAHICGADKIMAMGGV
D0CV87_RUELI          PGGRYSHVASAIMTVTTAKVAGCRHITACSPPRPGEGVAPAIVYAAHISGADSILAMGGV
HPSN_RUEPO            PGGRYSHIASAIMTVTTAKVAGCKHIMACSPPRPGVGVAPAIVYAAHICGADTIMAIGGV
A0A1H3NFF4_9RHOB      PGGRYSHIASAIMTVTTAKVAGCKHITACSPPRPGVGVAPAIIYAAHICGADKIMALGGV
B6B377_9RHOB          PGGRYSHIASAIMTVTTAKVAGCHHITACSPPRPDVGIAPAIVYAAHICGADKIMAMGGV
Q28SJ7_JANSC          PGGRYSHIASAIMTVTTAKVAGCNHIIATSPPRPGVGVAPAIVYAAHICGADTIMALGGV
U4V193_9RHOB          PGGRYSHIASAIMTVTTAKVAGCNNIVACSPPRPGVGIAPAIVYAAHICGADKILAMGGV
B9NNL9_9RHOB          PGGRYSHIASAIMTVTTAKVAGCKNIVACSPPRPGVGIAPAIIYAAKVCGADKILAMGGV
A8LPR9_DINSH          PGGRYSHIASAIMTVTTAKVAGCKHIVACSPPRPDVGIAPAIVYAAHVCGADKIMAMGGV
E2CFU8_9RHOB          PGGRYSHIASAIMTVTTAKVAGCKNIIACSPPRPGVGINPAIVYAAKVCGADQILAMGGV
A6FK01_9RHOB          PGGRYSHIASAIMTVTTAKVAGCQHIVACSPPRPGVGINPAIIYAADLCGADTILAMGGV
Q161S1_ROSDO          PGGRYSHIASAIMTVTTAKVAGCQHITACSPPRPDVGINPAIVYAANLCGADKILSMGGV
A0A2Z2NUL7_9GAMM      PGGRYSHIASAIMTVTTAKVAGCDHIVACSPPRPGVGIAPAIIFAANLCGADKILAMGGV
A0A2R8A8E0_9RHOB      PGGRYSHVASALMTVTTAKVAGCGHITACSPPRPEIGVNPAIIYTADICGADSILALGGV
A9CXT5_HOEPD          PGGRYSHVASAIMTVTTAKVAGCKHITVCSPPRPDVGVHPAILYTADICGADTILAMGGV
A0A073J3R7_9RHOB      PGGRYSHVASAIMTVTTAKVAGVSHIAACSPPRPGTGLPPAIIFAAHLCGADSILAMGGV
A3JST3_9RHOB          PGGRYSHVASAMMTVTTAKVAGVHNITACSPPQGDAGMNPAIVYAAKLCGADQILTLGGV
Q0FFD7_9RHOB          PGGRYAHIASAMMTVTTAKAAGVGHITACSPPNGDEGINPAIIYAADLAGADKILSLGGV
A0A0K8P5H8_IDESA      PAGRYAHIASAYMGVATAKAAGVKTIVACSGPFRGGPMHPHLLYAFDRAGADVILTLGGV
A1WFZ2_VEREI          PTGRYAHIASAYMGVATAKAAGVETIIACSGPFRGAPMHPCLLYAFDRAGADVVMTLGGV
HPSN_CUPPJ            PAGRYAHIASAYMGVATAKAAGVKTVVACSSPFRGQGIHPHVLYAFQAAGADVIMALGGV
A0A2N0GCX7_9GAMM      PGGRYAHIASAIMSVATAKVAGVKNVVACSVPRDEQGIHPAILYAMDLAGADTILQMGGV
S2KEX9_HALAF          PGGRYAHIASAIMSVATAKVAGVRNVVACSVPRDEKGIHPAILYAMDLAGADIILQMGGV
D0I9Q1_GRIHO          PGGRYSHIASAIMSVTTAKVAGVDHVIACSPPGREGGIHPAILYTLSLCGADTILNLGGV
                      * ***:*:*** * *:***.**   : . * *     : * ::::   .*** :: :***

A3SJU4_ROSNI          QAIAAMTFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADKTADPH
A0A0L6CTD6_9RHOB      QGVAAMTFGLFGLPRANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADSSADPH
A4ESX9_9RHOB          QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADGAADAQ
D0CV87_RUELI          QGVAAMTYGLFGLPRANILVGPGNQFVAEAKRILYGKVGIDMIAGPTDSLILADATADPF
HPSN_RUEPO            QGVASMAFGLFGLPKAKILVGPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADRTADPH
A0A1H3NFF4_9RHOB      QGVAAMAFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADKDADPH
B6B377_9RHOB          QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADKTADAH
Q28SJ7_JANSC          QGIAAMTFGLFGLPKANILVGPGNQFVAEAKRHLFGRVGIDMIAGPTDSLILADKTADPH
U4V193_9RHOB          QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADGTADAD
B9NNL9_9RHOB          QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADKTADPM
A8LPR9_DINSH          QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRMLFGRVGIDMIAGPTDSLILADASADPM
E2CFU8_9RHOB          QGVASMAFGLFGMPPANILVGPGNQFVAEAKRILFGRVGIDMFAGPTDSLILADETADPM
A6FK01_9RHOB          QGVAAMTFGLFGLPRANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADATADAE
Q161S1_ROSDO          QGVAAMTFGLFGLPKADILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLVLADATADPF
A0A2Z2NUL7_9GAMM      QGVAAMTFGLFGLPKADILVGPGNQFVAEAKRILYGRVGIDMIAGPTDSLILADGTADPF
A0A2R8A8E0_9RHOB      QGIAAMAFGLFGLPKSDILVGPGNQFVAEAKRMLFGRVGIDMFAGPTDSLILADASADPE
A9CXT5_HOEPD          QGVASMAFGLFDVPPAGILVGPGNQFVAEAKRILFGRVGIDMFAGPTDSLILADKDADPE
A0A073J3R7_9RHOB      QGIAAMTFGLFGLPRADILAGPGNQYVAEAKRVLFGRVGIDMVAGPTDSLILADASADPH
A3JST3_9RHOB          QGVAAMAFGLFGLPSSDIIVGPGNQFVAEAKRQLFGRVGIDMIAGPTDSLILADKNADAH
Q0FFD7_9RHOB          QGVASMTYGLFDLPEADIIVGPGNQFVAEAKRQLFGRVGIDMIAGPTDSLILADADADPE
A0A0K8P5H8_IDESA      QAIASMAYGLFTGRRADVIVGPGNKFVAEAKRTLFGQVGIDVFAGPSEVAVIADETADPA
A1WFZ2_VEREI          QAIASMAYGLFTGKPADVIVGPGNKFVAGAKRALFGTVGIDVFAGPSEIAVIADDSADPA
HPSN_CUPPJ            QAIASMAYGLFTGKPADVVVGPGNKFVAEAKRSLYGQVGIDVFAGPSEVAVIADETADPA
A0A2N0GCX7_9GAMM      QGIASMAFGLFTGKPADILVGPGNRFVAEAKRQLFGRCGIDMFAGPTEIGIIGDHTADPD
S2KEX9_HALAF          QGIASMAFGLFTGKPADILVGPGNRFVAEAKRQLFGRCGIDMFAGPTEIGIIADHTADPD
D0I9Q1_GRIHO          QGIAAMAFGQFTGHPADILVGPGNQFVAEAKRQLYGRVGIDMFAGPSEIMVIADSNADPE
                      *.:*:*::* *    : ::.****::** *** *:*  ***:.***::  ::.*  **. 

A3SJU4_ROSNI          IVATDLVSQAEHGYNSPVWLVTDDRALAEDVMARVPALIDDLPEVNRDNAAAAWRDYAEV
A0A0L6CTD6_9RHOB      IVATDLVSQAEHGYNSPVWLVTDDRALAEDVMARVPGLIADLPEVNAENAAAAWRDYAEV
A4ESX9_9RHOB          IVATDLVSQAEHGYNSPVWLVTDDRALAEEVMQLVPGLIDNLPEVNRDNAAAAWRDYAEV
D0CV87_RUELI          VVATDLVSQAEHGYNSPVWLVTDDRDLANRVMELVPTLIADLPELNRDNAAAAWRDYAEV
HPSN_RUEPO            IVTTDLVSQAEHGYNSPVWLVTDDRALAEKVIEMIPSYIADLPEVNRDNAAAAWRDYAEV
A0A1H3NFF4_9RHOB      IVATDLVSQAEHGYNSPVWLVTDDRALAEDVMARVPVLIDDLPELNRDNAFAAWRDYAEV
B6B377_9RHOB          IVATDLVSQAEHGYNSPVWLVTDDRALAEKVMEMVPGLIDDLPETNRENAFAAWRDYAEV
Q28SJ7_JANSC          VVATDLVSQAEHGYNSPVWLVTDSKDLAEDVMARIPALIDDLPETNRENAAAAWRDYAEV
U4V193_9RHOB          IVAADLVGQAEHGYNSPVWLVTDDRALAEKVMDLVPGLIEDLPEVNRDNARAAWRDYAEV
B9NNL9_9RHOB          IVATDLVGQAEHGYNSPVWLVTDDRALAEEVMRLVPALIDDLPEVNRDNAAAAWRDYAEV
A8LPR9_DINSH          VVAVDLVGQAEHGYNSPVWLVTDDRALAEKVMELVPGLIDDLPDVNRENATAAWRDYAEV
E2CFU8_9RHOB          VVAADLVGQAEHGYNSPVWLVTDNRPLAEEVMRLVPELIQDLPEVNRDNAMAAWRDYAEV
A6FK01_9RHOB          VVATDLVGQAEHGYNSPVWLVTDDRALAEQVMELVPRLIDDLPEVNRDNAAAAWRDYAEV
Q161S1_ROSDO          MVATDLVSQAEHGYNSPVWLVTDSRVLAEKVMELVPGMIDDLPELNRDNAFAAWRDYAEV
A0A2Z2NUL7_9GAMM      IVATDLVSQAEHGYNSPVWLVTSDEALAEKVMQMVPDLIADLPETNRLSAEAAWRDYAEV
A0A2R8A8E0_9RHOB      IVAWDLVGQAEHGYNSPVWLVTDNRELAEKVLNRVPELIETLPETNAQNAAAAWRDYAEV
A9CXT5_HOEPD          IVAADLVGQAEHGYNSPVWLVTDDKSLAETVMALVPRLIADLPQVNRDNAEAAWRDFAEV
A0A073J3R7_9RHOB      IVATDLVSQAEHGYNSPVWLVTDDRALAQEVARRVPDLIAALPDLNRASAEAAWRDYAEI
A3JST3_9RHOB          IVATDLVSQAEHGYNSPVWLVTDSTEMAEDVMARVPALIDDLPELNRENAFAAWRDYAEV
Q0FFD7_9RHOB          IVACDLVGQAEHGYNSPVWLVTDSKELAEKVIELVPGYIESLPGTNRENATAAWRDYAEV
A0A0K8P5H8_IDESA      LVASDLVGQAEHGHESPAWLFTTSRPLAEEVMRRVPVLIEALPPTARDAAGAAWANYGEV
A1WFZ2_VEREI          IVASDLVGQAEHGQESPAWLFSTSRPLADQVLQRVPALIAQLPPTAREAAASAWRDYGEV
HPSN_CUPPJ            IVASDLVGQAEHGHESPAWLFTTSRDLADRVMALVPELIAKLPPTARDAATAAWRDYGEV
A0A2N0GCX7_9GAMM      IVAADLVGQAEHGPDSPVWLFTTSKELADEVTARMPGLIESLPETQRKAAEVAWRDYGEI
S2KEX9_HALAF          IVAADLVGQAEHGPDSPAWLFTTSRALADAVTERMPDLIGALPETQRKAADAAWRDYGEI
D0I9Q1_GRIHO          LVAVDLVGQAEHGPNSPAWLVTDSETLAQTVMKRLPELIAELPELNRQSAEAAWRDYGEV
                      :*: ***.***** :**.**.: .  :*: *   :*  *  **      *  ** ::.*:

A3SJU4_ROSNI          ILCADREEMAATSDDYAPEHLTVQAEDLDWWLDRLTCYGSLFLGEETTVSYGDKATGTNH
A0A0L6CTD6_9RHOB      ILCADREEMAATSDAYAPEHLTVQAADLDWWLGRLTCYGSLFLGEETTVAYGDKAAGTNH
A4ESX9_9RHOB          ILCTDREGMAACSDEYAPEHLTVQADNLDWWLERLTCYGSLFLGEETTVSYGDKAAGTNH
D0CV87_RUELI          ILCADREEMAACSDDYAPEHLTVQAADLDWWLDRLTCYGSLFLGEETTVSYGDKATGTNH
HPSN_RUEPO            ILCADREEMAATSDRYAPEHLTVMAEDLDWWLDRLSCYGSLFLGEESTVSYGDKAAGTNH
A0A1H3NFF4_9RHOB      IVCKDREDMAACSDEYAPEHLTVQASDIDWWLDRLTCYGSLFLGEETTVSYGDKASGTNH
B6B377_9RHOB          IICENRIDMAKCSDEYAPEHLTVQAEDLDWWLDTLSCYGSLFLGEETTVSYGDKASGTNH
Q28SJ7_JANSC          IVCADREDMAACSDEYAPEHLTVQAEDLAWWKGRLSCYGSLFLGEETTVSYGDKAAGTNH
U4V193_9RHOB          MVCDTREEMAATSDAYAPEHLTVQAQDLDWWLDRLSCYGSLFLGEETTVAFGDKASGTNH
B9NNL9_9RHOB          ILCGDREEMAACSDDYAPEHLTVQADDLEWWLDRLSCYGSLFLGEETTVAFGDKASGTNH
A8LPR9_DINSH          IVCADREEMAATSDEYAPEHLTVQAEDLDWWLERLSCYGSLFLGEETTVAFGDKASGTNH
E2CFU8_9RHOB          ILCGDREEMAATSDSYAPEHLTVQAQDLDWWLGRLSCYGSLFLGEETTVAFGDKASGTNH
A6FK01_9RHOB          ILCADREEMAATSDDYAPEHLTVQAEDLDWWLSRLSCYGSLFLGEETTVAFGDKASGTNH
Q161S1_ROSDO          IVCANREEMAACSDDYAPEHLTVQAEDLPWWLDRLQCYGSLFLGEETTVSFGDKASGTNH
A0A2Z2NUL7_9GAMM      IVCDDREEMAATSDDYAPEHLTVQAEDLPWWLERLQCYGSLFLGEETTVSFGDKASGTNH
A0A2R8A8E0_9RHOB      ILCDTREEMAATSDAYAPEHLTVQAEELDWWLNRLSCYGSLFLGEETTVAFGDKASGTNH
A9CXT5_HOEPD          ILCDSREEMARTSDDYAPEHLTVQAADLDWWLDRLSCYGSLFLGEETTVAFGDKASGTNH
A0A073J3R7_9RHOB      ILCEDREDMAACSDTYAPEHLTVQAADLDWWLERLTCYGSLFLGEETTVSYGDKATGTNH
A3JST3_9RHOB          IVCADREEMAACSDDYAPEHLTVQADDLDWWLSRLQCYGSLFLGEETTVSYGDKSAGTNH
Q0FFD7_9RHOB          IVCSDREEMAATSDDYAPEHLTVQASDLDWWLDRLTCYGSLFLGEETTVAYGDKSSGPNH
A0A0K8P5H8_IDESA      VLCSTREEIVAVSDRYASEHLEVHARDLDWWLQHLSCYGSLFLGEETTVAFGDKASGPNH
A1WFZ2_VEREI          IVCDTREEVAALSDRYASEHLEIHAAHLDWWLEHLTCYGSLFLGEEATVAFGDKASGPNH
HPSN_CUPPJ            ILCGTREEVVEISDRYASEHLEVHTADLDWWLANLTCYGSLFLGEETTVAFGDKTSGPNH
A0A2N0GCX7_9GAMM      ILCDTREEVVEVSDRYASEHLELQVEDLDWWVERLNSYGSLFVGEETTVAFGDKCSGTNH
S2KEX9_HALAF          ILCDSREEVVEVSDRYASEHLELQAKDLDWWMDHLSSYGSLFVGEEATVAFGDKCSGTNH
D0I9Q1_GRIHO          IVVDSREEAVAVSDQYASEHLEVHADDLDWWLQNLRNYGSLFLGEETNVAFGDKASGPNH
                      ::   *   .  ** **.*** : . .: **   *  *****:***:.*::*** :*.**

A3SJU4_ROSNI          VLPTSGAASYTGGLSVHKYMKIVTWQRATRTGSKPIAEATARISRLEGMEGHARAADVRL
A0A0L6CTD6_9RHOB      VLPTSGAARYTGGLSVHKYMKIVTWQRATREGAKSIAEATARISRLEGMEGHARAADVRL
A4ESX9_9RHOB          VLPTSRAASYTGGLSVHKYMKIVTWQRSTREGSKPVAEATARIARLEGMEGHARAADVRL
D0CV87_RUELI          VLPTSGAASYTGGLSVHKYMKIVTWQRATREGSKPIAEATARISRLEGMEGHARAADVRL
HPSN_RUEPO            VLPTSGAASYTGGLSVHKYMKIVTWQRGTREGYKPVAEATARIARLEGMEGHARAADVRL
A0A1H3NFF4_9RHOB      VLPTSGAAGYTGGLSVHKYMKIVTWQRATKEASKDVAIATARISRLEGMEGHARAADVRL
B6B377_9RHOB          VLPTSGAAGYTGGLSVHKYMKIVTWQRTTRDASKRVAEATARISRLEGMEGHARAADVRL
Q28SJ7_JANSC          VLPTSGAASYTGGLSVHKYMKIVTWQQATREGSKDVAIATARISRLEGMEGHARSADVRL
U4V193_9RHOB          VLPTSGAASYTGGLSVHKYMKIVTWQRATREGSKPVAEATARISRLEGMEGHARTADIRL
B9NNL9_9RHOB          VLPTSGAASYTGGLSVHKYMKIVTWQRATREGAKPVAEATARIARLEGMEGHARTADIRL
A8LPR9_DINSH          VLPTSGAANYTGGLSVHKYMKIVTWQRSTREGSKPVALATARISRLEGMEGHARTADIRL
E2CFU8_9RHOB          VLPTSGAATYTGGLSVHKFMKIVTWQRATREGAKPVAEATARISRLEGMEGHARTADIRL
A6FK01_9RHOB          VLPTSGAARYTGGLSVHKYMKIVTWQRATREGCKPVAEATARISRLEGMEGHARTADIRL
Q161S1_ROSDO          VLPTSRSAKYTGGLSVHKYMKIVTWQRSTRDGARPVAEATARISRLEGMEGHARAADARL
A0A2Z2NUL7_9GAMM      VLPTSRSAKYTGGLSVHKYMKVVTWQQATRDGSKSVAGATARISRLEGMEGHARSADVRL
A0A2R8A8E0_9RHOB      VLPTSGAAKYTGGLSVHKYMKLVTWQRATREGSKSVAEATARISRLEGMEGHARTADIRL
A9CXT5_HOEPD          VLPTSGAARYTGGLSVHKFMKIVTWQRATRDGSRPIAEATARISRLEGMEGHARTADIRL
A0A073J3R7_9RHOB      VLPTSGAAKYTGGLSVHKYMKVVTWQRATRAGSKSVALATARISRTEGMEGHARSADVRL
A3JST3_9RHOB          VLPTSGSARYTGGLSVHKYMKVVTWQRSTPEGSKRVAEACARISRLEGMEGHARSADVRL
Q0FFD7_9RHOB          VLPTSRSARYTGGLSVHKYMKVVTYQRSTREGAKRVAESCARISRLEGMEGHARTADIRL
A0A0K8P5H8_IDESA      VLPTKGAARYSGGLSVHKFMKTLTWQRMSREAARDIAEVTARISRLEGMEAHARTADDRL
A1WFZ2_VEREI          VLPTKGAARYSGGLSVHKFMKTLTWQRMTRAGARDIGAVTARIARLEGMEAHARTADDRL
HPSN_CUPPJ            VLPTKGAARYSGGLSVHKFMKTLTWQQMTREATRQIGQVTARISRLEGMEAHARTADDRM
A0A2N0GCX7_9GAMM      ILPTKGAARYTGGLSAQKFLKIVSYQRQSREATRSVAAATARLSRCEGMEGHARTGDVRL
S2KEX9_HALAF          ILPTKGAARYTGGLCAQKFLKIVTYQRQSREATRGVASAAARLSRCEGMEGHARTGDARL
D0I9Q1_GRIHO          ILPTKGAAKYTGGLSAGKFIKVVTYQRSTQDASKDVAQVTARISRLEGMEAHAKTGDARL
                      :***. :* *:***.. *::* :::*: :  . : :.   **::* ****.**::.* *:

A3SJU4_ROSNI          AKYFPDETFDLTAHG---
A0A0L6CTD6_9RHOB      AKYFPDETFDLTANG---
A4ESX9_9RHOB          AKYFPDETFDLTANG---
D0CV87_RUELI          AKYFPDEKFDLTADG---
HPSN_RUEPO            AKYFPDETFDLTANG---
A0A1H3NFF4_9RHOB      AKYFPGENFDLTSEG---
B6B377_9RHOB          AKYFPGENFDLSAEG---
Q28SJ7_JANSC          AKYFPGENFDLSADG---
U4V193_9RHOB          RKYFPNENFDLTAAEDI-
B9NNL9_9RHOB          QKYFPGENFDLTADG---
A8LPR9_DINSH          RKYFPDQEFDLTGND---
E2CFU8_9RHOB          KKYFPDETFDLTAGA---
A6FK01_9RHOB          RKYFPGQNFDLSANG---
Q161S1_ROSDO          HKYFPNENFDLSAVD---
A0A2Z2NUL7_9GAMM      KKYFPDETFDLSL-----
A0A2R8A8E0_9RHOB      AKYFPGENFDLSGAE---
A9CXT5_HOEPD          RKYFPLDNFDLSGVDQDI
A0A073J3R7_9RHOB      AKYFPGEVFDLAAQT---
A3JST3_9RHOB          AKYFPNENFDLSAD----
Q0FFD7_9RHOB          AKYFPGENFDLTPEG---
A0A0K8P5H8_IDESA      AKYCPGQAFELGEPVQV-
A1WFZ2_VEREI          AKYFPGTAFELGAPVST-
HPSN_CUPPJ            AKYFPNASFEMGTPVEV-
A0A2N0GCX7_9GAMM      AKYYPDETFDLVIHEEV-
S2KEX9_HALAF          AKYYPDETFELVITEEV-
D0I9Q1_GRIHO          AKYFPDEQFNLQPE----
                       ** *   *::