CLUSTAL format seed alignment for MF_02233

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBIV_ECOLI            -------------------------------MKYSLGPVLWYWPKETLEEFYQQAATSS-
Q8D1C9_YERPE          ------------------------MAVAGGNMKYALGAVLYYWPKTEIETFYHAAANSS-
A0A2S3XHU4_9GAMM      -------------------------------MQFSLGPLLFYWPKADTEAFYHAAADSQ-
A7MUV8_VIBCB          ---------------------MAVEVKMDNSMKYALGPLLYFWPKQDVEAFYEQAKSSS-
A5KZ90_VIBBS          -------------------------------MKYALGPLLYFWPKQDVESFYEQAKSSS-
A0A0B8QBD2_9VIBR      -------------------------------MKYSLGPILYFWPKQDVEDFYKQAMQSD-
A0A241PCF5_VIBAN      -------------------------------MKYALGPLLYFWPKQEVESFYQQAINSP-
Q5E7K9_ALIF1          -------------------------------MKYALGPLLYFWSKENVESFYQQATNSE-
C9P199_VIBME          -------------------------------MKYALGPLLYFWPKTDVESFYQHALSSS-
F2GAN4_ALTMD          -------------------------------MQYSLGPILYFWPKAQVEQFYDKAAQSE-
Q5QWK8_IDILO          -------------------------------MKFSLGPILYFWPKQQVFDFYQQAAESD-
A0A1Y5E148_COLPS      -------------------------------MKFSLGPSLFFWPKNEVVDFYQQAKKSS-
Z5XKZ2_9GAMM          ------------------------MGVTMTQLKVAVGPMLFLWQKELLEQFYERVAQST-
Q086E9_SHEFN          -------------------------------MKISLAPISYCWSKSDVEHFYQQVALSN-
Q8EHH3_SHEON          -------------------------------MKISLGPLLYCWEKQQVIDFYQQVANSQ-
A1S498_SHEAM          -------------------------------MKSSLGPLLYCWDKAKVFEFYRAIAQSD-
D4ZB16_SHEVD          ----------------------MHIKYIGKQMEVSLGPLLYCWPKEKVIEFYRAVADSQ-
B1KRL6_SHEWM          -------------------------------MKASLGPILYCWPKEKVIEFYTQVAASQ-
A3QGQ6_SHELP          -------------------------------MKTSLGPIQYCWPKEKVVEFYEAVAQSS-
C7RCX0_KANKD          -------------------------------MKISLAAVPYFWTKPAYQDFYQQVADTN-
C5BJ04_TERTT          -------------------------------MKITLAAIPYYWPRSEVVDFYARLCRAN-
A4BKD7_9GAMM          -------------------------------MQLTLAPIPFYWPRETVLNFYEQAAHWP-
B7J8F4_ACIF2          -------------------------------MKISLGPIHYYWSKENIEQFYRRAEHWP-
A0A0C5VGH4_9GAMM      -------------------------------MKITIGANQFYWNRNETFDFYHQLLSAP-
Q2SJY5_HAHCH          -------------------------------MKISLGPLPYFWPKEMVVQFYSQVAAAP-
Q9HXA1_PSEAE          -------------------------------MKLSLGPLLFYWDKRQIFDFYAEMAGQP-
A1WVU7_HALHL          -------------------------------MKIAIGPILYHWPAAEIRQFYDGLRGQ--
K4KPK2_SIMAS          -------------------------------MKLSLGPIQYFWSHKDVLEFYARMIETP-
A0A1B8P623_HALEL      -------------------------MPIEQTLQLSLGPVLFYWNRERYAAFYREAADWP-
K0CIF7_ALCDB          ------------------------------MLELALGPVPFYWHQRDYETFYEHAADWP-
A1U5A2_MARHV          ------------------------------MMKLSLGPILWFWTKQSVFDFYANAAEWP-
D2ZVE4_NEIMU          ----------------------------MNPMKLSLGPVLFFWQKEALLEFYAAMLDAP-
C6M2H4_NEISI          ----------------------------MNPMKLSLGPVLFFWQKEALLEFYAAMLDAP-
F0F2I8_9NEIS          ----------------------------MNPMKLSLGPVLFFWQKEALLEFYAAMLDAP-
E7RTW0_9BURK          ---------------------MSEPIQSRNPIRLSLGPIQFFWQKETLLEFYVSMLDAP-
B9YZ31_9NEIS          --------------------MMEPTTMTSLNLKLTLGPVLFFWSRDEIFNFYSEAAAWP-
D5CMY6_SIDLE          -------------------------------MKLALGPLLYFWPRKTVLDFYAEMAQNPA
Q47JW4_DECAR          -------------------------------MKLSLGPLLYFWPKGEVMEFYAEMAQNPA
C7RPT3_ACCPU          -------------------------------MKLALGPLLYFWPKHEVFEFYAEIAQNPA
G8QJ00_AZOOP          -----------------------------MTMKLSLGPLLWFWPKQEVMNFYASMLETP-
C1DBA3_LARHH          -------------------------------MQISLGPLLFFWPRDQVMRFYAEVAASPD
A0A179TGV9_ALCXX      --------------------------MKPKAFRISVGPLLYYWPRQRTLAFYAELADSQ-
B2UJJ7_RALPJ          -----------------------------MSYEISLGPLLYYWPRLQTFDFYAEVAASP-
A9ITK8_BORPD          -----------------------------MPYQISLGPLLYYWPRRTVLDFYAAAIDSP-
Q46R27_CUPPJ          --------------------MRNTSTPGTASFGIALGPLLYYWPRATVMQFYADVAESS-
Q0JYR3_CUPNH          MTSICLEPAMTELPMPEIAAAAMPQTVAMPAFGIALGPLLYYWPREAVMQFYASVADAP-
A1K2D5_AZOSB          -------------------------------MKLSLGPLLYYWPRQSVLDFYAEIADSP-
Q5P3F9_AROAE          ----------------------------MNAMKLALGPLLYYWPRQATLDFYAQVADSP-
B9MDK0_ACIET          -------------------------------MKLALGPLQYYWPRDTVFDFYQAMAETP-
A0A0H2WJG0_BURMA      -------------------------------MKIALGPVQYYWPRVATMQFYQAMSETP-
A4G5P8_HERAR          ------------------------------MLKLSLGPLQYYWPRAATFKFYEEIARTA-
Q3SGV5_THIDA          -------------------------------MNLSLGPLLYYWPRDDVLAFYGEAAHWP-
D3RRV1_ALLVD          ---------------------MSALNNPAHRPRLSLGPILYLWPREQVLDFYAELLETP-
B1Y7Z7_LEPCP          ------------------------MTSHSTPLDLTVGPLQYWWPRATLINFYAELADSP-
F3LQZ3_9BURK          ------------------MALRPDETMSSERIKLTVGPVLTYWTRQALMDFYAGVAESA-
Q11MV2_CHESB          ----------------------------MQKAALTLGPVFFHWSRARLTDFYRRIADEAP
N0B3H5_9RHIZ          ----------------------------MPPIALTLGPVFFHWPAERLKDFYFRIADEAP
F2J405_POLGS          ----------------------------MAAIELALGPCLFNWPADRLADFYARIADEAP
Q0ALZ9_MARMM          ---------------------------MTAPIELTLGPLFFNWPVQTLADFYARIADESV
B4W960_9CAUL          --------------------------MEMTAMRIALGPLLFHWAPDRIEAFYAEVADEPS
B0T0Q4_CAUSK          --------------------------MSAPRLELAVGPLLFNWSPDRVAAFYDQIAADPA
A0A1I3R5M4_9RHOB      -------------------------------MDLTIGPNQFFWQAEQQRAFYAALA-ESD
D5AU36_RHOCB          -----------------------------MTMDLTVGANLFFWTTDATRGFYERLR-AAP
A0A2V4NA95_9RHOB      -------------------------------MQLTVGANQFFWSPEDWGSSYTALA-AAP
Q3J0P8_CERS4          -------------------------------MDLTLGPNLFFWEAERVRDFYARIADEAP
A5FTZ7_ACICJ          ------------------------------MSCLTLGPLQFHWPAARRRDFYARIADEAP
E3HZN6_RHOVT          -----------------------MPNENAQTAKLTLGPLLHHWTPEARRDFYFRAADEMP
K2IGT7_9RHOB          -------------------------MAVTNMTKLTLGPIAYHWSAEARSDFYARIADEAP
D0CT21_RUELI          -------------------------MAVGKMTKLTMGPIAYHWSAERRRDFYARIADEAP
A0A327JLQ5_9RHIZ      -----------------------------MSAELTLGPVLYNWKADAWRDFYFKIADEAP
A0A1V0PVB2_9RHOB      -----------------------------MAVELTLGPNLFHWPAEQKIDFYNRIADESP
C3M9K2_SINFN          --------------------------MNTGKPTLTLGPVPYLWEGEKWRDFYFRMADEAP
A6X3L9_BRUA4          ----------------------------MSAPSLSLGPVLFLWDGPKWRDFYFRIADEAP
B6JBV7_OLICO          ---------------------------MTSSMQLTLGPVLYNWQPEQWRDFYFRIAEEAP
B6ISC6_RHOCS          --------------------------MTVSRPVLTLGPILFNWPTEKKIDFYKRIADEAP
V6F8W1_MAGGM          --------------------MAMNKRDSLSPVRLTLGPVLFNWKPEKLRDFYFRMADESC
A0A0H3G2P4_ZYMMA      -------------------------MSSSTSDHLSLGAVMFPWPAKMLRDFYFRIADEGD
Q2RRC1_RHORT          ----------------------------MTRVDIALGPLTYNWPADKRRAFYEDIAKQPV
A0A1G7ZNK3_9PROT      ---------------------------MTADRRLVLGPLLYHWPTETRLDYYRRIAEESP
A0L5V3_MAGMM          -------------------------------MKLSIGPVLFDWGKNGFRDFYKKMAFETE
                                                         :..    *        *        

UBIV_ECOLI            ADVIYLGEAVCSKRRATKVGDWLEMAKSLA-GSGKQIVLSTLALVQASSELGELKRYVEN
Q8D1C9_YERPE          ADIIYLGENVCTKRREMKVGDWLALAKAVA-SSGKQVVISTLALLQAPSELNELKRYVEN
A0A2S3XHU4_9GAMM      ADIIYLGETVCSKRRELKVDDWIALARQVA-SSGKQVVLSTLALISAPSELKEVKRLVDN
A7MUV8_VIBCB          ADIIYLGETVCSKRREMKPTHWFDIAKELS-ASGKQVVLSTMALLEAPSEVNIMKKYIDN
A5KZ90_VIBBS          ADIIYLGEAVCSKRREMKAKHWMDIAKELS-ASGKQVVLSTMALLEAPSEVNIMKKYIDN
A0A0B8QBD2_9VIBR      AEIIYLGESVCSKRREMKPNHWFDIAKELA-HSGKQVVLSTMALLEAPSEVNVMKKYVDN
A0A241PCF5_VIBAN      ADVIYLGESVCSKRREIKPQHWFEIAKALS-QAGKQVVISTMALLEAPSEINVMKKYIEN
Q5E7K9_ALIF1          ADIIYLGESVCSKRREMKPKDWFAIAKDIS-DSGKQVVLSTMALLEAPSEVNVMKKYIDN
C9P199_VIBME          ADIVYLGETVCSKRREMKAGDWFDIAKQLA-AAGKEVVLSTMALLEAPSEINLMKKYIDN
F2GAN4_ALTMD          AQIIYLGETVCSKRRQLKMVDYIAIAKALA-DKGKEVILSTMTLLEAPSELAQVRKYCEN
Q5QWK8_IDILO          VEHVYLGETVCSKRRELKLDDYLAIAHMLR-EAGKKVTLSTMTLLEAPAELRELGKYCDN
A0A1Y5E148_COLPS      ADVIYLGETVCSKRRELRAKDWLGLAQDVAKDTNKQVVVSTMTLLESPAEIQVLKRLCDN
Z5XKZ2_9GAMM          ADIVYLGETVCGKRRLSRLNDYLEWAKMLE-QAGKEVVLSSLALLESGAQLQELKRVCRQ
Q086E9_SHEFN          IDTVYLGETVCSRRRELKFNNYLDLANMLK-SHGKHVVLSTMALIEAQSELNELKRAIDN
Q8EHH3_SHEON          IPLVYLGEAVCSRRRELKWGDYLELAKMLK-SAGKDVVLSTLALIEAPSEYTELKRQVDN
A1S498_SHEAM          IALVYLGEAVCSRRRELKTSDYLTLARELR-DAGKEVVLTSLALIEAAGELTELKKLVSN
D4ZB16_SHEVD          IPLVYLGETICSRRRELKFTDYMDLAHMLK-ASGKEVVLSTLALLEAPSEYTELKKQVNN
B1KRL6_SHEWM          IPLVYLGETICSRRRELKFSDYMDLAHMLR-DSGKEVVLSTLALLEAPSEYTELKKQVEN
A3QGQ6_SHELP          VPLVYLGETVCSRRRELKFSDYLALAQMLK-AAGKEVVLSTLTLIEAQSEFLELKKQVEN
C7RCX0_KANKD          IDTVYLGETVCSKRRSMTLQDWIEIGNLLA-SKGKQVVLSTMTLLEAESELNYLKKIVQQ
C5BJ04_TERTT          IDVVYLGESVCSKRSEMTLDDWLAIAAELQ-RAGKEVVLTSLALITGRNELQMMKRICAQ
A4BKD7_9GAMM          VDRVVVGENVCSKRRELRTDDWLNVAQRLR-DAGKEVAVSTLALLEAESDLKTVERLCRQ
B7J8F4_ACIF2          VDIVYLGETVCAKRRALRSADWLDIAARLT-DAGKEVVLSTLALLEANSDLLQLERICAN
A0A0C5VGH4_9GAMM      VERVYLGETICPKRKELRYDDWLDIARQLS-ERGKEVVLSSLTLLESESDFRQIRQICAN
Q2SJY5_HAHCH          VDIIYLGETVCSKRREMNLRDWLDIAEKLL-AAGKEVALSTLALIEAESELKALRAICKA
Q9HXA1_PSEAE          LDVIYLGETVCAKRRALSLNDWQALARELAQATRAELVLSGLALIEAASELSSLRRLCEN
A1WVU7_HALHL          VDTFYLGETVCGRRRELRPEDWIGLGRELAEEGH-EVVLSTLSLVEARSEASVVRRLCDN
K4KPK2_SIMAS          VNTLYLGEVVCGKRRELSPIQWIDLARQLASSCGKEIILSTMTLIESGADLKGVKRLCDN
A0A1B8P623_HALEL      VNIVYLGESVCSRRRDMKLDDWLGIGRELA-QSGKQVVLSSQALIESEADLRDLRKLCDN
K0CIF7_ALCDB          VERIYLGETVCGRRRDMKLDHWLGLARELR-AQGKTVVLASQTLIEAGADLRALRRLCDN
A1U5A2_MARHV          VDTIYLGEVVCSRRRELKPDDWLDLARDLK-ACGKNVVLSTLTLIESEADLRRLRRFCEQ
D2ZVE4_NEIMU          VDTIYLGEVVCSRRQKMRFADWVSLAEDLA-ESGKEIILSSQVLLESESDLKRLRKIMGQ
C6M2H4_NEISI          VDTIYLGEVVCSRRQKMRFADWVSLAEDLA-ESGKEIILSSQVLLESESDLKRLRKIMGQ
F0F2I8_9NEIS          VDTIYLGEVVCSRRQKMRFADWVSLAEDLA-ESGKEIILSSQVLLESESDLKRLRKITGQ
E7RTW0_9BURK          VDTIYLGEVVCSRRQKMRFADWYGLAENLA-DSGKEVILSSQVLLESETDLRRLRKITGQ
B9YZ31_9NEIS          VDTIYLGEVVCSRRQQLRTQDWIGLAHDLA-DAGKEAVLSSQALLESESDLKRLRKLIDN
D5CMY6_SIDLE          IDIIHVGEVVCSRRQQLRVTDWIALARELS-DAGKEVVVSAQALLESESDLKALRRLMDE
Q47JW4_DECAR          LDIIYVGEVVCSRRQQLRTTDWIGLARDLT-DAGKQVVVSAQALLESESDLKALRRLIDD
C7RPT3_ACCPU          IDIITIGEVVCSRRQQIRVADWLALARDLA-AAGKEVVVAAQALLESESDLKSVRRLADE
G8QJ00_AZOOP          LDRIYLGEVVCSRRQQLRTSDWIGLARDLA-ESGKEVVISAQALLESESDLKALRRLVEE
C1DBA3_LARHH          IDIVYLGETVCSRRQQLRTDDWIGLARDLA-DAGKEVVLSAQALLESESDLKRLRRLIDA
A0A179TGV9_ALCXX      ADILYVGETVCSRRHELRADDWLDLARDLA-AAGKEVVLSGRTLIETGAEASALRRLCEQ
B2UJJ7_RALPJ          VDIVYVGETVCSRRHELRADDWLDIAAMLR-EAGKSVVLSTRTLIETSAEAQALRKQCQQ
A9ITK8_BORPD          VDIVYIGETVCSRRHEMRAADWLDLARALR-DAGKTVVLSSQTLIETSADAHALRRLCDN
Q46R27_CUPPJ          VDRVYLGETVCTRRHELRHAHWIEIAQMLR-DAGKEVVLSTPVLVESDSDIACMRRVCEQ
Q0JYR3_CUPNH          VDRVYLGETVCTRRHEVRHAQWLEIAQMLR-DAGKEVVLSTPVLVESDTDIAWMRRACAQ
A1K2D5_AZOSB          VDIVHLGETVCSRRHELRLDDWIEVAAVLA-DAGKEAVLSSQSLIESESDLKTLRRVVGQ
Q5P3F9_AROAE          ADIVHVGETVCSRRHELRLDDWFEVAAMLR-AAGKEVVLSSQSLIESESDLKALRRIVAQ
B9MDK0_ACIET          VDVVYLGEAVCSRRRELRQSDWIDIARMLR-DAGKQAVLSTMVLLESTSDVSAMHKIAQD
A0A0H2WJG0_BURMA      VDIVYLGETVCSRRHELRFADWIEIADMLA-EAGKEVVLSTQVLLESGRDLKTMREIAEN
A4G5P8_HERAR          IDIVYLGETVCSRRHELRLADWLEIADRLA-DAGKQPVLSTLVLVESGLDVGTLRRIVDN
Q3SGV5_THIDA          VARVYLGESVCSRRHVLRLPDWLALAVELA-AAGKQVLLSTQTLIESESDLKTLRRIASD
D3RRV1_ALLVD          VDVVYLGETICSKRRQLKPEDYWELAERVT-AAGKQAVISTLALIESDGELKTLKRICAD
B1Y7Z7_LEPCP          ARRIVLGEVICSRRNEFSTEDWLALARDLT-AAGKTVLLASMPLLMSEAELRTLRRIAEQ
F3LQZ3_9BURK          ADAVVLGEVVCSRRYEFKLDDWLDLAADLR-AAGKEVVLATQGLIESESDLRVVRRIAEQ
Q11MV2_CHESB          VERVHVGEVVCGKRMPFSDPA-WPDIIERLERAGKEVVISTLAAPATVRER---RSVEEL
N0B3H5_9RHIZ          VDRVHLGEVVCGKRMPFSDPV-WPDLIERLERAGKEVVLSTLATPMTARER---RSIEDL
F2J405_POLGS          VERVYVGEVVCGKRMPFTDPL-WPQVIERLQRAGKTVVLSALALPATVRER---KTLKDL
Q0ALZ9_MARMM          INRVYVGEVVCGKRSPLVEST-LVDAAERLERAGKTAVWSTLCSPTNKRER---SATASL
B4W960_9CAUL          IDRVYLGEVVCGKRSPLTQYA-LAAAAETLSAAGKDIVWSGLALPATVRDR---KGLAAL
B0T0Q4_CAUSK          IDRVYLGEVVCGKRGPLLAQT-LAQAAIGLEAAGKTVVWSTLALPALPRDR---QAIAAL
A0A1I3R5M4_9RHOB      ATRVVLGEVVCSKRLPFWQAE-IPQAVEALLAAGKEVALTSLGLITLKRER---KLTADL
D5AU36_RHOCB          VARVVVGEVVCSKRLPFWEHD-IPLIVSTLKDAGKEVALSTLGLITLNRER---AKTKDL
A0A2V4NA95_9RHOB      VDRVVLGELVCSKRLPFYQDR-IPAAIETLSAAGKAVSVTSLALITLKRER---KLGAEL
Q3J0P8_CERS4          VARVVLGEVVCSKRLPFWQGE-IPVAVERLRAAGKEVWLSSLALVTLKRER---SLTEEL
A5FTZ7_ACICJ          VECVYLGEVVCSKRLPWFEKD-LPKIAERLRRAGKQVVFSTPALIITDHEV---AMIRAL
E3HZN6_RHOVT          VDSVYLGEVICSKREPFFQDH-LPEVIDRLKSAGKEVVMSTLALVTQPREV---KAIREA
K2IGT7_9RHOB          VDDVYLGEVICSKRAPFHEAE-LPATIDRLERAGKRVILSTLAEVMLKRER---KATDDL
D0CT21_RUELI          VDEVYLGEVICSKRAPFQEAD-LPGIIERLERAGKTVVLSSLAEVMLRRER---KATEDL
A0A327JLQ5_9RHIZ      VDTVVIGETICYKRAPFFEPL-YGEVMERLEAGGKTVVFSTLAEVMLPHDR---RIVESI
A0A1V0PVB2_9RHOB      VSTVYLGEVICSKRTPFFDDKHMDQVAERLTKAGKTVVYASFSEVVIKRER---NILMEW
C3M9K2_SINFN          VHRVIIGETVCSKRLHFTEPH-LSAVIERLESAGKHVVLSTLALVTLERES---QYIRSL
A6X3L9_BRUA4          IDHVTVGEIVCSKRFHFLTPY-MDAVIERLQRAGKTVNVGSLALVMLEREA---KQVRHT
B6JBV7_OLICO          VDVVVVGEVVCSKRSPFFEAH-MPAVIERLAACGKQVVLGSLILVSLPRER---RQTAEL
B6ISC6_RHOCS          VDVVYIGEVICSKRTPFFEPA-IPELIEKLQRGGKTVVLSTLSLIMASREL---KQLRET
V6F8W1_MAGGM          VDSVCVGEVVCSKRTPFFTPY-LPEVIERLQAAGKEVILSSLALIMTAREA---EQAREL
A0A0H3G2P4_ZYMMA      VDTVYLGEVICSKRSPFLKHY-LPEITDRLTKGGKKIVFSSMALVGTADEV---REMEAL
Q2RRC1_RHORT          FDMVYMGETICAKRSAIVGEA-MADSVLALEAAGRTVVYSTLSLAITDPER---QAITDV
A0A1G7ZNK3_9PROT      VDEVVLGEVICERRLPLVREA-NAKAAEMLEKAGKTVVQATLALPVGPKER---AALSEV
A0L5V3_MAGMM          ADILYIGEVVCSKRYNLNPAE-MVELAEALKPSGKELVFSTLGLVMNEPEQQALREIVAA
                         . :** :* :*                                   :          

UBIV_ECOLI            G--------EFLIEASDLGVVNMCAERK------LPFVAGHALNCYNAVTLKILLKQGMM
Q8D1C9_YERPE          G--------EFLLEANDLGAVNMAAERG------LPFVAGHALNCYNAYTLRILHRQGMI
A0A2S3XHU4_9GAMM      G--------DLMVEANDLGTVQLAWEAG------IPFVCGPAINAYNADVLRMLLKQGMK
A7MUV8_VIBCB          G--------DFAIEANDVSAVQLASEHK------VPFVVGPAVNTYNAHTLNLFLKQGMI
A5KZ90_VIBBS          G--------DFAIEANDVSAIQLASESK------VPFVVGPAVNTYNARTLNLFLKQGMT
A0A0B8QBD2_9VIBR      G--------DFAIEANDVSAIQLAHEKG------VPFVVGAAVNTYNAHTLNLFLKQGMI
A0A241PCF5_VIBAN      G--------DFAIEANDVSAIQLASEKR------LPFVVGPAVNAYNARTLQLFLKQGMI
Q5E7K9_ALIF1          G--------DFIIEANDVSAIQLASESK------VPFVVGPAVNCYNAQTLNLFLKQGMT
C9P199_VIBME          G--------EFTIEANDVAAIQLAYQQG------VPFVVGPAINCYNAYVLKRFLQQGMI
F2GAN4_ALTMD          G--------EFLVEANDMAAVNYLRKLK------VPFVAGPALNIYNHKTLDILLKQGMK
Q5QWK8_IDILO          G--------EFDVEANDVSAIGVLQEQG------LNFTAGPGINIYNHQSLRRLIDMGMT
A0A1Y5E148_COLPS      G--------EFLVEANDLSAVQIMHELK------MPFVAGPAINCYNLSTLKVLLKQGMT
Z5XKZ2_9GAMM          S--------AYLIEANDLAAVQQLHSLG------LPFVIGPAINVYNGYTLAKFAQMGAV
Q086E9_SHEFN          G--------DFSIEANDMAAVHYAHQAK------VPFVCGPTINNYNRTSLNLLHQKGMY
Q8EHH3_SHEON          G--------EFMIEANDMAAVYLAKEHK------QPFVCGASINNYNRASLDILQRLGMQ
A1S498_SHEAM          G--------EFIIEANDMAAVHHAREAA------VPFVCGPHINLYNAASIRKLADWGMQ
D4ZB16_SHEVD          G--------EFTIEANDMGAVQAAKELG------LPFICGPTINNYNLASLKKLHSWGMQ
B1KRL6_SHEWM          G--------EFIIEANDMGAIQAAKENK------LPFICGPTINNYNLASLKTLHKWGMQ
A3QGQ6_SHELP          G--------EFTIEANDVGAIYLAKEHG------IPFVCGPSINSYNAATLKKFASWGMQ
C7RCX0_KANKD          A--------DFLIEANDMSAIQVANQAG------RPFAAGNAINIYNNQSLSLFHKLGMS
C5BJ04_TERTT          ---------GLQVEANDTATVQQLHELG------QPFICGSSINIYNAPTLQYFARLGMR
A4BKD7_9GAMM          H--------DISVEANDFSAVNALHREG------VPFSTGPYLNIYNAQTLDLLVADGMN
B7J8F4_ACIF2          T--------HYLVEANDMSAVHLLAGRG-------PFVIGPHINCYNAETLSLLADLGGR
A0A0C5VGH4_9GAMM      E--------QYLVEANDIAAVQIASELN------KRFVLGPAINIYSSATLDFLVRQGAV
Q2SJY5_HAHCH          ANAD----ERLSVEANDMAAAHLMSEAG------KPFIAGPYLNIYNAQALEIIRQAGAK
Q9HXA1_PSEAE          G--------ELRVEANDMAAVYYLSQRG------VPFVGGPALNLYNGHALAELYSWGMR
A1WVU7_HALHL          G--------ELRVEANDFTAVSELERRR------LPFVAGPILNLYSGRALRAMQRAGAV
K4KPK2_SIMAS          E--------GLLVEANDIAAIHYLSEKK------LPFVAGPAINIYNAQSLQFLMSQGLK
A0A1B8P623_HALEL      G--------EFSIEANDQSALQYLSTAR------LPFIAGPALNLYNPATIGVLARANMQ
K0CIF7_ALCDB          G--------ELPVEANDMSAVQLLNEAR------LPFIGGAPLNLYNVEAIRLLAGSGMQ
A1U5A2_MARHV          D--------EFLVEANDQSALQVAIRNK------IPFITGPSMNIYNVATLKILARQGLQ
D2ZVE4_NEIMU          --------DKFKVEANDMGAVKLAREHG------IPFVAGASLNIYNESTLALFQKLGAY
C6M2H4_NEISI          --------DKFKVEANDMGAVKLAREHG------IPFVAGASLNIYNESTLALFQKLGAY
F0F2I8_9NEIS          --------DKFKVEANDMGAVKLAREHG------IPFVAGASLNIYNESTLALFQKLGAY
E7RTW0_9BURK          --------DRFKVEANDMGAVRLAREHD------IPFVAGASLNIYNETTLGVFRQLGAF
B9YZ31_9NEIS          --------GRVRIEANDLGAARLAREQR------LPFVAGPHLNIYNGETLALMQRLGAY
D5CMY6_SIDLE          --------ANGKVEANDLGAVNIAAGR--------PFVAGPHLNIYNENTLATYARYGMQ
Q47JW4_DECAR          --------AGCWLEANDLGAVNLVHGQ--------DFVAGPHLNIYNEATLASFARFGLK
C7RPT3_ACCPU          LTDELTNIPGCRLEVNDLGAVGIAAGR--------PFVAGPHLNIYNEATLATFFRYGMR
G8QJ00_AZOOP          --------GNCSLEANDLGAVSLAREKQ------LPFVCGPHLNIYNESALAYFAGLGAK
C1DBA3_LARHH          --------TSFAIEANDLGALRLARAAG------RDVVAGPHLNLYNEDSLAFLARLGVK
A0A179TGV9_ALCXX      --------RDFMVEAGEAGAMRHLGG--------RPFVAGPHMNAYHGGTLEWLAARGAT
B2UJJ7_RALPJ          --------DDWLVEAGELGAVRLLGG--------RPFVAGPHCNAYHGATLAWLAGLGAI
A9ITK8_BORPD          --------DDFLLEAGEIGALRHLKG--------RQFVAGPHINAYHGDTLAWLATQGAM
Q46R27_CUPPJ          --------DEFLVEANDIGAVRCMGG--------RPFVGGPHLNVYHADTLAWLASLGAS
Q0JYR3_CUPNH          --------DDYLVEANDLGAVRCMQG--------RPFVGGPHLNVYHADTLAWLAGLGAA
A1K2D5_AZOSB          --------QRFRVEANDMAAVRLLAEAGR-----RDWIAGPTLNVFNPHTLGLLVEAGAS
Q5P3F9_AROAE          --------TDFRVEANDMSAVHLLTGAGR-----RDWIAGPALNIFNPATLSMMAESGAT
B9MDK0_ACIET          --------EEFLIEANDMGAVHQLAGK-------RAFVAGPQLNLFNADSLNWMVGLGAS
A0A0H2WJG0_BURMA      --------GRYLVEANDMGAVRRSAS--------RAFVAGPWLNVYNPPTLAMLAGLGAR
A4G5P8_HERAR          --------GRYAVEANDMGAVHALEG--------MPFIAGPHLNIYNAPTLKLLAELGAT
Q3SGV5_THIDA          --------GRFGVEANEWGAVRLLAEAG------VPFVAGSTLNVYNAQTLALLAELGAT
D3RRV1_ALLVD          --------ERFMIEAGDLAALDFLEG--------RPFVAGHSINLYNHRTLAFLAERGLK
B1Y7Z7_LEPCP          D--------EFAVEAGDASALQVLARRPAEQAARHPITLGPHLNIYSHGALIEHAALGAD
F3LQZ3_9BURK          R--------DYLVEAGDASALAVL------EPAGVPFAIGPHVNVYSRAALEEHARFGAV
Q11MV2_CHESB          C------TDERLIEINDITALPSR--------SGRPFVTGPFLNVYNEGSARFLIDRGAR
N0B3H5_9RHIZ          C------GDSRLVEINDVTALPSR--------TGKPFVSGPFVNVYNGATAQFLIRRGAQ
F2J405_POLGS          A------ASGLTLELNDFSLLADP--------LERAFVAGPFLNVYNEAALGFLAARGAS
Q0ALZ9_MARMM          S------TFDAEIEVNDIGALAAR--------NGRPFTAGPMLNIYNETALAALQDEGCT
B4W960_9CAUL          A------ALPDLIEVNDVSGLSER---------RDPFVAGPLLNIYNEGALGELARRGCV
B0T0Q4_CAUSK          A------ADPGLIEVNDLSALAHRP-------LGAPFVAGPMLNIYNEAAAGELIARGCV
A0A1I3R5M4_9RHOB      M------DMGLPIEINDLSALQKLP-------QDREFWVGPLVNVYNDSALRFLARRGAT
D5AU36_RHOCB          F------DMGLPVEINDITALKNLP-------EGTPFWVGPLVNVYNEGTLAYLARRGAT
A0A2V4NA95_9RHOB      V------GTGVDIEINDLSMLAYLP-------EGTSFSIGPLVNVYNEGSFAWLAARGAR
Q3J0P8_CERS4          I------DAGAGIEIADLTALAYIP-------EGAAFSVSPLINCYNVGTLDWLASRGAR
A5FTZ7_ACICJ          C------ETGDLIEINDLACLQLL--------NGQAFVSGPLVNVFNEGALDVLLRLGAM
E3HZN6_RHOVT          A------DADLIVEANDVACLEAL--------HGRPHIIGPFINVFNEGARDFVAKNGAF
K2IGT7_9RHOB          AG-----IDAPEIEINNAAGLFAR--------GRRPHRIGPFMNAYNEATIGWMAARGAT
D0CT21_RUELI          AS-----MEAPEIEINNAAGLYAR--------GTRPHRIGPFMNAYNEATIRWMASKGAT
A0A327JLQ5_9RHIZ      CS-----IEDHLVEVNDASGLYHL--------TGKPHNIGPLFNTYNEEVVKTLAKRGAK
A0A1V0PVB2_9RHOB      SQ-----QEGRDLEVNNTAALLHL--------KDKPHRIGALLNVYNEDTMAYLAAQGAT
C3M9K2_SINFN          VA-----DSPFPIEANDLSALALL--------EGKPHSIGPFINVYNAATARLLARRGAS
A6X3L9_BRUA4          IK-----EATLPVEANDLSALGLL--------SGVPHIVGPLVNVYNAATAKVLAARGAQ
B6JBV7_OLICO          AA-----NTDFMVEVNDLTCLGAL--------MDRPHAIGPFVNIYNEATATYFASRGAQ
B6ISC6_RHOCS          AA-----SAEVMIEANDVSTMRML--------EGKPHIVGPFVNIYNEGALNYALGKGAV
V6F8W1_MAGGM          TM-----TDGLLVEANDVSVVAMM--------GGKPFVAGPLLNIYNEGTLAYLHRMGAT
A0A0H3G2P4_ZYMMA      VE-----KTDGLIEANDVSLVRLL--------QGKPHHLGPFVNIYNEGALDFLTRLGAE
Q2RRC1_RHORT          AA-----DRDLLVEGNDAGALRAC--------AGRPHHVGPHVNVYNEGTLDVLAARGAT
A0A1G7ZNK3_9PROT      CA-----TPGP-VEAAEAGALKHL--------KGRPHRVGPFVNTYNESTLKVLVANGAE
A0L5V3_MAGMM          CK-----ELGIRYEANDMAALYVG--------EGQAAVAGPHITTYNPETADFLTTVGVD
                                   *  :                      .   . :           .  

UBIV_ECOLI            RWCMPVELSRDWLVNLLNQCDELG-IRNQFEVEVLSYGHLPLAYSARCFTARSEDRPKDE
Q8D1C9_YERPE          RWCMPVELSRDWLSNVLQQCDALG-FRHQFEVEVLSYGHLPLAYSARCFTARSEDRAKDE
A0A2S3XHU4_9GAMM      RWVMPVELSRDWLIQLNQDLGPL---RDQFEVEVFAYGHLPLAYSARCFTARSLDKPKDN
A7MUV8_VIBCB          RWCMPVELSREWLSNTLVQCDELG-IRNKFEVEVFSHGYLPLAYSARCFTARAENKAKDD
A5KZ90_VIBBS          RWCMPVELSREWLSNVMTQCEELN-IRNKFEVEVFSHGYLPLAYSARCFTARAENKAKDD
A0A0B8QBD2_9VIBR      RWCMPVELSRDWLSNTLNQCGELG-IRNKFEVEVFSHGYLPLAYSARCFTARAENRAKDE
A0A241PCF5_VIBAN      RWCMPVELSRDWLINVLQQCDELG-IKNQFEVEVFSHGYLPLAYSARCFTARAENRAKDE
Q5E7K9_ALIF1          RWCMPVELSREWLQNVLTQCDELG-IRNKFETEVFSYGYLPLAYSARCFTARAENKPKDE
C9P199_VIBME          RWCMPVELSREWLINVLNQCDDLN-IRGKFTTEVFAHGYLPLAYSARCFTARAENLAKDE
F2GAN4_ALTMD          RWCMPVELSKDKLSEILSKCDAIG-IKDRFEVEVFSYGHLPLAYSARCFTARSENRAKDD
Q5QWK8_IDILO          RWVVPFELSRDWLQDVLQHNLIDT-VRDCFDVEVFSFGHIPLAWSGRCFTARSENRPKDQ
A0A1Y5E148_COLPS      RWLMPVELSGDWLKILLNQATDAG-IRQQFECEVFSWGYLPLAYSARCFTARSEDKAKDD
Z5XKZ2_9GAMM          RWVMPVELSRDWLVALKHEYAGLT--DLPMQFEVFSYGLLPLAYSARCFTARHYDLAKDQ
Q086E9_SHEFN          RFVMPCELSQQWLNTVINQGDKP-----AFEIEVLGHGYLPLAHSARCFTAKHYQLPKDK
Q8EHH3_SHEON          RFVMPVELSKTWLSQVVDK--KP-----SFEVEVLGHGYLPLAHSARCFTARHSQLAKDS
A1S498_SHEAM          RFVMPVELSRDWLAEVLSQLGSS-----RPEVEVLGHGHIPLAHSARCFTARHHGLAKDG
D4ZB16_SHEVD          RFVMPVELSKHWLDKVISIEAP------AFEIEVFGHGFMPLALSARCFTARHKGLAKDK
B1KRL6_SHEWM          RFVMPVELSKHWLNTVVSVEKP------EFEIEIFGHGFLPLALSARCFTARQKGLVKDK
A3QGQ6_SHELP          RFVMPLELSKAWLTQVLDDLAPR-----QVEVEVFGHGFMPLAHSARCFTARHKGLTKDK
C7RCX0_KANKD          RWNIPVELGQEDLKPVIPKAQQL-----GVELEYQVYGRMPLAYSARCFTARHHDLPKDR
C5BJ04_TERTT          RWVVPVELAGPDLAALLAQ-TT---HANPIETEILGWGKLPLAYSARCYTARAHNRPKDA
A4BKD7_9GAMM          RWTLPVELGRETLKTLLAHIDS---SALPLATEVMAHGYLPLALSARCFTARALERPKDA
B7J8F4_ACIF2          RWIPPVELPATTIAMLQNT------RPETMETEAFAYGYLPLSFSARCFTARADNVGKDA
A0A0C5VGH4_9GAMM      TWVPPVEIGYQQIDTIYSQ------ALTSVNLEIFAYGYLPLAYSARCYSARHHQYQKDQ
Q2SJY5_HAHCH          RWTPPVEISRHALEGILEN------LAAPIETELFAYGHLPLALSARCFTARSEGLPKDD
Q9HXA1_PSEAE          RWIPPVEVSGKLLRGVLDQAAQL--GLEQLQTEVFAYGHLPLAYSARCFTARAENRPKDD
A1WVU7_HALHL          RWVPPMELPGASLRGVLSELTEL--GGETMETEVFAYGRQPLAFSARCFSARHYDRPKDD
K4KPK2_SIMAS          RWVVPVELGQQQLRAALTPLKV------KPEIEVLAWGRLPLAYSARCFTARHHGVKKDD
A0A1B8P623_HALEL      RWHAPVEMSRSDLARLLADCRAQ---GLHHACEVFAYGHLPLAWSSRCFTARRHRTPKDR
K0CIF7_ALCDB          RWHAPLELSRQALTALLTALREQ---GLALPCEVHAYGHLALAWSARCFTARRRGHAKDR
A1U5A2_MARHV          GWNLPVELGKETLEQLIRELKAD---GLDLPAEVFSWGFLPLAWSSRCFTARHYNLPKDN
D2ZVE4_NEIMU          RWITPSELSRDKVAEIIKA-SDD------IETELFAWGKMPLAYSSRCFTARHYNLNKDG
C6M2H4_NEISI          RWIAPSELSRDKVAEIIKA-SDD------IETELFAWGKMPLAYSSRCFTARHYNLNKDG
F0F2I8_9NEIS          RWIAPSELSRDKVAEIIKV-SDD------IETELFAWGKMPLAYSSRCFTARHYNLNKDG
E7RTW0_9BURK          RWVPPTELSHDKLATILAA-TEG------IETELFGWGRMPLAYSSRCFTARHYNLNKDH
B9YZ31_9NEIS          RWLPPVEMDRATLAEVLQH-APA------IETEVFAWGKLPLAFSARCFTARHYNLNKDD
D5CMY6_SIDLE          RWVPPLEADRKLVEMLHNARPAG------IETEVFVYGKIPLAFSARCFTARHYDLNKDD
Q47JW4_DECAR          RWVPPLEGSRSMIEALHRKKPAD------VETEVFAFGKIPLAFSARCFTARHYDLNKDD
C7RPT3_ACCPU          RWVPPLEGDSRLIETLHRSRPAG------VETEVFVFGKLPLAFSARCFTARRYILNKDD
G8QJ00_AZOOP          RWVPPLEATRELVQTLHQARPAG------METEVFAFGKIPLAFSARCFTARHYNLNKDD
C1DBA3_LARHH          RWVPPVEMPRERVARVLQQRPAG------LSCEVFAWGRLPLALSARCFTARYYTLNKDD
A0A179TGV9_ALCXX      RFVAPLEMHVNALARLLAERPAG------LQAEIMVWGRMALAFSARCFTARHFRLKKDE
B2UJJ7_RALPJ          RAVMPLEMSQATLAELMREKPDA------LEIEAMVWGRLPLAFSARCFTARHFRLNKDD
A9ITK8_BORPD          RVVVPVELDRDTLRALLQERPTG------LQAEVMVWGRLPLAFSARCFTARHFRLKKDA
Q46R27_CUPPJ          GCVMPVEMDGATLAALSAGRCAG------VALEVLAWGRMPLAFSARCFTARHHRLRKDA
Q0JYR3_CUPNH          GCVAPVEMDGATLAALAAARPTG------MRLEAFVWGRLPLAFSARCFTARHHRLRKDS
A1K2D5_AZOSB          RWVVAPEMSGAALAEVRSTLPAP------IETEIFAYGRLPLAHSARCFTARHYNLQKDG
Q5P3F9_AROAE          RWVAPPEMSGAVLAELLASGAPE------IETEVLAWGRLPLAHSARCFTARHFNLQKDT
B9MDK0_ACIET          RWVMPLEMRQADLAVLHQHKPAG------LETEVFAYGRMPLAFSARCFTARHHNLPKDD
A0A0H2WJG0_BURMA      RWVMPPEMSEAGLARMQAERPAH------LETEVFAYGRIPLAFSARCFTARNRNFPKDN
A4G5P8_HERAR          RWVMPLEMGREGLAQILQDKPTG------LETEVFAYGRMPLAFSARCFTARHRNLPKDN
Q3SGV5_THIDA          RWLPPVETSRAGLAALLAHAPAG------IETEVFAYGRLPLAYSARCFTARHYNLPKDD
D3RRV1_ALLVD          RWVMPVELGRATATELLQRRPEG------VECELFAFGRLPLAYSARCFTAYNRGLGKDN
B1Y7Z7_LEPCP          RWVAPLELSLDAIARINPPDAPVPGVAGPVASEVFGFGRMPLAFSARCFTARHHRLNKDE
F3LQZ3_9BURK          RWTAPTELPLDAMGRVNPAADPVKAGQTPVETEAFAFGRTPLAFSARCFTARHHRLSKDQ
Q11MV2_CHESB          SICPPVELSLAAIGHMAQA--FPQ-----TEFEVFAFGRLPLAISGRCYHARHRGLHKDS
N0B3H5_9RHIZ          TICPPVELSLAHIAAIART--CPD-----TEFEIFAFGRLPLALSGRCYHARLHGLHKDS
F2J405_POLGS          DWCPPVEVPLDSIRKAGAA--HPQ-----ITVELFAFGRLPLALSSRCYHARAHGLAKDS
Q0ALZ9_MARMM          RWCPPVEMSLAAIRAVHAA--RPD-----MPIEVFGFGRLPLAHSGRCYHARFHSLNKDS
B4W960_9CAUL          RLCPNVELSLEAISHLSAA--QPQ-----VEIELFAFGRLPLALSGRCYHARSHGLHKDA
B0T0Q4_CAUSK          RLCANVELSLPTLAALSAR--CPG-----LEIELFAFGRLPLALSGRCYHARHHGLHKDN
A0A1I3R5M4_9RHOB      RVCLPPELPIEAVAALCRVGDELG-----VAVEVWGHGRLPLAISGRCYHARLHDRAKDN
D5AU36_RHOCB          RICLPPELPLKSIAALCKAGKEAG-----VAVEVWGHGRLPLAMSARCYHARLHDRAKDN
A0A2V4NA95_9RHOB      SICLPPELPIDAVRILAQLGRRLG-----VAVEVWGHGRVPLAISGRCYHARRQGRSKDN
Q3J0P8_CERS4          RICLPNELPMESVETLARAGKERG-----VAVEVWGFGRQPLAISGRCYHARLHDRIKDS
A5FTZ7_ACICJ          RVNAPMELSIGAIATLAARNQSS-------EVEVFVFGRQPLAISQRCYHARAHDLHKDN
E3HZN6_RHOVT          RVVLPVEAPATSIKVLADNAGKL-------EIEVLVFGKQTLSIAMRCYHARANGLTKDS
K2IGT7_9RHOB          HVCLPSEMPAPAIAVAARAANDLG-----LGVEVQVFGRVSLAVSARCYHARAHGRTKDN
D0CT21_RUELI          HVCLPTELPAPSIAVAARMARDIG-----LGVEVQVFGRASLAVSARCYHARSHGRTKDN
A0A327JLQ5_9RHIZ      NFCVPHEMRATAIEAVAKEANALG-----CTVEVQVFGRQSLALSARCYHARAHDRIKDT
A0A1V0PVB2_9RHOB      HFALLPELPRSAVEKLGAKAQELG-----VGLELQVFGRASLALSARCYHARAHARTKDN
C3M9K2_SINFN          NICLPPELPASSIAEIAAGTPDI-------ALEVLAFGRMPLAISARCAHARAKGHIKDN
A6X3L9_BRUA4          SICLPPELPISSIREIVKAAPEI-------AFEVFTFGRVPLAISARCAHARSKGHIKDN
B6JBV7_OLICO          RICLPPELPMDSIQTIAAALPDV-------TMEVFAFGRVPLAISARCYHARLHKLSKDN
B6ISC6_RHOCS          RVALPCELPATSIAALAKAAPQA-------ELEVQVFGRLPLAVSSRCYHARSRDLHRDG
V6F8W1_MAGGM          RACLPAELPESVIATLA-AGDGP-------EIEVQSFGRLPLAISARCYHARSRNLAKDG
A0A0H3G2P4_ZYMMA      KACLNPELPATVIKELAQKSAIP--------LEVIVFGRLPISISARCFDARAKGRTKDN
Q2RRC1_RHORT          SICLPWELERASIERLAARARHHG-----MVAEVEVFGKAPLAISARCHHARAYGLAKDG
A0A1G7ZNK3_9PROT      VVCLPWELGAEAIATLSGAARAGG-----AEVEVQAFGHVPLAISARCYTARAQGLSRDA
A0L5V3_MAGMM          RIVMPVELSMDMVAMLIAKS-AIK-----VEYELFAYGKIPLTFSARCYTSRAFNLPKSN
                            *                         *    *  .:: : **  :      :. 

UBIV_ECOLI            CETCCIKYPNGRNVLSQENQQVFVLNGIQTMSGYVYNLGNELASMQGL-VDVVRLSP-QG
Q8D1C9_YERPE          CETCCIKYPQGRKVMSQEDQQVFILNGIQTQSGYCYNLGNDLISMQGL-VDIIRLSP-QG
A0A2S3XHU4_9GAMM      CEFACINYPTGRLANSREGQRVFNLNGIQTQSGYCYNLGNELAGMEGL-VDVVRLSP-QG
A7MUV8_VIBCB          CETCCIKYPTGIQVSSQEGQEVFNLNGIQTQSGYCYNLINDLPSMEGL-VDVVRLSP-LG
A5KZ90_VIBBS          CETCCIKYPTGLQVESQEGQSVFNLNGIQTQSGYCYNLVNDLPNMHDL-VDVVRLSP-LG
A0A0B8QBD2_9VIBR      CETCCIKYPTGLQVHSQEGQSVFNLNGIQTQSGYCYNLVNDQVSMQGL-VDVVRLSL---
A0A241PCF5_VIBAN      CETCCIKYPTGIQVHSQEGQAVFNLNGIQTQSGYCYNLANDLPSMAGL-VDVVRLSP-LG
Q5E7K9_ALIF1          CETCCIKYPTGITVNSQEGQEVFTLNGIQTQSGYCYNLINDLPSMSNL-VDVVRLSP-LS
C9P199_VIBME          CQTCCIRYPTGIQVTSQEGQAVFNLNGIQTQSGYCYNLINEQAGMQGF-VDVVRLSP-LG
F2GAN4_ALTMD          CELCCLNYPRGRVASSQEGQTLFVLNGIQTMSGYRYNLINDLKTMEGL-VDIVRISP-EA
Q5QWK8_IDILO          CELCCIKYPEGREVKSQEGQQVFVLNGIQTQSGTRYNLINQLPGMNGL-VDIVRISP-QP
A0A1Y5E148_COLPS      CEYCCIKYPEGRRMNSREGERVFVLNGIQTLSGYQYNLINEMPALDAMGVDIARISA-DS
Z5XKZ2_9GAMM          CELICQKHPSGLMTHSQDGKKVFTLNGIQTMSGQVYNLCEDRHALNSS-ADIARLSM-HD
Q086E9_SHEFN          CQTICQRHSKGLLAQTQESQPLLRLNGIQTQSAAQVNLINQIPQMIDMGIDYWRISP-NK
Q8EHH3_SHEON          CETVCRQYSKGLLAQTQEAQPLLRLNGIQTQSASCVDLRSEISAMVKIGVDVFRVSP-SS
A1S498_SHEAM          CQIICKNHSKGLLVQTQESQPLLRLNGIQTQSAACVNLASEWHNMAAMGVDWFRISP-SG
D4ZB16_SHEVD          CQTICISNPKGLLAQTQESEPLLRLNGIQTQSAACIDLSSERSDMEKMGVDYFRVSP-SG
B1KRL6_SHEWM          CQTICIENPKGLLAQTQESQPLLRLNGIQTQSAACIDLTSELSSMSDMGISYFRVSP-SS
A3QGQ6_SHELP          CQTICIENPEGLLVQTQEDQPLLRLNGIQTQSANYMDLCDQQTQMQALGVDYFRISP-SS
C7RCX0_KANKD          CQFKCKDDVEGIPVATREGDSFAQINGIQTQSGKLSNLLNHWQKLQAAGIDYARIVPVAP
C5BJ04_TERTT          CKKICIDYPRGMAVSSQENTGLFTLNGIQTLSASAQDLRALLPQVRSAGVTHFRVVP-EL
A4BKD7_9GAMM          CKRVCIDYPTGIPVDSQEDQRLFTMNGIQTLSGDILDLQAQIPEMADLGVNALRISP-SQ
B7J8F4_ACIF2          CELRCIKDPEGRALFTQEQERLFTINGIQLQSGIPCNLLNETVAMSEMGMDIVRISP-QL
A0A0C5VGH4_9GAMM      CQKICIEYPDGIQIFSQDGEPVFNLNGISTQSGKIAQLITEIPRMELMNVDYVRLSP-VK
Q2SJY5_HAHCH          CRFVCKKYPQGIPTRSQEGETLFNLNGIQTQSGKCYHLLNQWRDLQHAGVKVIRLSP-ES
Q9HXA1_PSEAE          CQFCCQQYPEGIPLLSQEGEALFTLNGIQTMSGKVSNLLADYRSLEHSGADLLRLSP-RA
A1WVU7_HALHL          CGFVCGHHPEGLPVTTRAGEPFLVINGIQTQSWGCANLLPAVPEMQQMGVTAVRLSP-RP
K4KPK2_SIMAS          CAFVCQQYPAGLQLKSQESQSLFTLNGIATLSGMPVNLLNHHASLTDTGVSHARISP-EW
A0A1B8P623_HALEL      CQFVCQQYPEGLALRSQESRDVFTLNGIQTLSGACQDLRHEVSDMLEMGVDVARLSP-RA
K0CIF7_ALCDB          CQFVCRDDPQGLPLFSQDGRRLFTLNGVQTLSAWPQDLRRELPVMAEMGISSARLVV-AN
A1U5A2_MARHV          CEFRCLEHPDGMELRSRESQELFRINGISTLSGSRYDLMRELPEMERMGVSTVRLSP-EH
D2ZVE4_NEIMU          CEFRCLDYEQGMDMNTREGKPFLTINGIQTMSYGCQNLLPHHEDLRQIGVNMLRLSP-QM
C6M2H4_NEISI          CEFRCLDYEQGMDMNTREGKPFLTINGIQTMSYGCQNLLPHHEDLRQIGVNMLRLSP-QM
F0F2I8_9NEIS          CEFRCLDYEQGMDMNTREGKPFLTINGIQTMSYGCQNLLPHHEDLRQIGVNMLRLSP-QM
E7RTW0_9BURK          CEFRCLDHEDGLVLKTREGKPFLTINGIQTMSYGSQTLLPHHQELQAMGVSLLRLSP-QL
B9YZ31_9NEIS          CQFRCLDHPDGLTLTTRDGQDFLTINGIQTMSAGCQSLLPHLAGMAAAGVTAVRVSP-QA
D5CMY6_SIDLE          CQFKCMEHPEGIMLKTREGQSFLTINGIQTMSAQSYSLLNEVPDLLQMDIDIIRISP-QP
Q47JW4_DECAR          CQFKCLDHAEGLTLKTREGQDFLTINGIQTMSAQSYNLLHEMPEMLKMGIDIVRISP-QK
C7RPT3_ACCPU          CQFKCLDHPEGLTLRTRTGQPFLTINGIQTMSAQTYNLLPQMPDLLDLGIEVVRISP-QP
G8QJ00_AZOOP          CQFKCLDHSEGLTLLTREKQPFLVINGIQTMSAQTYSLLHLMPELSQMGIDAVRISP-QP
C1DBA3_LARHH          CQFRCMEHPDGLPLDTREGQGFLTMNGIQTMSGAVMNLGAELPQLAASGVDIARISP-QS
A0A179TGV9_ALCXX      CGFRCIEHPDGLDMRTRESREFLAINGIQVQSAACLDLLDQAAYLADMGADVLRVSP-QS
B2UJJ7_RALPJ          CGFRCIEHPDGLAVRTREGQEFLAINGIQTQSGQCLDMLDQAPALSALGVKVLRVSP-QS
A9ITK8_BORPD          CEFRCIEYPDGLPVQTREGQPFLAFNGIQTQSAACLDLLDQAGELAAMGVEVLRVSP-QS
Q46R27_CUPPJ          CEFRCLDYPDGLVAATGEGQAFFTLNGIQTQSATSLDLCAQALTMAHVGIDMLRVSP-QS
Q0JYR3_CUPNH          CEFRCMDYPDGLVAATGEGQAFFTLNGVQTQSATCLDLCAEALAMARMGVGMLRVSP-HS
A1K2D5_AZOSB          CEFRCLGIADGLVLRTREGEPFLTLNGVQTQSAKVHTLLGDLPALAG-RAEVLRISP-QG
Q5P3F9_AROAE          CEFRCLGMSDGLVLRTREGEPFLTLNGVQTQSARVHNLLADLASVRQ-SAQVVRVSP-QG
B9MDK0_ACIET          CGFRCIEHPDGQLLATREGEGFLVLNGIQTQSARVHNLIQDVPALRALGVELLRLSP-QS
A0A0H2WJG0_BURMA      CQYVCMAHPDGLPLHTREGEPFLVLNGISTQSARVYNLIGEIDALRALNVDVVRLSP-QS
A4G5P8_HERAR          CEFSCLEHPDGLLLQTRENSDFLVLNGIQTQSAKVCNLLDQLSVMQAMGASVARISP-QA
Q3SGV5_THIDA          CQFRCLDHPDGLALGTREGEAFLTLNGIQTQSSGVHTLIDQLPALREIGVASLRLSP-QS
D3RRV1_ALLVD          CEFCCGDYPDGVLVTTQEGQEFLSLNGIQTQSAGTHNLLASLDEVRALGVDLLRISP-QS
B1Y7Z7_LEPCP          CDFRCRDDADGLLLSSTEGQPFLVLNGIQTQSAGLQCLIGDAAAMRAAGVSSVRLSP-CG
F3LQZ3_9BURK          CEFRCQDYPDGLLLSTSDGKPFLVLNGIQTQGAAQHCLIEQREQIVAHGVRRLRLSP-CS
Q11MV2_CHESB          CQFTCEKDPDGLAVDTLDDQEFLAINGVQTLSNQVQAFLPIPSELTSRRIRRLRLSP-QT
N0B3H5_9RHIZ          CQFTCEQDPDGLVVDTLDDQSFLAMNGVQTMSAQVQAVMLPPAEFAAQSVRRLRLSP-HT
F2J405_POLGS          CQFVCDRDPDGMAVRTLDNRRFLAVNGIQTLSDACQAVTLDADRLAANGIGRLRLSL-HT
Q0ALZ9_MARMM          CRYFCEEDPDGKTVSTVDGAPFLAFNGLQTLSDGVHLATTPSFDLRRVGIAAVRLSP-HS
B4W960_9CAUL          CQFVCDRDPDGMDLRTLEGQPFLAVNGVQTLSWAMQCVDAPVAALRAAGVGALRLSP-HS
B0T0Q4_CAUSK          CQFVCDRDLDGLAVETLDAVGFLAVNGVQTLSHGVQVADNPLAELRAAGVTCLRLSP-HS
A0A1I3R5M4_9RHOB      CQFVCGEDPDGREVETLDDQKFLVVNGVQTLSHSTATVAMQITALQEAGVSAIRLSP-QI
D5AU36_RHOCB          CQFICGADLDGREVDTLDGQAFLSVNGVQTLSAATGCAAYYTEALAEAGVSALRLSP-QT
A0A2V4NA95_9RHOB      CQFACENDPDGLDVTTLEGQDFLAMNGVQTLSASFACVDHQIEVLQEAGVTGLRLSP-HT
Q3J0P8_CERS4          CQFICNADPDGREVDTLDGERFLAVNGVQTLSCATSFAGREIPDLLAAGVSALRLSP-HT
A5FTZ7_ACICJ          CQFVCGQDADGLEIAQLDGRPLLAINGTQTLSHGHVALLEELTDLQAAGVTHFRLSP-HA
E3HZN6_RHOVT          CQFVCGLDPNGLNATTVTGDDILTINGTSTMSNGYGVLLHELDALRTMGVTHFRLSP-QA
K2IGT7_9RHOB          CQFVCEEDPDGMPLRSRDDQPILRVNGIQTQSESYLDLLPETPQLVADRVTHLRLMP-QR
D0CT21_RUELI          CQFVCEEDPDGMPLRTRDEQPILRINGIQTQSEGYLILLQELPQLVADGVSHLRLMP-QA
A0A327JLQ5_9RHIZ      CQFVCEDDPDGLNLRTLEGQPFLTINGVQVLSNDYVDLIAELPDLARMGVARFRLSP-QN
A0A1V0PVB2_9RHOB      CQFVCGEDPDGMVLKTMDDKPFLAINGIQTLSYGYLDMMADMDDMKRIGVTHFRVMP-HS
C3M9K2_SINFN          CQFVCAEDPDGLLVKTLDRQSFLALNGVQTVSFTCQALLTELLDLVSIGVSRFRLSP-QD
A6X3L9_BRUA4          CQFVCGEEPDGLPVKTLDSQPFLALNGVQTLSHTCQSLIEDLPELQEAGIRRFRLSP-QD
B6JBV7_OLICO          CQFVCERDPDGLPVATLDGEPFLAMNGVQTLSHACVNLLGDAVDLAIAGVGALRLSP-QQ
B6ISC6_RHOCS          CQYVCADDPDGMTVETLEGQKFLAVNGTETISYTVCNLIAELAQLREIGVSHFRLWP-HD
V6F8W1_MAGGM          CQYVCAEDADGMDVDTLDDDPFLAVNGTQTMSYHYLGLLAELSALRRLGVNRFRLWP-HD
A0A0H3G2P4_ZYMMA      CRFACLHHRDGLTISTLENEPFLTVNGMQTLTYGCGNLIQAIPELQQAGIHSFRLSP-QS
Q2RRC1_RHORT          CQYVCGKDLEGMPVDTLDGEAFLTLNGLQTQADAVTLLVSEIASLVEAGVGRLRLSP-LN
A0A1G7ZNK3_9PROT      CQFVCGNDPEGMYVKTIDDQPILRVNGVQTLSVGLQVLVDEVPALLKAEVRRLRLAA-EP
A0L5V3_MAGMM          CQYKCGDYADGMVMRTQEGKPLLTVNGIQTMSDKLFNVVDGMERMQAGGVHIARLSP-QS
                      *   *     *          .  .**                 .        *:     

UBIV_ECOLI            TDTFAMLDAFRANENG-----------------AAPLPLTANSDCNGYWRRLAGLELQA-
Q8D1C9_YERPE          LETLSVIDQFRANEQG-----------------LSPLPVANKADCNGYWHRVAGLELVS-
A0A2S3XHU4_9GAMM      METLEMLARFKANRQG-----------------QAPLPLQQGSDCNGYWRQIPGMSLVE-
A7MUV8_VIBCB          LSTFSELDQFRSNEKG-----------------TNPGKIQD-RQCNGYWHQLAGLEVKNI
A5KZ90_VIBBS          VDTFSEINNFRANEQG-----------------QNPMKIES-RQCNGYWHQLAGLDVKNI
A0A0B8QBD2_9VIBR      ------------------------------------------------------------
A0A241PCF5_VIBAN      FETFEHLSQFKANEKG-----------------EHPSPLTN-HQCNGYWHQLPGLAIQQS
Q5E7K9_ALIF1          VDTFDEVRKFKANETG-----------------SEKFALKDARHCNGYWHNIAGLDIQM-
C9P199_VIBME          QETFSLIDAFKANQNA-----------------EHPQRLDN-HQCNGYWHQLPGLDVHYQ
F2GAN4_ALTMD          TSTFEVLTNFVH---------------------ANSISLSA-DETNGYWHQIAGLTPLGA
Q5QWK8_IDILO          EGTFDWLQRFRSNING-----------------EHPVTLTS-KENNGYWLQLAGLATG--
A0A1Y5E148_COLPS      TDAFTQLDNFREQLVH-----------------PTKKDLDGITECNGFWHKIAGMSVA--
Z5XKZ2_9GAMM          MDDLQWIESFALGTDS-----------------KRPD-----EHINGFWHHIAGMHCQS-
Q086E9_SHEFN          LTDVAMGSELAHVLAQITEDPFNSKALITKQFNDNKQASIINHHCNGYWLGLPGMDYSLE
Q8EHH3_SHEON          LACIAKADALVEAL--------NSGAM-------DAQYPLSDEHCNGYWFGEAGLKSLS-
A1S498_SHEAM          MSLPNLE----------------------------ISTPLSGNECNGYWFGEAGFNQAV-
D4ZB16_SHEVD          IKSVELADKLLNGE------------------HEPQIHTDAELSCNGYWHQQAGFNRV--
B1KRL6_SHEWM          VSCIEKADKLF--E------------------LGSQSVQVDDTHCNGYWHQQAGFNHLQI
A3QGQ6_SHELP          LASIALADKLP------------------------AKSASHDRQCNGYWHQLPGLALS--
C7RCX0_KANKD          EATLEVIQALTQAINS--------------NQPTVDFTDHTREYCNGYWFQMAGLEMIA-
C5BJ04_TERTT          DLQSSFFDALEANISG---------------DAQPVTIASDA--CNGYWFGAAGMTYK--
A4BKD7_9GAMM          PEMTDIVASYAAAIQS---------------RESQPTPASSAPYCNGYWFEEAGMIHHAI
B7J8F4_ACIF2          TATESVIRAFHAVLNG---------------EISPPVEYGSPA-CNGYWYGKPGMQFSPV
A0A0C5VGH4_9GAMM      NGFFETIERYHKALTG---------------QPDPMIPIARSG-CNGYWFEEAGKEWV--
Q2SJY5_HAHCH          PDTLRVAESLALALKE---------------KQDMVLPYQLRH-SNGYWSRIPGMELAAG
Q9HXA1_PSEAE          QGMAEVIAAFDRVRKG---------------AAPPL----AVEGCNGYWHGRPG-MLRAE
A1WVU7_HALHL          GAMDQVVAAFRSAIAG---------------ETVTLREPESAQQCDGYWWGDAGHTRKAL
K4KPK2_SIMAS          EQTEIVIETFYNALRG---------------SSTAS----LAGGTDGYWRGQPGIDLIAR
A0A1B8P623_HALEL      EGMAEVVAAFDAARRG-------------ELPAPDPLALVDVEICDGYWNARPGIDNSRG
K0CIF7_ALCDB          EPMADVVAAFDQVRRG-------------QPDHRDPLALVDEARCDGYWHGAPGMDRH--
A1U5A2_MARHV          QGMDEVVKRFDQVRQG-------------QVPASDPLQLLEAPPCNGYWYGKPGMDLVGA
D2ZVE4_NEIMU          HGMTEIVRIHRDVLDGK---------TALADALPELERLTTGTLVDGYWHGQPGIEAVKE
C6M2H4_NEISI          HGMAEIVRIHRDVLDGK---------TALADALPELERLTTGTLVDGYWHGRPGIEAVKE
F0F2I8_9NEIS          HGMAEIVRIHRDVLDGK---------TALADALPELERLTTGTLVDGYWHGQPGIEAVKE
E7RTW0_9BURK          HDMPEIIRLHRDVLDGK---------ATWADVQPELTRLAVGTPVDGYWRGLPGIEALKE
B9YZ31_9NEIS          QHCAEVVQAFRAVIDGQ---------AAAGELLSGLAAKSRDPLVDGYWLGQPGIVNTQG
D5CMY6_SIDLE          QHMNEIIAAFDAARKGE---------MPQPDTHD----WSANGLVDGYWFGDAGIARHET
Q47JW4_DECAR          QHINEIIAAFDAARLGE---------AVQVDSRD----WSTSGLVDGYWFGDAGIVQRHT
C7RPT3_ACCPU          QAMSAIIAAFDAARHAR---------AVDPDTAG----WASEGLVNGYWFGEAGIVRHPP
G8QJ00_AZOOP          AHTAAIVAAFERARRGE---------EVAEQPQ-----WAEHGLCDGYWFGRAGIDLAAA
C1DBA3_LARHH          QDTLAVAAAFRRASTG----------SVDADFAT----LAHAPLCNGYWHARAGIDLT--
A0A179TGV9_ALCXX      AGTLEAIAALDAARGGR---------APEAVQ--PPAGISR---CNGYFHGQAGIAWQEA
B2UJJ7_RALPJ          RGTLDAVAALDAQRRGE---------PAPAVQ--PPEGIGR---CNGYWHGRSGIDWLET
A9ITK8_BORPD          QNTLQAVAALDQIRRGL---------PLQPVA--PPEGIDR---CNGYWHGRAGIDYLEN
Q46R27_CUPPJ          TGTLDAVAALAAIRSGT---------RPPAPSGVLPAGAEP---SNGYWHGRPGIAWEAR
Q0JYR3_CUPNH          SGTLQVVQQLAAIRAGE---------QAPAASGITPTGAQP---CNGYWHRSAGIAWEAR
A1K2D5_AZOSB          AHTRGIIEHFRATLDGR---------QTPAEALAASSAHMPAAPCNGFWHGRPGVEQFVP
Q5P3F9_AROAE          EHTIRVLELFRESADGR---------LAPQEAFRRSAEWMVEAPCNGFWYGRPGVEQYVP
B9MDK0_ACIET          QHMAEVIAAFDAARKAP---------QPDAGALDRMRPLMPEAPCNGYWHGKPGLDLVQP
A0A0H2WJG0_BURMA      QHMIDVIDAYHGVLSGR---------TDAGDALAALHGRMPEASCNGYWHGKPGLEHVAR
A4G5P8_HERAR          QHNERIIDAFDRVRHGR---------MLPDAAMAAVQKWMPDQPCNGYWNGKPGMDQTEQ
Q3SGV5_THIDA          RHMGRVVEAFAAALNG------------DGWDAAALQRAMPGAAIDGYWHGRAGLEYLRE
D3RRV1_ALLVD          RHTADVVRTFADCLTGD---------LDPAEGTARLRGWASSGLCDGYWTGESGYKVGMP
B1Y7Z7_LEPCP          QGFARVLTLFDQVLNHG--------EPAADAIAELATLGLPGALVNGYAHRQPGLEEISA
F3LQZ3_9BURK          QHFSTVVACFEQVMNQG--------APAAAARRELEAIALPGGLANGYAQGRAGMEWKAA
Q11MV2_CHESB          ADMVEVARTYRALLDGR-------QDPQSARFLLSCLELPGV-MVDGYAYGKPGWEATAS
N0B3H5_9RHIZ          CDMVQVARIYRSLLEGN-------EEPERARVLLSNLDLPGA-LVDGYARGRAGAEPVAS
F2J405_POLGS          VDMVAVARTYRALLDGD-------MSPADAESALTAMDLPGP-VCNAYLAGEAGWRHVTL
Q0ALZ9_MARMM          VDMVRVAAAFRHFLDDQ-------IAPLELKNSLKADVLDRP-VINGYLGGRPGMEWSTQ
B4W960_9CAUL          GDMPAVARAFRAYADGL-------CDPDGLLQRLQELNPSVA-FVSGYLHGLAGVAGTR-
B0T0Q4_CAUSK          GDMGKVIGGFRAYADGE-------LTPADLATAILAADPPGP-LVNGYLQGQAGARWTAR
A0A1I3R5M4_9RHOB      GAFDSLVSGYADRLSGK-------ISGQDLVSKLEAFDPAMD-LSDGFLTGAFGAEWSAE
D5AU36_RHOCB          GDFNGLCQGYADRLAGK-------VSPADLVAKLLPEAPGGR-FADGFFDGPSGSDWQHR
A0A2V4NA95_9RHOB      GDFTAVCAQYRARIDGH-------VARGAVADALLAAYPDRH-LSDGFLTGARGADWSGP
Q3J0P8_CERS4          GDMVALARAFDAAIAAG-------GATEDLEAAARAVAPGGQ-LANGYLHARAGAEWIDA
A5FTZ7_ACICJ          LDMVEISTLYRAVLDGI-------YDAKEGLTRLRELTAQLP-FVNGYLHGRAGMDWQP-
E3HZN6_RHOVT          VDMVEVARLFRDTLDGK-------LAPAEAEAKLRPLTEPVP-YVNGFYYGRVGLSWND-
K2IGT7_9RHOB          VDMVAVAQVFRDAVDGR-------LSMSEADARLAALSGDAR-LSNGFYHGAAGYRRIA-
D0CT21_RUELI          VDMVTVAEVYRAVLDQS-------MSTEAAEARLRQVCADTP-FSNGFYHGQAGYRRIA-
A0A327JLQ5_9RHIZ      VDMVAVAKVYRAAMDGD-------ITAAEGHETLKDLVGDTP-LANGFFYQQPGYRFID-
A0A1V0PVB2_9RHOB      CDMIAVTRLYDDVLQGR-------IGAGEGAARLRELGIDAP-FVNGFYHGKSGHEWVA-
C3M9K2_SINFN          CDMVAVASLYDDVLNGR-------TDAEGGIARLRQLYPAAP-LSNGFHHGQEGAAWVA-
A6X3L9_BRUA4          CDMVEVAHIHDEVLNRS-------ISPEDGIARLRTVYPGVP-LSNGFLHGNIGAAWIS-
B6JBV7_OLICO          CDMVAVAKVFRDLLDGR-------RTQENGMQELTRIYPDVP-FVNGFIHGQPGAVLTTK
B6ISC6_RHOCS          VDMVAVATLFRDVMDGR-------MPAIDAYKELEKLVTFAP-FSNGYVSGVEGFRFTH-
V6F8W1_MAGGM          VDMVAVAGLFRAAADGL-------IDAEEAGQRLTELCPRAE-FANGYFHGREGHAYVQ-
A0A0H3G2P4_ZYMMA      GDMVATASLFRQCLAGQ-------IDATEASTLLASYHPEMPGFANGFLYGQPGHKFITD
Q2RRC1_RHORT          MDMGAVAGIYRALLDGA-------LEADVAQERLITLLGDRA-VANGFYYGIEGSSFAA-
A0A1G7ZNK3_9PROT      MDMVAVAQVYRGLLDGA-------IEPAEAHQRLKPLLADRE-VCNGFYHETAGVNWIEA
A0L5V3_MAGMM          KNMVAVVALWKQAVAGK-------ISGAEARQKLIELNRGQD-FCNGYFHGRAGLDFVDA
                                                                                  

UBIV_ECOLI            ----------------------
Q8D1C9_YERPE          ----------------------
A0A2S3XHU4_9GAMM      ----------------------
A7MUV8_VIBCB          ----------------------
A5KZ90_VIBBS          ----------------------
A0A0B8QBD2_9VIBR      ----------------------
A0A241PCF5_VIBAN      ----------------------
Q5E7K9_ALIF1          ----------------------
C9P199_VIBME          ----------------------
F2GAN4_ALTMD          NQTHSRVMS-------------
Q5QWK8_IDILO          ----------------------
A0A1Y5E148_COLPS      ----------------------
Z5XKZ2_9GAMM          ----------------------
Q086E9_SHEFN          PNTPAG----------------
Q8EHH3_SHEON          ----------------------
A1S498_SHEAM          ----------------------
D4ZB16_SHEVD          ----------------------
B1KRL6_SHEWM          ----------------------
A3QGQ6_SHELP          ----------------------
C7RCX0_KANKD          ----------------------
C5BJ04_TERTT          ----------------------
A4BKD7_9GAMM          ----------------------
B7J8F4_ACIF2          QGH-------------------
A0A0C5VGH4_9GAMM      ----------------------
Q2SJY5_HAHCH          PQETSNLS--------------
Q9HXA1_PSEAE          EAGLC-----------------
A1WVU7_HALHL          ETGMAE----------------
K4KPK2_SIMAS          E---------------------
A0A1B8P623_HALEL      RTAP------------------
K0CIF7_ALCDB          ----------------------
A1U5A2_MARHV          ----------------------
D2ZVE4_NEIMU          EYYGVA----------------
C6M2H4_NEISI          EYYGVA----------------
F0F2I8_9NEIS          EYYGVA----------------
E7RTW0_9BURK          ESHALA----------------
B9YZ31_9NEIS          ADHARA----------------
D5CMY6_SIDLE          APSRR-----------------
Q47JW4_DECAR          QALAQLGA--------------
C7RPT3_ACCPU          AVAATEEGIGT-----------
G8QJ00_AZOOP          ATTELHAGA-------------
C1DBA3_LARHH          ----------------------
A0A179TGV9_ALCXX      L---------------------
B2UJJ7_RALPJ          PR--------------------
A9ITK8_BORPD          LS--------------------
Q46R27_CUPPJ          P---------------------
Q0JYR3_CUPNH          A---------------------
A1K2D5_AZOSB          A---------------------
Q5P3F9_AROAE          S---------------------
B9MDK0_ACIET          AVTS------------------
A0A0H2WJG0_BURMA      ----------------------
A4G5P8_HERAR          ALQVGDM---------------
Q3SGV5_THIDA          EPC-------------------
D3RRV1_ALLVD          TQGRLG----------------
B1Y7Z7_LEPCP          ----------------------
F3LQZ3_9BURK          ----------------------
Q11MV2_CHESB          I---------------------
N0B3H5_9RHIZ          P---------------------
F2J405_POLGS          ----------------------
Q0ALZ9_MARMM          ----------------------
B4W960_9CAUL          ----------------------
B0T0Q4_CAUSK          S---------------------
A0A1I3R5M4_9RHOB      AS--------------------
D5AU36_RHOCB          FRPDRPSLSWPRR---------
A0A2V4NA95_9RHOB      LP--------------------
Q3J0P8_CERS4          ----------------------
A5FTZ7_ACICJ          -------SRAG-----------
E3HZN6_RHOVT          -------RHAA-----------
K2IGT7_9RHOB          -------MAAPV----------
D0CT21_RUELI          -------QASLA----------
A0A327JLQ5_9RHIZ      -------GDAVVH---------
A0A1V0PVB2_9RHOB      -------EDLVPA---------
C3M9K2_SINFN          ------RARNIGHRGAE-----
A6X3L9_BRUA4          ------RQRSAAAN--------
B6JBV7_OLICO          GTEENLRQRKAQAGTMVHEAGQ
B6ISC6_RHOCS          -------PEMVSDLGA------
V6F8W1_MAGGM          -------AEV------------
A0A0H3G2P4_ZYMMA      GPVLNPSPLKKTESA-------
Q2RRC1_RHORT          ----------------------
A0A1G7ZNK3_9PROT      AS--------------------
A0L5V3_MAGMM          SMIQSEQLD-------------