CLUSTAL format seed alignment for MF_02231

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBIT_ECOLI            ----------------------------------------------MLDKLRSRIVHLGP
A9MPN5_SALAR          ------------------------------------------------------------
E3G0Z6_ENTLS          ----------------------------------------------MLDKLRSRLVQLGP
W1HP54_KLEPN          ----------------------------------------------MLDKLRSRLVHFGP
I2B4V4_SHIBC          ----------------------------------------------MLDKLRSRLVRLGP
H2ISZ0_RAHAC          ----------------------------------------------MLQKLRARMVRQGP
C5BFC9_EDWI9          ----------------------------------------------MLEQLRARIVRQGP
Q2NW15_SODGM          ----------------------------------------------MWDKLRAQLVRRGP
A0A0L7T7J5_9GAMM      ----------------------------------------------MLNQLRVQCVENGP
R8AMK9_PLESH          ----------------------------------------------MLTQLQARLVKEAP
B7VJG6_VIBA3          --------------------------------MMLSILLTKLRISHVINKIRTQLVQNAA
U3BD49_VIBPR          ----------------------------------------------MINKIRTQLVQNAA
Q87M13_VIBPA          --------------------------------------------MNVLNKIRSQLVKNAA
Q9KU69_VIBCH          ----------------------------------------------MLNKIRTQLVQNAA
Q6LUI3_PHOPR          ----------------------------------------------MITQLRKHIVQHGP
C4L7K5_TOLAT          ---------------------------------------------MLLKNLHHKLVMQMP
Q483B2_COLP3          ----------------------------------------------------------MP
A1SWF4_PSYIN          ------------------------------------------------------------
D4ZB14_SHEVD          ------------------------------------------MQLPLSGNIAKQFLNLAP
A8H6Z8_SHEPA          ------------------------------------------MQGFFPHKLAHKVLEIGP
Q086E7_SHEFN          ------------------------------------------MAQAFTQQLSAHLLHFAP
R4YS84_OLEAN          --------------------MRLKKLMPKKALLINAKLARFIKNSPLLKKSQQKAVKHST
Q5QWL0_IDILO          -------------------------------------------------MNTTNWVSYIP
D1KB62_9GAMM          --------------------------------------------------MSVVSKPFNG
C7RCX1_KANKD          ----------------------------MFMAESAGVLKFPFADHLKSALLPKFASLLAP
Q0A6R1_ALKEH          ------------------------------------------------MTHLP--TPPGA
A1WVU6_HALHL          ------------------------------------------------MKRPQ--FDQAL
G8PWN8_PSEF3          ------------------------------------------------MLSPKKWVLKGA
C5BJ06_TERTT          --------------------------------------MPFSSQARRLLLANRPLAVRGA
E1STJ7_FERBD          ------------------------------------------------MLPRP-------
M1FLK7_9ALTE          ------MALHMPTFLPRPTLPAFRSLPGVSRAQALSQKLATNPLLTDSLALLNEYLPAPS
A3JBV8_9ALTE          ------MALHMPTFLPRPSLTAFHTLPGMSRVQATSQKLIANPLMTDSLALLNEYLPSPS
A1U595_MARHV          -----------------------------------------------------------M
E1V7H4_HALED          ----------------------------------------------MALPL-----PSPL
K0CG81_ALCDB          ----------------------------------------------MRFPFTPSGPPSPL
A0A2D9TUG4_9GAMM      ----------------------------------------MPAKGPFSPTFPLQTFRAVH
Q2SJY3_HAHCH          MRCAGDLMEIKMLLVMSLFNNGYLTLRQGRPKFMLKSPLQLSRELAAALPPLTDVVRRPG
A0A0F5AV16_9GAMM      -------------------------------------------------MPQPNLIT-PG
D3RT19_ALLVD          --------------------------------------------------MSAT--QRFL
W0E2R6_MARPU          --------------------------------------------------MSSVLPPRLL
S6BAC1_9GAMM          ------------------------------------------------------------
K4L1X9_SIMAS          -------------------------------------------------MLAVSFMQSGL
A0A1E9M1V5_9NEIS      --------------------------------------------------MALPEIILPK
D2ZVE5_NEIMU          --------------------------------------------------MALPEIVLPA
D4DM76_NEIEG          --------------------------------------------------MPLPDITLPQ
G2J058_PSEUL          --------------------------------------------------MRVPELTVPT
C1DBA2_LARHH          --------------------------------------------------MNIPDFTVPA
G8QJ01_AZOOP          -----------------------------------------------MSHFTIPTFKLPE
D5CMY5_SIDLE          --------------------------------------------------MNIPNFKLPA
Q47JW5_DECAR          ----------------------------------------------MTGNFTIPKFKLPD
C5T5T9_ACIDE          -----------------------------------------------MVASPSDLLVVPP
F4GD36_ALIDK          -----------------------------------------------MNATPPAPFTLPR
Q223A9_RHOFT          -----------------------------------------------MSAKP---LLIPT
Q63SG3_BURPS          -----------------------------------------------MNAPV---FQLPP
C4ZIX4_THASP          -------------------MPALPALPRPPLPSHLLPGSLRQRIGERLATLRIPDFTVPA
Q3SGV7_THIDA          ----------------------------------------------------MLNLAVPP
Q7WX87_CUPNH          ------------------------------------------------------MSVLQT
Q0JYR4_CUPNH          ------------------------------------------------------MSALHK
F8GXS6_CUPNN          ------------------------------------------------------MSVLFP
Q1LDH6_CUPMC          ------------------------------------------------------MTMLTG
B2UJJ6_RALPJ          -----------------------------------------------------MMLRPPA
Q8XR91_RALSO          --------------------------------------------------MKPFRPRPPA
B2U6W3_RALPJ          ----------------------------------------------------MTRLRPPE
A9ITK5_BORPD          ------------------------------------------------------MNRLTA
A0A1U9JIX4_9NEIS      -----------------------------------------------------------M
I0HL44_RUBGI          -------------------------------------MSTKSHAFVAPRSLAELHALAAA
B1Y7Z8_LEPCP          -------------------------------MNPHDTVRTEAVSPFDPATWPAPLARAAE
C5AJM9_BURGB          -------------------------------------------------MTRFAGAFLLP
G4E6P8_9GAMM          ------------------------------------------------MACLVSPKLLLK
A0A1B4VCW1_9GAMM      --------------------------------------------------------MLPD
F2GAN1_ALTMD          ---------------------MNKTTPFDMLWHKLNSQSCSNPLICIAKKRLQNQLLALP
Z5XMH6_9GAMM          ------------------------------------------MISLTDIMKHKTPPFFTP
B7J8F6_ACIF2          -------------------------MGKGRTVLRSQRYSPLAIMLGFPQKHMTKTFLEHG
A0LDD5_MAGMM          --------------------------------------------------------MFVK
                                                                                  

UBIT_ECOLI            SLLSVPVKLTPFALKRQVLEQVLSWQFRQALDDGELEFLEG--RWLSIHVRDIDLQWFTS
A9MPN5_SALAR          --MSVPVKLTPFALKRQVLEQVLSWQFRQALADGELEFLEG--CWLSIHVRDIGLKWYTT
E3G0Z6_ENTLS          TLMSVPVKMTPFALKRQVLEQVLSWQFRQALADGELDFLEG--RWLSIEVRDIGLRWFTS
W1HP54_KLEPN          SLMSVPVKLAPFALKRQVLEQVLSWQFRQALAEGELEFLEG--RWLSIHVRDIGLLWYSS
I2B4V4_SHIBC          SLIKTPVRLAPFALKRQVLEQVLGWQFRQALEDGDLDFLEG--RWLSIAVRDIGLEWFTS
H2ISZ0_RAHAC          SLLSVPLKFTPFALQRQVLQQVLSWQLRQALADGELDFLEG--RWLKIDVSDLNLNWLMS
C5BFC9_EDWI9          AFLSLPLKVTPFVLQRHVLEQLLSWQFRQALAEGDLAFLDG--RWLQVDVCDLGLRWFVT
Q2NW15_SODGM          SLLRLPIKLTPFAVRRQVLEQVLHWQFRSALAEGELDFLEG--RWLQIEVVDLGI-----
A0A0L7T7J5_9GAMM      KLLRFPLQFAPFAVKKRLFQQLLNWQFAHALAEGELDFLQG--RWLGIEIRDLDLRWATS
R8AMK9_PLESH          RFLRMPLQWVPFGVQKQALEQLLGWMFRQAMEDGELDFLQH--RWLQVEVPDLNLSWFVS
B7VJG6_VIBA3          SILRSPVQLLPKSVQKKALLEALKNVFKEALEDGDFEFLED--KWLKVSIKDMGLSWCIS
U3BD49_VIBPR          SILRSPVHLLPPIVQKKALLEGLKTVFKESLEEGDFDFLED--KWLKVEIKDMLLCWYVS
Q87M13_VIBPA          NILRSPVQLLPQTVQQKALLEGLKMVFKEALEDGDFEFLED--KWLKVAIKDLNLAWYIS
Q9KU69_VIBCH          SILRSPIHLLPQNVQKKALLDAMGLVFREALQDGDFEFLED--KWLKVEVKDMELRWFIS
Q6LUI3_PHOPR          ALLRVPAKLTPFTVQKKMMLEGLTLVFKEALEDGDFEFLDG--RWLKVEVRDLELHWYIS
C4L7K5_TOLAT          QLLRLPVSLIPFSAKKSVMVFILQRIFKEALTDGDFDFLEE--RFLKVSVDDLQLSCFIT
Q483B2_COLP3          KILQPSLRFVPFSAQKSVLIPALHSIFSEAITDGDFEFLQD--KWLKISILDLQLNWWLS
A1SWF4_PSYIN          -------MHLSFFMQKKLLLELLDRLLSE---DNELDSLHH--KWLKIEVTDLKFSCYLS
D4ZB14_SHEVD          KLLRQPLALVPFKLKADVLVRLLGLMLKQQGEDEELDFLAG--RWVAINVEDMGLEFEVS
A8H6Z8_SHEPA          KVIAGPLAIVPFTLKAELLKRILGLLLAEQAADEELDFLDG--RWVAIKIEDLGLTFEVT
Q086E7_SHEFN          QVSRRSLNLMPEALKIIVINKLLNLVLAEQLKADELHFLKQ--KWVGICVDDIGLRFEVG
R4YS84_OLEAN          ALLAIAHKIMPTKVENYFVLHQVKRLSQPFMDEGEIDFLDN--KIVEVEIRDLSAKWYFT
Q5QWL0_IDILO          NIIRPINKLIPSKFINFGSEKLLNLLFKEEISSGELNFISG--NIIEIKVKDIDLSLFLT
D1KB62_9GAMM          LLLQSPFALIPKNISNKIIVMVFNQIFAQSIKDGDLGFLKG--NWVLIEVTDISLSFSLG
C7RCX1_KANKD          NNVGSCVGWVPQRVNRKVIESVLNRVLQEQVADGDFDYLTG--KWLQVEIRDARLFVTLG
Q0A6R1_ALKEH          RFLKRRL--------DRVLVGLINQALADPLADGVFDFLEA--RCLEVRLRDWGLALPLS
A1WVU6_HALHL          PLLLTPLRFVPGPVNAAVVPALLQQVLADALADGELEILVD--RTLALEVTDARLAYGFT
G8PWN8_PSEF3          DRLLPLVGKVPFVVQRLALQQALNRCLAEPLRDGGFDVLHG--RWLCLRVPDLKLCWYLT
C5BJ06_TERTT          SVLLALT---PFSLQERALLPLFRQALAVPLNDGDLNFLDA--RVLRIQVDDLRWRLCLS
E1STJ7_FERBD          --PLGPI--------RALLLPLLNQRLAAPLRDGELDFLEG--RSVSIAVRELPLPIKLG
M1FLK7_9ALTE          PLLAAIDQRIPLALKQLVVEAPLNRLFAEAIADGEFDDFEG--RRIRLELNGGQPSVTFG
A3JBV8_9ALTE          PLLATIDHHIPLVLKQLIIEAPLNGLFAEAIADGEFDDFEG--HRIRLELNGGQPGVTFG
A1U595_MARHV          PLLNGIDQRIPLPLKQLAAEAPLNRLFSDAIAEGEFNDFEG--RRIRLEINGGQPGITLG
E1V7H4_HALED          LLLRALDQTAPLAVKRRLVEPLLNRTFAEPLAEGEFDALEG--RRISLMVEDLDLMLTLG
K0CG81_ALCDB          AVFRHIDAHAPLPLKRPFLEPLMNRLLAEPLAAGEFEPLQG--RHLTLDLADGAPRFTVT
A0A2D9TUG4_9GAMM      PFFKRQLHHAPFSLIQPIMERIMRDAFAEALATGELDCLIG--RWLEIEITDIPLNWFVT
Q2SJY3_HAHCH          RYLLQPLTRTPFALQAALLRKLLKDSYGEAIREGDFDSLVN--RWIKITVVDLDASWSIS
A0A0F5AV16_9GAMM      ---LKAITQLPQGLQAQVLTKVMNAAFAVPLAEDEFDFLAG--RTIRIGLRDLNANWFVS
D3RT19_ALLVD          YPLTFPLRLVPGTLHSRALAGILNQVMKESLAEGELDFLEG--RRMAIEIDDVGLRYRLG
W0E2R6_MARPU          RPLSLPLRLMPTTFHSRALARILNQVMKEAIADGELDFLEG--RQVAIEIADMGVRYRLG
S6BAC1_9GAMM          -------------MHARGLALVVNRLFADALDAGELDFLEG--KVLHVEVEDVGLHYRLV
K4L1X9_SIMAS          KIGRQMGRHLPSWPQQWVLCLCLNRLLRAERHAGDFDFLAG--KTLSIDVEDFSLTYCIT
A0A1E9M1V5_9NEIS      WMAKIGTKLPGKPPRFVLVSVLNTMLKKGLLPAD-MELFAG--RKFEIEVLDAGIKVRFS
D2ZVE5_NEIMU          WAGKIGGKLPGKPPRFALVFALNTMLKRGLLPAN-MSLFDG--KKFEIDVLDAGIKVRFT
D4DM76_NEIEG          WCAQIGRRLPALPPRFALVKTLNLMLKRGLLPAD-MSLFDS--RTFEIDVLDAGITVRFT
G2J058_PSEUL          RLARLLGRLPATPPAWLLVTSLNQLVKRGVLPAD-MELLAE--RRFEVRLVDAGVSLRFA
C1DBA2_LARHH          PLAGLHRMLPKRPPSMALAAALNLAAGRGVLPVDTVALLEG--RSFVVEATDAAISACFT
G8QJ01_AZOOP          FVAKIGARLPQWPHALALVSGLNTAAKLKLLPEDSLQSLAG--KTFLVAVNDTGGEARFT
D5CMY5_SIDLE          LVARIGHRLPQWPHALTLVAGLNAAAKMKLLPLDSLELLEG--RSFLVEVLDTGGRASFT
Q47JW5_DECAR          FVANLGQKLPQWPHALVLVGGLNAALKMKLLPESELALLED--KLFRVRVLDTGGEASYT
C5T5T9_ACIDE          PVGALLSRLPAYPGSLLLVTALNLALARH-LPADVGQLLLH--KKMRVQVRDARLVFDFG
F4GD36_ALIDK          PVGAVLARLPAYPGSMLLVAAINFALARQ-LPQDVKDILQG--KRLAIRVRDARLGFDFS
Q223A9_RHOFT          PLGAMLGRLPAYPGSLFFVTGLNLALSKQ-LAPDVTQMLLG--KKLRLRVTDAHWAFDFE
Q63SG3_BURPS          TLGKLLSKLPAYPGALLFASGINLVLRRH-LPAETLALLED--RPLRIQVKDAGVAFDFV
C4ZIX4_THASP          PVAKLVSRLPQQPPTHVLTLALNLALDRI-LPRDTLEPLSG--RHLQMRVLDAGLTLDFT
Q3SGV7_THIDA          QLAKVVARLPPAPPSIAFSAAANRLLWPA-LQAFDWQPLVG--RRYAIRVNDLGLTLRFT
Q7WX87_CUPNH          LMAGVHRRMPARACALPLVAALEIARRAGWLEPP--AALDG--HSFLLTVEDLGLDVPFR
Q0JYR4_CUPNH          LIAGVHRRMPARARALPLVAALELARRAGWLEPP--AALDG--HAFLLTVQDLGLAVPFR
F8GXS6_CUPNN          LLARAHRRLPAPQHALPLVGALEAARRADWLTPP--AALDG--HGFLLCVEDLALTVHFR
Q1LDH6_CUPMC          LMSRVHRHMPAPARALPFVLAVEAMRRSGWLEPP--AALNG--HTFRLTVEDIGLEVRFR
B2UJJ6_RALPJ          TLVRMARRLPTPLTSLPFVLGLDLARRLSWLTPP--PELEG--RRFAITVEDLGLRACFC
Q8XR91_RALSO          ALVRLARRLPVPLTSFPFVLGLDVARRLAWLTPP--PELEG--RRFALTVEDLGLRACFC
B2U6W3_RALPJ          VFVRMARSLPVPLTSFPFVMGLDLARRLSWLTPP--PELDG--RRFAITVEDLGLRACFC
A9ITK5_BORPD          MLSRLDRLLPAPLVSAHFALGLEIARHFKWLQPP--AEIEG--KRFAIKIEDLGLRSCFT
A0A1U9JIX4_9NEIS      SVATFGAIVPPVLLSPPLCAVLELARLGRWLQPP--AELEG--RSVALTLTDLGLRHGLC
I0HL44_RUBGI          KVKPLVQRLPMQPPSMVLALAMNKLLLPRLPADA-KAALSG--RSVEVAVTDLGLAMKLQ
B1Y7Z8_LEPCP          HARQVVRRLPVQPPSFVAARLLDRLLWPKLDAGQ-RSALAG--RVVEVELMESGVRVRLM
C5AJM9_BURGB          PLRRGLALLPVRPPATVLCLLLDRHLLPQLDDEA-RTRIAG--RRYVIEVTDLGIAIGLT
G4E6P8_9GAMM          PGALALRTFPDSFHRQIFTQMLNFMFKGQIVTEQ-LHEIDG--KRLCLDITDTRSQIHMR
A0A1B4VCW1_9GAMM      PLTLWLRAVPDRAHTAVLAAIFTHLLRGQPLRAR-LAELAG--KRVRLEITDGGSVLDFE
F2GAN1_ALTMD          KDITKAFTRLPSSFQSWVAQTTFSNLLAEQLTDESLRFLEG--HWLAIIVSDVPYQFFIS
Z5XMH6_9GAMM          KWLTAITHLTPTAGISWLIEQRINLIFKTQINDGELDFLID--KQLCIDVDNLPLSLLIS
B7J8F6_ACIF2          RTLKRPFIAATTILMDPVFMAIFMGLANRVLARYQADFLQMEGRRIVVEVSDLGKSLRLV
A0LDD5_MAGMM          QFAAPLALLPQPFTAVGLGVTLNLFFMRYPELKARLQELAG--KLFHFAVEDLGQDYYML
                                                            :        .            

UBIT_ECOLI            -------VVNGKLVVSQ----N-------------AQADVSFSADASDLLMIAARKQDPD
A9MPN5_SALAR          -------VENEKLIVSQ----Q-------------ADADVSFSADASDLLMIAARKQDPD
E3G0Z6_ENTLS          -------VDHDKLVVSQ----S-------------AEADVSFSADASDLLMIAARKQDPD
W1HP54_KLEPN          -------VVDGRLVVSQ----Q-------------ADADVSFSADASDLLMIAARKQDPD
I2B4V4_SHIBC          -------VQEGRLVVRE----Q-------------AQADVSFRADANDLLLIAARKQDPD
H2ISZ0_RAHAC          -------VDEGKLVIAE----H-------------GEADVSFSGTANDLILIAARKEDPD
C5BFC9_EDWI9          -------VQQGMLRVSR----H-------------QQADVSFSADANDLILIAASKEDPD
Q2NW15_SODGM          -----------------------------------------FSSQANDLLLIAAGREDPD
A0A0L7T7J5_9GAMM      -------VVDGQLQVSD----V-------------QQIDVWFRGDANDLLLVAARKRDPD
R8AMK9_PLESH          -------VLNAQLVVAK----Q-------------AQPDVIFRGNTNELILIAARVEDPD
B7VJG6_VIBA3          -------YKNEQLVVAD---KE-------------VSEDVSFSGNLNDLVLIAGRKEDPD
U3BD49_VIBPR          -------YQNERLMVAD---GA-------------VEHDVSFSANLNDLVLIAGRKEDPD
Q87M13_VIBPA          -------YQDEKLVVAE---KP-------------VQEDVSFSGNLNDLVLIAGRKEDPD
Q9KU69_VIBCH          -------YQNDKLVVAD---KP-------------VAEDVSFSGNLNDLVLIAGRKEDPD
Q6LUI3_PHOPR          -------YQDDKLVVSE---HI-------------EQEDVSFSGECNDLVLIAARKEDPD
C4L7K5_TOLAT          -------LQQGQLRVLE---QN-------------DTCDVSFAAGLNDLILIAGRKEDPD
Q483B2_COLP3          -------FDQDQLIMASP-KDN-------------IAEDVSFSANGDDLVLIAGRKQDPD
A1SWF4_PSYIN          -------FAEQKFVIKQ---QC-------------KKRDVIFSGALNQFILIAGRKEDPD
D4ZB14_SHEVD          --------YDSRWLVRP----R-------------NDAQVVFSGNSKELLLVAAGKEDPD
A8H6Z8_SHEPA          --------YTDTWQVRQ----L-------------QEAEVTFTAQSKDLLLIAAAKEDPD
Q086E7_SHEFN          --------VEQQLRVRA----F-------------TQPDVTLSANVPELILVAAGKEDPD
R4YS84_OLEAN          KIGRQLAMLDKTKALAV----N-------------PEPDVVFSASVDALVLMASQKVDPD
Q5QWL0_IDILO          -------LKVNQLKSL---KSP-------------VEPDVKLSADGDALLLLIYGKVDPD
D1KB62_9GAMM          -------LKSGQLIHN---QNR-------------QVTSLRISAKACDFLDMVCRKKDPD
C7RCX1_KANKD          -------FRNGQFVCREVVRQA-------------SEANANLSVMTVDAIDMVQHKVDPD
Q0A6R1_ALKEH          WR-------DGRLVAAHG-----------------CEPEASIRGDLGAFLLMAGECADPD
A1WVU6_HALHL          LR-------DGRLATADP-----------------AGADVTIRGDAAAFLALAGGAADPD
G8PWN8_PSEF3          LA-------RDGLRIAER-----------------AEAQVTISGNWREFLLLASRQEDPD
C5BJ06_TERTT          LV-------NGRLVMAPPD----------------NEYAVCIRADSADFLALINRVDDPD
E1STJ7_FERBD          LS-------EGRLWLDWAD----------------ASVDARLSGDARALLQMALGSADGD
M1FLK7_9ALTE          FW-------TGRLRIVDGP------------------GETTIRGSLSAFKTLAERNHDPD
A3JBV8_9ALTE          FW-------AGRLRIVDGP------------------GEATIRGSLSAFKTLAEQNQDPD
A1U595_MARHV          YW-------AGRLRVLNGP------------------GEATIRGSVGAFRTLAERKQDPD
E1V7H4_HALED          LE-------AGRLVLCREA------------------GEATIRGGWREFLCLATRHEDPD
K0CG81_ALCDB          LQ-------ANRLRLSERP------------------GEACIRGGWREFLQLLGREQDPD
A0A2D9TUG4_9GAMM      MG-------KHYPVLVKTP----------------MNSDASIRGTLKAFIQLANNELDPD
Q2SJY3_HAHCH          LG-------ADRSIRVAQT----------------ETADTEIRGDSAAFALIAGRKMDPD
A0A0F5AV16_9GAMM      LN-------EDNQLLVRLS----------------GEEDASIEGDWLAFLKMATHYCDPD
D3RT19_ALLVD          LE-------NGRIRGYGDD----------------RPADASIAGGLHEFLLLAARREDAD
W0E2R6_MARPU          FE-------NGRIQGYGEQ----------------RPADASIAGDTREFMMLAARQEDAD
S6BAC1_9GAMM          MR-------GGRFAAAAAE----------------APVDVGFRGELQTFLQLAARREDAD
K4L1X9_SIMAS          LN-------QRRFVPGT------------------ARADATIAAELTDLLKIIIGEADPD
A0A1E9M1V5_9NEIS      AD-------TEKFLDDNFS-GT---------------PDLRLAANGIDFMRMMMREEDPD
D2ZVE5_NEIMU          AN-------AEKFIDADFF-GT---------------PDLRLAANGIDFMRMMMREEDPD
D4DM76_NEIEG          AD-------GERFLDRRFE-GT---------------PDLRLAANGVDFLRMMLREEDPD
G2J058_PSEUL          AD-------SRRFLLDRQP-GE---------------PDLRLSANVADFARMMLREEDPD
C1DBA2_LARHH          VH-------NGSFSAIDRP-ET---------------PDLYFGAKACDFARLALREEDPD
G8QJ01_AZOOP          YA-------NGWFRPVFGAAGE---------------PDLTFRADLSAYLQLVSRQEDPD
D5CMY5_SIDLE          YR-------DGLFRPQFSAPAS---------------PDLCFRANLSAFLQMLARQEDPD
Q47JW5_DECAR          YR-------DGLFRPVFRPERE---------------PDLAFAANLSAYLQLLARQEDPD
C5T5T9_ACIDE          WT-------GQRFAPHAPLVAPA-------------TADLTLSATAHDFLLLAQRQEDPD
F4GD36_ALIDK          WN-------GQRFAPSAPQANP----------------DLAISANAQDFLLLAQRRQDPD
Q223A9_RHOFT          WR-------NKHFAACQNVGEA----------------DLTISASAHDFVLLARRQEDPD
Q63SG3_BURPS          CR-------RGAFSALSGGRDV----------------DLTIGATAYDFYLLSQRREDPD
C4ZIX4_THASP          LG-------ERGFRRATPAAGA--------------RPDLILSATTRDFMALALREEDPD
Q3SGV7_THIDA          VS-------ARGF----AADSG--------------TPDLTISASARDFLLLLGRREDPD
Q7WX87_CUPNH          CE-------GGRFHTGRSDGSA---------------PALTLRARAVDYLRLLGGEADTD
Q0JYR4_CUPNH          CE-------GGRFRAAAAD-AE---------------AELTLRACAVDYLRLLGGEADTD
F8GXS6_CUPNN          CA-------DGGFYIGPFNGTA---------------PALTLCARAGDYLRLLAGEADTD
Q1LDH6_CUPMC          CV-------DGRFAPGPFDGSA---------------SDLTLRAKVADYLRLISGDADTD
B2UJJ6_RALPJ          CR-------GGAFHLLSGQ--V---------------PELELHAGVAEFVALIRGTADAD
Q8XR91_RALSO          CR-------GGAFHLLSDG--Q---------------PELELTAGVADFVALIRGAADAD
B2U6W3_RALPJ          CR-------GGAFHMFSASSSE---------------PELELRAGMGDFVALIRGTADAD
A9ITK5_BORPD          CR-------QGRFRPLWAS--E---------------VDLELGASLGDFAALARGTSDAD
A0A1U9JIX4_9NEIS      CR-------QGRFRPHGVA--D---------------AELSLSASLADVLQLLAGQVDAD
I0HL44_RUBGI          LG-------ERGFVLAPQ----------------SKPVALRIAAALPDYLRLLRGEDDAD
B1Y7Z8_LEPCP          LG-------ERGFSVAGG----------------AAEPAVRIRARTDALWRLVRGQDDAD
C5AJM9_BURGB          LG-------DDGFRVASDIPGTASATGRAANPAAGTAPAIRIAAGSGDFIRLAAREVDAD
G4E6P8_9GAMM          IQ-------GQHLRPYTPLHPRD--------------WEVCIRGDLEGFWRLATRAEDPD
A0A1B4VCW1_9GAMM      IT-------PVGLRAAAGAEPH-----------------VRIRGRVEDFLALALRREDPD
F2GAN1_ALTMD          VRDVEHSGLRKQSILVKSQIEQ--------------EPDVTFSGDIDSLVSIAVREQDPD
Z5XMH6_9GAMM          LN-----ATSKRLTIFSIKPWLL--------PKEHLKYDGKLTGSSDTFLSLMSGKYDPD
B7J8F6_ACIF2          IR-------QGRIAPTRAG-----------------PVDLRIAGNAKDLCRLALRLEDPD
A0LDD5_MAGMM          VE------QDGHVRIHTYSDAP---------------VNVTMSGSAEAFLQLLFNVEDPD
                                                               :         :     * *

UBIT_ECOLI            TLFFQRRLVIEGDTELGLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQ-
A9MPN5_SALAR          TLFFQRRLVIEGDTELGLYVKNLMDAIELEQMPKALRVMLLQLADFVEAGMKNSPQTKQ-
E3G0Z6_ENTLS          TLFFQRRLVIEGDTELGLYVKNLMDAIELEQMPKALRVMLLQLADFVEAGMKTPSQTRH-
W1HP54_KLEPN          TLFFQRRLVIEGDTELGLYVKKFDGRH---------------------------------
I2B4V4_SHIBC          TLFFQRRLVIEGDTELGLYVKNLMDAIELDAMPKPLRVLLLQLAEFVEAGLKSESATRE-
H2ISZ0_RAHAC          TLFFQRRLRIEGDTELGLYVKNLMDSIDLDTMPLLLKNGLLRLADFVEAGLQ-EDRGSK-
C5BFC9_EDWI9          TLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGTPIDA-
Q2NW15_SODGM          TLFFQPRLRIEGDTQLGLWVKNLLD-----------------------AGLKEDTIAADG
A0A0L7T7J5_9GAMM      TLFFQRRLVIEGDTELGLEVKNLMDAIELEMMPTPLRIGLMQLAQFIEAGLTKDANSPE-
R8AMK9_PLESH          TLFFQRRLTIEGDTELGLYVKNLLDALDMEQMPKPLQALLQQLAQFIQKGLAAQPAANT-
B7VJG6_VIBA3          TLFFQRRLSIEGDTELGLEVKNLMDSVDLDLLPTPMKTLLNQLADFVQKGVQSPDTQSEV
U3BD49_VIBPR          TLFFQRRLSIEGDTELGLEVKNLMDSVDLDLLPRTLQILLEQLADFVQKGLQSPITQNEV
Q87M13_VIBPA          TLFFQRRLSIEGDTELGLEVKNLMDSVDLEQLPKAMQVALNQLADFVQKGVQEPAQQPGV
Q9KU69_VIBCH          TLFFQRRLSIEGDTELGLEVKNLMDSVDLQQLPKALQILLHQLADFVHKGMQTPNSSHEV
Q6LUI3_PHOPR          TLFFQRRLRIEGDTELGLEVKNLMDSIDLDSLPSPLKFLLQQSADFIQKGMQDASAEKEV
C4L7K5_TOLAT          SLFFQRRLRIEGDTELGLEVKNLIDSLDLDELPKIIRLALNDLALFVQRGIQIPEIAGER
Q483B2_COLP3          TLFFQRRLKIEGDTELGLEVKNLIDAIDIEQLPSSIHDLVDFSACFLQNTHDELAVANG-
A1SWF4_PSYIN          TLFFQRRLVIEGDTELDLEIKNLLDNIYFENLSPFIEKSLNHFATFVQRGLIPLGGKGVT
D4ZB14_SHEVD          TLFFQRKLSIEGDTELGLEVKNLLLSVEFDTLPFPIRQSIEKMAQVICQLQLKAEPELA-
A8H6Z8_SHEPA          TLFFQRKLCIEGDTELGLEVKNLLLSVEFDAMPAAIRVAIEKLAQALQALQAKAEPALV-
Q086E7_SHEFN          TLFFQRKLRIEGDTELGLEVKNLLLSIELDSLPKPARIGIEQLAKVLQTLTASE------
R4YS84_OLEAN          TLFFSRKLKITGDTELGLEIKNLFDQFDLELLDKPFRNALDTWSDELIAAQAH-------
Q5QWL0_IDILO          TLFFNRKLMVKGNTELGLHLKNFLDTIEVNQKLPRTLYLIGDRFSDFIYKEKGETIQTS-
D1KB62_9GAMM          TLFFQRKIKMQGSTELGLYVKNFLDAFDVESHWASFRADQALQNSYPLLKNLFCNNH---
C7RCX1_KANKD          TLFFQRKLTIGGDTELAHHVKNTLDTLDPEA-IPKLVLILLQHYQAIISRPAI-------
Q0A6R1_ALKEH          TLFFQRRLSIQGDTELGLMAKNALDQLDPEAL----------PPRFRRPLLRLAGLVAEG
A1WVU6_HALHL          MLFFRRRLSVEGDVALGLSVKNLLESYEPRH-------------RLPGPLCRALEAAAAR
G8PWN8_PSEF3          TLFFRRRLVIEGDTELGLALKNLIDSLDPDV--------------LPPWLWRNLERAGKG
C5BJ06_TERTT          TLFFQRRLAIEGDTELGLAVKNLLDALDYDD--------------FPRWLAQGLALLRHA
E1STJ7_FERBD          ALFFQRRLAMEGDTELAMELKSLLGRYPLLP--------------APPFSLPGLGTV---
M1FLK7_9ALTE          QLFFQRRLVIEGDTELGLALKNLLDSLE-----------------WHIRISG--------
A3JBV8_9ALTE          QLFFQRRIVIEGDTELGLALKNLLDSLE-----------------WKLNIRQLLFF----
A1U595_MARHV          QLFFQRRLVIEGDTELGLALKNLLDSLD-----------------WHLRLRDFLKPW---
E1V7H4_HALED          ALFFQRRLLIGGDTELGLTAKNLLDGREEGLAQGRLGKWLERLERWQGHSGAALMGNPPG
K0CG81_ALCDB          TLFFQRRLLVEGDTELGLWVKNLLDGLDQ--------------SRWPGPVREGL------
A0A2D9TUG4_9GAMM      TLFFQRRLCIEGDTELALQIKNLLYATELS-----------GVARFASKKLNRFIHLAEP
Q2SJY3_HAHCH          TLFFQRRIVILGDTELGHEMKNLLDTGDLN--------------DLPAPAHQLLELASSI
A0A0F5AV16_9GAMM      TLFFQRQLSISGDTELGLHVKNLLDSLEID--------------TLPKPLARSLTLS---
D3RT19_ALLVD          TLFFQRRLRMSGDTELGLYLKNFLDAFEPPARWAPMIRTLERLADM--RLPGRKA-----
W0E2R6_MARPU          TLFFQRRLRMSGSTELGLYLKNFLDAFEPPERWQPLTRAIDRMAGV--RFPGH-------
S6BAC1_9GAMM          TLFFQRRLRIEGDTATGLHLKNFPDAREGALLPPALQYSLERMTDLYGRYCGREDVAAV-
K4L1X9_SIMAS          SLFFQRRLRISGDTELGLTAKNTLDAIDRHQLPRSLLLRLSQLTQLIELAENQHKESSRG
A0A1E9M1V5_9NEIS      TLFFNRKLQIEGDTELGLITKNLLDSVEWPFSEWFLKRSTSTLD----------------
D2ZVE5_NEIMU          TLFFNRKLQIEGDTELGLITKNLLDSVDWPFGDWFLKRQLSD------------------
D4DM76_NEIEG          TLFFNRKLQIEGDTELGLITKNLLDSVEWPFAEQLVKWQEKGIL----------------
G2J058_PSEUL          TLFFNRKLSIEGDTELGLIVKNLLDSVDW--HETPLARFMAS------------------
C1DBA2_LARHH          TLFFSRRLDIEGDTELGLIVKNLLDSIDW--SETPFARFMAH------------------
G8QJ01_AZOOP          TLFFNRQLSIEGDTELGLVVKNMLDAIEWPPSVGRIPGLERLSALVAGLPRPGRTA----
D5CMY5_SIDLE          TLFFNRELSIEGDTELGLVVKNMLDAVEWPQLRG-LPGFSQQAD----------------
Q47JW5_DECAR          TLFFNRELEITGDTELGLIIKNMLDAVEWPKFSSRLPLLRH-------------------
C5T5T9_ACIDE          TLFFSRRLSMEGDTELGLVVKNALDAIELPVLDPRQWTPRQVFARLAQ---RRFPGHGVG
F4GD36_ALIDK          TLFFNRRLVMEGDTELGLVVKNALDALELPVLAPSHWSPRAVLERKAPHLLRQLPPLPAF
Q223A9_RHOFT          TLFFSRRLAMEGDTELGLLVKNTIDAIELPMVNLEPFKPAQVLARLRA----RWTLRQSH
Q63SG3_BURPS          TLFFSRRLTMEGDTELGLLVKNSLDAIDLSVFSLERWLPTRLFRQRPL----ERDAMPD-
C4ZIX4_THASP          TLFFSRRLRMEGDTDLGLLVKNTLDAVDWDALKAKLLGRHG-------------------
Q3SGV7_THIDA          TLFFSRRLVSEGDTALGLTVKNLLDALDPDAVLAQLPAPLARLARRVLAA----------
Q7WX87_CUPNH          TLFFQRKLVISGDTALGLEVKYWLDAAPRPAWVGDVVSRML-------GRAVPG------
Q0JYR4_CUPNH          TLFFQRRLVISGDTALGLEVKYWLDAAPRPAWVSQAAARLVALHGATVGRAGAAS-----
F8GXS6_CUPNN          TLFFQRRLAITGDTALGLEVKYWLDAAPRPPWVVAASTRLS--------AMMAA------
Q1LDH6_CUPMC          TLFFQRRLSISGDTELGLEVKYWLDAAPRPTWVGPFAARLSVLF---PAPATAS------
B2UJJ6_RALPJ          TLFFQRRLKIAGDTELGLIVKNWLDAAARPAWLARWQSR---------------------
Q8XR91_RALSO          TLFFQRRLKISGDTELGLIVKNWLDAAERPAWLARWQSRQV-------------------
B2U6W3_RALPJ          TLFFQRRLKIAGDTELGLIVKNWLDAAARPAWLARWQSR---------------------
A9ITK5_BORPD          TLFFQRRLRIAGDTELGLIVKNWLDATERPGWLRRVGGAA--------------------
A0A1U9JIX4_9NEIS      TLFFQRRLAIAGDTELGLVVKNWLDAQERPAWLTRLAARWSPM-----------------
I0HL44_RUBGI          RLFFERALVMEGDTEMGLVLKNTLDALGPLFRF---------------------------
B1Y7Z8_LEPCP          RLFFERALVMEGDTEFGLILKNTLDAIGPLWQ----------------------------
C5AJM9_BURGB          TLFFNRRLVIQGETELALIVRNAIDAIDFSATRSGTVLHDLLRRVARRLAPPPRP-----
G4E6P8_9GAMM          TLFFQRRLSLEGETEAGLYIKNMLDGAEFDWQAHAIAVLGPRLGIRAIRLIQRTGLDRLS
A0A1B4VCW1_9GAMM      TLFFNRRLSLEGETEAGLHVKNLLDALEYDLEAHVRDVLGGAPARLALGLLRATPLARRL
F2GAN1_ALTMD          TLFFQRKLLVTGNTELGLQVKNFLDELDTSAFPSVVLCALKKYNDVMQTAP---------
Z5XMH6_9GAMM          TLFFSRKLAIQGDTELCLTVKNWLDTQDPQASLPDWLFNQLTEYVESLQ-----------
B7J8F6_ACIF2          TLFFARRLVLEGETSVGLQLKNILDSIDLDWLAPVGYLPAPLGPRIRRAIDHAIRNTHAD
A0LDD5_MAGMM          SLFFARRLKMSGETETGLHFKNILDNVAIDWEREAAFFIGPIGAKLAGGVGSRLKALFAM
                       ***   :   *..      :                                       

UBIT_ECOLI            TSVGEPC-----------------------------------------------------
A9MPN5_SALAR          TSVGEPC-----------------------------------------------------
E3G0Z6_ENTLS          TSVGEPC-----------------------------------------------------
W1HP54_KLEPN          ------------------------------------------------------------
I2B4V4_SHIBC          HSIGEPC-----------------------------------------------------
H2ISZ0_RAHAC          TPVAEPC-----------------------------------------------------
C5BFC9_EDWI9          RAVTSC------------------------------------------------------
Q2NW15_SODGM          HRVTHSC-----------------------------------------------------
A0A0L7T7J5_9GAMM      NRAGAPC-----------------------------------------------------
R8AMK9_PLESH          -QAITSC-----------------------------------------------------
B7VJG6_VIBA3          MNAYSN------------------------------------------------------
U3BD49_VIBPR          MNAYSN------------------------------------------------------
Q87M13_VIBPA          ANAYSN------------------------------------------------------
Q9KU69_VIBCH          INAYSN------------------------------------------------------
Q6LUI3_PHOPR          MNAH--------------------------------------------------------
C4L7K5_TOLAT          AATI--------------------------------------------------------
Q483B2_COLP3          ------------------------------------------------------------
A1SWF4_PSYIN          ASFFASDQ----------------------------------------------------
D4ZB14_SHEVD          ------------------------------------------------------------
A8H6Z8_SHEPA          ------------------------------------------------------------
Q086E7_SHEFN          ------------------------------------------------------------
R4YS84_OLEAN          ------------------------------------------------------------
Q5QWL0_IDILO          ------------------------------------------------------------
D1KB62_9GAMM          ------------------------------------------------------------
C7RCX1_KANKD          ------------------------------------------------------------
Q0A6R1_ALKEH          ERRFRPSEPSA-------------------------------------------------
A1WVU6_HALHL          VKV---------------------------------------------------------
G8PWN8_PSEF3          LATV--------------------------------------------------------
C5BJ06_TERTT          HLWVRGVRKGVNA-----------------------------------------------
E1STJ7_FERBD          ------------------------------------------------------------
M1FLK7_9ALTE          ------------------------------------------------------------
A3JBV8_9ALTE          ------------------------------------------------------------
A1U595_MARHV          ------------------------------------------------------------
E1V7H4_HALED          HDMRVPARRFISRTSRGCLPPLPRSSPG--------------------------------
K0CG81_ALCDB          --------RLLAYATR--------------------------------------------
A0A2D9TUG4_9GAMM      D-----------------------------------------------------------
Q2SJY3_HAHCH          AVYWENAKRDMLAALSYKIPVTPPSA----------------------------------
A0A0F5AV16_9GAMM      --------HHYLTKLAL-------------------------------------------
D3RT19_ALLVD          ------------------------------------------------------------
W0E2R6_MARPU          ------------------------------------------------------------
S6BAC1_9GAMM          ------------------------------------------------------------
K4L1X9_SIMAS          AGMPGR------------------------------------------------------
A0A1E9M1V5_9NEIS      ------------------------------------------------------------
D2ZVE5_NEIMU          ------------------------------------------------------------
D4DM76_NEIEG          ------------------------------------------------------------
G2J058_PSEUL          ------------------------------------------------------------
C1DBA2_LARHH          ------------------------------------------------------------
G8QJ01_AZOOP          ------------------------------------------------------------
D5CMY5_SIDLE          ------------------------------------------------------------
Q47JW5_DECAR          ------------------------------------------------------------
C5T5T9_ACIDE          GQP---------------------------------------------------------
F4GD36_ALIDK          LKPRP-------------------------------------------------------
Q223A9_RHOFT          ------------------------------------------------------------
Q63SG3_BURPS          ------------------------------------------------------------
C4ZIX4_THASP          ------------------------------------------------------------
Q3SGV7_THIDA          ------------------------------------------------------------
Q7WX87_CUPNH          ------------------------------------------------------------
Q0JYR4_CUPNH          ------------------------------------------------------------
F8GXS6_CUPNN          ------------------------------------------------------------
Q1LDH6_CUPMC          ------------------------------------------------------------
B2UJJ6_RALPJ          ------------------------------------------------------------
Q8XR91_RALSO          ------------------------------------------------------------
B2U6W3_RALPJ          ------------------------------------------------------------
A9ITK5_BORPD          ------------------------------------------------------------
A0A1U9JIX4_9NEIS      ------------------------------------------------------------
I0HL44_RUBGI          ------------------------------------------------------------
B1Y7Z8_LEPCP          ------------------------------------------------------------
C5AJM9_BURGB          ------------------------------------------------------------
G4E6P8_9GAMM          AKCWAQQDRPQTRY----------------------------------------------
A0A1B4VCW1_9GAMM      SGVSGV---PRARS----------------------------------------------
F2GAN1_ALTMD          ------------------------------------------------------------
Z5XMH6_9GAMM          ------------------------------------------------------------
B7J8F6_ACIF2          RRLHDLLDRALQP-----------------------------------------------
A0LDD5_MAGMM          QKESAEESAEMWLDENSVPRRHDVDDLQDQCSDLSGETESLERRLTRLENRYKMRQAALR
                                                                                  

UBIT_ECOLI            ------
A9MPN5_SALAR          ------
E3G0Z6_ENTLS          ------
W1HP54_KLEPN          ------
I2B4V4_SHIBC          ------
H2ISZ0_RAHAC          ------
C5BFC9_EDWI9          ------
Q2NW15_SODGM          ------
A0A0L7T7J5_9GAMM      ------
R8AMK9_PLESH          ------
B7VJG6_VIBA3          ------
U3BD49_VIBPR          ------
Q87M13_VIBPA          ------
Q9KU69_VIBCH          ------
Q6LUI3_PHOPR          ------
C4L7K5_TOLAT          ------
Q483B2_COLP3          ------
A1SWF4_PSYIN          ------
D4ZB14_SHEVD          ------
A8H6Z8_SHEPA          ------
Q086E7_SHEFN          ------
R4YS84_OLEAN          ------
Q5QWL0_IDILO          ------
D1KB62_9GAMM          ------
C7RCX1_KANKD          ------
Q0A6R1_ALKEH          ------
A1WVU6_HALHL          ------
G8PWN8_PSEF3          ------
C5BJ06_TERTT          ------
E1STJ7_FERBD          ------
M1FLK7_9ALTE          ------
A3JBV8_9ALTE          ------
A1U595_MARHV          ------
E1V7H4_HALED          ------
K0CG81_ALCDB          ------
A0A2D9TUG4_9GAMM      ------
Q2SJY3_HAHCH          ------
A0A0F5AV16_9GAMM      ------
D3RT19_ALLVD          ------
W0E2R6_MARPU          ------
S6BAC1_9GAMM          ------
K4L1X9_SIMAS          ------
A0A1E9M1V5_9NEIS      ------
D2ZVE5_NEIMU          ------
D4DM76_NEIEG          ------
G2J058_PSEUL          ------
C1DBA2_LARHH          ------
G8QJ01_AZOOP          ------
D5CMY5_SIDLE          ------
Q47JW5_DECAR          ------
C5T5T9_ACIDE          ------
F4GD36_ALIDK          ------
Q223A9_RHOFT          ------
Q63SG3_BURPS          ------
C4ZIX4_THASP          ------
Q3SGV7_THIDA          ------
Q7WX87_CUPNH          ------
Q0JYR4_CUPNH          ------
F8GXS6_CUPNN          ------
Q1LDH6_CUPMC          ------
B2UJJ6_RALPJ          ------
Q8XR91_RALSO          ------
B2U6W3_RALPJ          ------
A9ITK5_BORPD          ------
A0A1U9JIX4_9NEIS      ------
I0HL44_RUBGI          ------
B1Y7Z8_LEPCP          ------
C5AJM9_BURGB          ------
G4E6P8_9GAMM          ------
A0A1B4VCW1_9GAMM      ------
F2GAN1_ALTMD          ------
Z5XMH6_9GAMM          ------
B7J8F6_ACIF2          ------
A0LDD5_MAGMM          AADSEA