CLUSTAL format seed alignment for MF_02234

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

S4XMX9_SORCE          --MRHFLTTMDYTRAEIEGLLERAQRFKRRP----------LEPRLKDRTIALVFFNPSL
A9GL64_SORC5          --MRHFLTTMDYTRAEIEGLLERAQRFKRRP----------IEPRLKDRTIALVFFNPSL
AOTC_XYLFA            MALKHFLNTQDWSCSELNALLTQARAFKHNK----------LGNGLKGKSIALVFFNASM
Q3REX4_XYLFS          MALKNFLNTQDWSCSELNALLTQARAFKHNK----------LGNALKGKSIALVFFNPSM
AOTC_XANCP            MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
G0CG84_XANCA          MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A3R7G3K2_XANCA      MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
D4T6H1_XANCI          MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
G7TIE8_XANOB          MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELNGKSIALVFFNPSM
AOTC_XANAC            MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A2K2RAU8_XANCI      MSLKHFLNTQDWSRAELDALLTQAALFKRNM----------LGSELKGKSIALVFFNPSM
W4S5N0_9XANT          MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A0A3WII7_XANCH      MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A563JKH7_XANVA      MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A125PWB3_XANCT      MSLKHFLNTQDWSRAELDALLTQAALFKRNR----------LGSELKGKSIALVFFNPSM
A0A0G3LR80_XANCT      MSLKHFLNTQDWSRAELDALLTQAALFKRNK----------LGSELKGKSIALVFFNPSM
A0A0K2ZFF0_XANCT      MSLKHFLNTQDWSRAELDALLTQAALFKRNR----------LGSELKGKSIALVFFNPSM
D2U8N7_XANAP          MSLKHFLNTQDWSRTDLDALLTQAALFKRNR----------LGSELKGRSIALVFFNPSM
A0A2W6J7J1_STEMA      MSPKHFLNTQDWSRSELDALLTQAALFKRNK----------LGDQLKGKSIALVFFNPSM
A0A2J0V2D2_STEMA      MSPKHFLNTQDWSRSDLDALLTQAALFKRNK----------LGDQLKGKSIALVFFNPSM
B2FME2_STRMK          MSPKHFLNTQDWSRSDLDALLTQAALFKRNK----------LGDQLKGKSIALVFFNPSM
M5CP89_STEMA          MSPKHFLNTQDWSRSELDALLTQAALFKRNK----------LGDQLKGKSIALVFFNPSM
A0A427BZM3_9GAMM      MSLKHFLNTQDWSRPELDALLTQAALFKQNK----------LGDQLKGKSIALVFFNPSM
A0A1J1EKL3_LYSEN      --MKHFLNTQDWSRADLDALLAQAAAFKRNK----------FGDQLKGRSVALVFFNPSM
A0A0S2DF31_LYSEN      --MKHFLNTQDWSRADLDALLAQAAAFKRNK----------LGDQLKGKSIALVFFNPSM
E6WSC3_PSEUU          MSLKHFLNTQDWSRPDLDALLAEAAAFKRNK----------LGSELKGRSIALVFFNPSM
A0A0A0ELS5_9GAMM      MTPRHFLNTQDWSRPDLDALLLQAAAFKRDK----------LGDQLKGRSIALVFFNPSM
A0A0S1AZ11_9GAMM      MSVKHFLNTQDWSRAELDALLTQAAMFKRNK----------LGDDLKGRSIALVFFNPSM
G7UUH4_PSEUP          MALKHFLNTQDWSRADLDALLTQAALFKRNK----------LGNELKGKSVALVFFNPSM
A0A087ML92_9GAMM      --MKHFLNTQDWSRAELDAVLAEAAAFRQGK----------ASQALKGKSIALVFFNPSL
A0A372DMI5_9GAMM      --MKHFLNTQDCSRSELDALLALAARFRRAGRGGASAGLPLPEQPLRGKAIALVFFNPSL
A0A410UH90_9GAMM      MSLRHFLTTQDYNRAEIDALLEQAAVFKRSP----------CGQQLAGKSMALLFFNPSM
A0A316IB75_9GAMM      MALRHFLTTQDYSRAEIDALLEQAAAFKRSP----------RGQQLAGKSVALLFFNPSM
I4WVL0_9GAMM          MTLRHFITTQDYSRAEIDALLEQAAAFKRSP----------AGAQLAGKSVALLFFNPSM
H8L3H6_FRAAD          MTIRHFLTTQDYSRREIDELLDQAAEFKRSP----------QGRQLAGKAVALLFFNPSM
A0A1T5G4A3_9GAMM      MTVRHFLNTQDYSRAEIDALLEQAAEFKRSP----------QGQQLAGKSIALMFFNPSM
A0A1I0MD22_9GAMM      MTVRHFLSTQDYSRAEIDALLEQAAAFKRSP----------QGQQLAGKSIALMFFNPSM
A0A3R7QTI4_9BACT      -MNMHFLETQDWXWDELDQMLQHASXLKDTP----------LQPLLEXKSXALLFFNPSL
K6H476_9GAMM          --MRNFITTQNWSRSELQDVLDLASDLKNKP----------HQPLLKNKSVAMLFFNPSL
A0A2D8WT91_9GAMM      --MKHFLSTNDWTESEIQEILNFAKKLKKDP----------YQPLLKNKSVAMLFFNPSS
A0A368BDU8_9GAMM      --MKNFITTSEWSKDELQDLLDYASFLKKEK----------FHKTLENKSVALLFFNPSM
A0A1Z9R0Q9_9GAMM      --MKNFISTQDWSKAELQEILDYAKDLKKNK----------FQQTLKNKSVALLFFNPSM
A0A2E6QZJ6_9GAMM      --MKNFITTKDWSXSEIQEILXYSXELKINK----------FXNILKNKSVALLFFNPSM
C7R8V0_KANKD          --MQHFLTTEHWSKPDLQQILDFAKDLKQSP----------IQPLLKNKSIALLFFNPSL
A0A2N1WIP3_9GAMM      --MKNFLTTADHDRATLQGLLDRAEAIRREP----------ISNALAGKSIALLFLNPSL
Q0AST0_MARMM          --MRHFLSTADWTRNELQGLLDRASAFKSGTV----------SRSLEGKSVALVFFNPSL
E0TIE3_PARBH          --MKHFLTTEDWPREDLEQLLVDADRLR-GLK----------DQSLKGKTAALIFFNPSL
                          :*: * .     :: :*  :  ::                 *  :: *::*:*.* 

S4XMX9_SORCE          RTRTSFDVGIRELGGHAVVLEPGRGAWPIEFEEGAVMDGEPEEHIQEVARVLSRYADLIG
A9GL64_SORC5          RTRTSFDVGIRELGGHAVVLEPGRSAWPIEFEEGIAMDGEPEEHIQEVARVLSRYADLIG
AOTC_XYLFA            RTRSSFELGAFQLGGHAIVLQPGKDAWPIEFDTGTVMEAETEEHICEVARVLGHYVDLIG
Q3REX4_XYLFS          RTRSSFELGAFQLGGHAIVLQPGKDAWPIEFDTGTVMEAETEEHICEVARVLGHYVDLIG
AOTC_XANCP            RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
G0CG84_XANCA          RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A3R7G3K2_XANCA      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
D4T6H1_XANCI          RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
G7TIE8_XANOB          RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
AOTC_XANAC            RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A2K2RAU8_XANCI      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
W4S5N0_9XANT          RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A0A3WII7_XANCH      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A563JKH7_XANVA      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A125PWB3_XANCT      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A0G3LR80_XANCT      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A0K2ZFF0_XANCT      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
D2U8N7_XANAP          RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFDLGTVMDGETEEHIAEVARVLGRYVDLIG
A0A2W6J7J1_STEMA      RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAKVLGRYCDIIA
A0A2J0V2D2_STEMA      RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAKVLGRYCDIIA
B2FME2_STRMK          RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAKVLGRYCDIIA
M5CP89_STEMA          RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAKVLGRYCDIIA
A0A427BZM3_9GAMM      RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAKVLGRYCDIIA
A0A1J1EKL3_LYSEN      RTRTSFELGTFQLGGHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
A0A0S2DF31_LYSEN      RTRTSFELGAFQLGAHAIVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLGRYVDLIG
E6WSC3_PSEUU          RTRTSFELGAFQLGGHAIVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVARVLARYVDLIG
A0A0A0ELS5_9GAMM      RTRTSFELGAFQLGAHAVVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVAQVLGRYVDLIG
A0A0S1AZ11_9GAMM      RTRTSFELGAFQLGGHAIVLQPGKDAWPIEFDLGTVMDGDTEEHIAEVAKVLGRYVDLIG
G7UUH4_PSEUP          RTRTSFELGTFQLGGHAVVLQPGKDAWPIEFDLGAVMDGEAEEHIAEVAQVLGRYADIVA
A0A087ML92_9GAMM      RTRTSFEIGAFQMGGHAVVLQPGKDAWPIEFELGTVMDGEAEEHIAEVARVLSRYVDLVA
A0A372DMI5_9GAMM      RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFELGTVMDGEAEEHIAEVARVLSRYADLIG
A0A410UH90_9GAMM      RTRTSFELGAFHLGGHAIVLSPGKDAWPIEFRPNVVMDGEAEEHIAEVARVLSRYVDLIA
A0A316IB75_9GAMM      RTRTSFELGAFHLGGHAIVLSPGKDAWPIEFEPGRVMDGEPEEHIAEVARVLSRYVDLIA
I4WVL0_9GAMM          RTRTSFELGAFQLGGHAVVLSPGKDAWPIEFEVGTVMDGDTEEHVAEVARVLSRYVDLIA
H8L3H6_FRAAD          RTRTSFELGAFQLGGHAVVLAPGKDAWPIEFEVGTVMDGDTEEHIAEVAQVLSRYADLIA
A0A1T5G4A3_9GAMM      RTRTSFELGAFHLGGHAVVLSPGKDAWPIEFEVGTVMDGDTEEHIAEVAQVLSRYADIIA
A0A1I0MD22_9GAMM      RTRTSFELGAFQLGGHAIVLSPGKDAWPIEFEVGSVMDGDTEEHIAEVARVLSRYVDLIA
A0A3R7QTI4_9BACT      RTRTSFELGAWQLGAKAIVLEPGKSAWGMAFDDGAIMDGDAEEHISEAARVLSTYCDAIA
K6H476_9GAMM          RTKTSFELGISELSGTAIILQPGKDAWPIEFGDNIVMDGESEEHVKEVAQVLSSYCDCIA
A0A2D8WT91_9GAMM      RTRTSFEVGISELSGKAIVLQPGKDAWPIEFEENIVMDGAAEEHVKEVAKVLAXYCDCIA
A0A368BDU8_9GAMM      RTRTSFEVGINELGGYAVILHPGKDAWPIEFKPNTIMDGDNEEHIIEVAKVLSDYCDLIA
A0A1Z9R0Q9_9GAMM      RTRTSFELGIQELGGYAIVLHPGKDAWPIEFKXNTXMDGESEEHIIEVAKVLSEYCDXIA
A0A2E6QZJ6_9GAMM      RTRTSFXLGIQQLGGMAVVLHPGKDAWPIXFKLDQIMDNESEEHIKEVAQVLSEYCDLIA
C7R8V0_KANKD          RTRTSFEIGIEQLGGHAVVLQPGKDAWPIEFELGSVMDGEAEEHVKEVAQVLSSYCDLIA
A0A2N1WIP3_9GAMM      RTRSSFEIGAFQLGAHAVVLEPGKAAWGIEFERGVVMDGSAEEHIAEVAGVLSRYCDAIA
Q0AST0_MARMM          RTRTSFDIGTQRLGGHAIVLDAKGATWPMEFGEGAVMDGDKEEHVREAARVLSSYVDLIA
E0TIE3_PARBH          RTRASFQVAMIEMGGNALVLDTAG-TWSLEVEPGAMMDQGAEEHVKEAARVLSTYVDVIC
                      **::** :.  .:.. *::* .   :* : .  .  *:   ***: *.* **. * * : 

S4XMX9_SORCE          VRAFPKFQRWEEDRQDKVLQGFARHATVPVVNLETITHPCQELALALAMKERLG--RLDG
A9GL64_SORC5          VRAFPKFQRWEEDRQDKVLQGFARHATVPVINLETITHPCQELALALAMKERLG--RLDG
AOTC_XYLFA            VRAFPKFLDWTYDRQDIVLNGFAKYSPVPVINMETITHPCQELAHIMALQEHFGTTDLRG
Q3REX4_XYLFS          VRAFPKFLDWTYDRQDIVLNSFAKYSPVPVINMETITHPCQELAHIMALQEHFGTTDLRG
AOTC_XANCP            VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTPDLRG
G0CG84_XANCA          VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
A0A3R7G3K2_XANCA      VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
D4T6H1_XANCI          VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
G7TIE8_XANOB          VRAFPKFVDWSKDREDQVLKSFARYSPVPVINMETITHPCQELAHALALQEHFGTPDLRG
AOTC_XANAC            VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
A0A2K2RAU8_XANCI      VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
W4S5N0_9XANT          VRAFPKFVDWSKDREDQVLRSFAKYSPVPVINMETITHPCQELAHAMALQEHFGTQDLRC
A0A0A3WII7_XANCH      VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
A0A563JKH7_XANVA      VRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQELAHVLALQEHFGTPDLRG
A0A125PWB3_XANCT      VRAFPKFVDWSKDREDLVLKSFARYSPVPVINMETITHPCQELAHALALQEHFGSQDLRG
A0A0G3LR80_XANCT      VRAFPKFVDWSKDREDLVLKSFARYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
A0A0K2ZFF0_XANCT      VRAFPKFVDWSKDREDLVLQSFARYSPVPVINMETITHPCQELAHALALQEHFGSPDLRG
D2U8N7_XANAP          VRAFPKFVDWAKDREDQVLKSFAKYSPVPVINMETITHPCQELAHALALQEHFGTQDLRG
A0A2W6J7J1_STEMA      VRAFPKFIDWAYDRQDIVLNSFARYSPVPVINMETITHPCQELAHIMALQEHFGTQDLRG
A0A2J0V2D2_STEMA      VRAFPKFIDWAYDRQDIVLNSFARYSPVPVINMETITHPCQELAHIMALQEHFGTQDLRG
B2FME2_STRMK          VRAFPKFIDWAYDRQDIVLNSFAKYSPVPVINMETITHPCQELAHVMALQEHFGTQDLRG
M5CP89_STEMA          VRAFPKFQDWAYDRQDIVLNSFARYSPVPVINMETITHPCQELAHIMALQEHFGTQDLRG
A0A427BZM3_9GAMM      VRAFPKFVDWAYDRQDIVLNSFAKYSPVPVINMETITHPCQELAHVMALQEHFGTQDLRG
A0A1J1EKL3_LYSEN      VRAFPKFVDWAYDRQDVVLKAFAKYSPVPVINMETITHPCQELAHALALQERFGTTDLRG
A0A0S2DF31_LYSEN      VRAFPKFVDWAYDRQDVVLKAFAKYSPVPVINMETITHPCQELAHALALQERFGTTDLRG
E6WSC3_PSEUU          VRAFPKFKDWSYDREDRVLKAFAKYSTVPVINMETITHPCQELAHALALQEHFGTTDLRG
A0A0A0ELS5_9GAMM      VRAFPKFVDWSIDRQDRVLESFAKYSPVPVINMETITHPCQELAHVMALQEHFGTSDLRG
A0A0S1AZ11_9GAMM      VRAFPKFVDWQYDRQDIVLKAFAKYSPVPVINMETITHPCQELAHALALQEHFGSSDLRG
G7UUH4_PSEUP          VRAFPKFVDWAIDRQDRVLKSFARYCPVPVINMETITHPCQELAHIMALQEHFGSSDLRG
A0A087ML92_9GAMM      VRAFPKFQDWSVDRQDTVLRSFAKYSTVPVINLETITHPCQELAHALALQTHFGTPDLRG
A0A372DMI5_9GAMM      VRAFPKFLDWAQDRRDTVLRGFAQYATVPVINMETITHPCQELAHALALQEHFGTTDLRG
A0A410UH90_9GAMM      VRAFPKFQDWSVDREDAVIKAFAQYATVPVINMETITHPCQELAHALALKERFG--DLSG
A0A316IB75_9GAMM      VRAFPKFQDWSVDREDKVIKAFAQYATVPVINMETITHPCQELAHALALRERLG--DLTR
I4WVL0_9GAMM          VRAFPKFQDWAVDRQDTVIKAFAKYATVPVINMETITHPCQELAHALAMKEHLG--SLQN
H8L3H6_FRAAD          VRAFPKFQDWAVDREDRVLKAFARYATVPVINMETITHPCQELAHAMALREHLG--DLQN
A0A1T5G4A3_9GAMM      VRAFPKFVDWQVDRQDIVLKAFARYASVPVINMETITHPCQELAHALAMKEHLG--DLQN
A0A1I0MD22_9GAMM      VRAFPKFVDWSVDRQDKVLNAFARYATVPVINLETITHPCQELAHALALKEHLG--DLQN
A0A3R7QTI4_9BACT      VRAFPMFEDWSVDRQDRVIQGFAKYANVPVINMETITHPCQELAHALTLREWFGTNDLRG
K6H476_9GAMM          VRAFPKFQDWAIDRTDHVINSFAKYSSVPVVNMETIEHPCQELAHLLTLQEHYG--DLQG
A0A2D8WT91_9GAMM      XXAFPLFKNWQKXRLDNVIKSFAKYSSVPVVNMETIEHPXQELAHILTLQEHYG--DLKG
A0A368BDU8_9GAMM      VRAFPKFQNVDEDISDIILRSFAEHSSVPVVNMESITHPCQELAHILTMQEKLG--DLSN
A0A1Z9R0Q9_9GAMM      XRAFPKFINLEEDLSDKVINSFAKYSXVPVVNMETITHPCQELAHIMTMQEHFG--DLSG
A0A2E6QZJ6_9GAMM      VRAFPKFEXLEEDLSDNVIKSFAKYSSXPXINMETXTHPCQELAHILTLQEKFG--DLSG
C7R8V0_KANKD          IRAFPKFVDWQKDKLDTLLNSFAQFASVPVINMETITHPCQELAHIMTLQEKLG--DLQG
A0A2N1WIP3_9GAMM      LRAFPLFQDWSVDREDRVIRALAAHATVPVINMETIVHPCQELALMRTIQDHLG--RPDN
Q0AST0_MARMM          IRCFPEFKDWQSEREDPLIEAFAKHATVPVINMETIVHPCQELAHMLALQERMG--PIAD
E0TIE3_PARBH          IRCFPKFQDWSVDRQDRLLHAFAEYATVPIVNMETIVHPCQELAHMLAVKDRLG--APDG
                        .** *        * ::..:* ..  * :*:*:  ** ****   :::   *      

S4XMX9_SORCE          KKFVLTWTYHPRPLNTAVANSAVLIASKLGMDVTLLCPTEEYHLDERYLDAARKSAADNG
A9GL64_SORC5          KKFVLTWTYHPRPLNTAVANSAVLIASKLGMDVTLLCPSEEYHLDERYLDAARKSAEGNG
AOTC_XYLFA            KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDERYIDWAQQNIADTG
Q3REX4_XYLFS          KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDERYIDWARQNIADTG
AOTC_XANCP            KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESG
G0CG84_XANCA          KKYVLAWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESG
A0A3R7G3K2_XANCA      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESG
D4T6H1_XANCI          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDQRYMDWAAQNVAESG
G7TIE8_XANOB          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDQRYMDWAAQNVAESG
AOTC_XANAC            KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDQRYMDWAAQNVVESG
A0A2K2RAU8_XANCI      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDQRYMDWAAQNVVESG
W4S5N0_9XANT          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDPRYMDWAAQNVAESG
A0A0A3WII7_XANCH      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDQRYMDWAAQNVAESG
A0A563JKH7_XANVA      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYVLDQRYMDWAAQNVAESG
A0A125PWB3_XANCT      KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDQRYMDWAAQNVAESG
A0A0G3LR80_XANCT      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYVLDQRYMDWAAQNVAESG
A0A0K2ZFF0_XANCT      KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDQRYMDWAAQNVAESG
D2U8N7_XANAP          KKYVLTWTYHPKPLNTAVANSALTIATRLGMEVTLLCPTPDYLLDERYMGWAAQNVAESG
A0A2W6J7J1_STEMA      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTADYILDDRYMGWAEQNVAESG
A0A2J0V2D2_STEMA      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTADYILDDRYMGWAEQNVAESG
B2FME2_STRMK          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTADYILDDRYMGWAEQNVAESG
M5CP89_STEMA          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTADYILDERYMGWAEQNVAESG
A0A427BZM3_9GAMM      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTADYILDERYMGWAEQNVAENG
A0A1J1EKL3_LYSEN      KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPEYVLDERYMGWAEQNVAESG
A0A0S2DF31_LYSEN      KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDERYMGWAEQNVAESG
E6WSC3_PSEUU          KKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPEYILDERYIGWASQNVAESG
A0A0A0ELS5_9GAMM      RKFVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTLEYILDERYMGWAAQNVAESG
A0A0S1AZ11_9GAMM      KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPDEQYILDERYMGWAAQNVAESG
G7UUH4_PSEUP          KKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPEYILDERYMGWARDNVDESG
A0A087ML92_9GAMM      KKFVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTAEYALDERYLGWARDNVAESG
A0A372DMI5_9GAMM      RKYVLTWTYHPKALNTAVANSALTIATRLGMDVTLLCPTPEYVLDERYMGWAAANVAESG
A0A410UH90_9GAMM      RKYVLTWTYHPKPLNTAVANSALLIATKMGMDVTLLCPTPDYVLDERYMAFGEQNARENG
A0A316IB75_9GAMM      KKYVLTWTYHPRPLNTAVANSALLIATKMGMDVTLLCPTPDYVLDERYMQAGYENAQANG
I4WVL0_9GAMM          KKYVLTWTYHPKPLNTAVANSALLIATKMGMDVTLLCPTPDYVLDERYMAFGRLNAEQNG
H8L3H6_FRAAD          KKYVLTWTYHPKPLNTAVANSALLIATKLGMDVTLLCPSPDFVLDERYMAYGEENARQNG
A0A1T5G4A3_9GAMM      KKYVLTWTYHPKPLNTAVANSALMIATRMGMDVTLLCPTPEYILDERYMEFAKQNAAENG
A0A1I0MD22_9GAMM      KKYVLTWTYHPKPLNTAVANSALLIATKMGMDVTLLCPTPEYILDERYMEFARTNARENG
A0A3R7QTI4_9BACT      KKYVMTWVPHPKPLNTAVANSAVRIATRAGMDVTLLCPDERWLLDDRYLNDARTNAASSG
K6H476_9GAMM          KNYLLTWTYHPKPLNTAVANSSLLIASKFGMNVKLLCPSEQYHLDDRYINAAKDNCSMEG
A0A2D8WT91_9GAMM      RDYLLTWTYHPXPLNTAVANSSLMIASKFGMNVTLLCPSEXYLLDDRYLKRAKEECEKAG
A0A368BDU8_9GAMM      KNYLLTWTYHPKPLNTAVANSSLLVASKFGMNIKLLCPNKDYILHESFISEAQSNCKKNK
A0A1Z9R0Q9_9GAMM      KDYLLTWTYHPKPLNTAVANSSLMIASKFGMNVKLLCPNEEYLLHQNYLEQAQKNCDVNG
A0A2E6QZJ6_9GAMM      KNYLLTWTYHPKALNTAVANSALMIASKFGMNVKLLCPXXDYLLHESFXDXANLQCTKNK
C7R8V0_KANKD          KKYVLTWTYHPKPLNTAVANSALMIASKFGMDVTLLCPTPDYVLDEHYMQSAQNNCNQNH
A0A2N1WIP3_9GAMM      RKFVLTWTWHPRPLNTAVANSALLIASKFGMDITLLIPDPAYRLDPKFMDSAAAFAAESG
Q0AST0_MARMM          KTYLLTWVPHPKPLNTAVANSSLLIASKFGANVRILVPDEAYRLDERYMSAAERFTAEGG
E0TIE3_PARBH          KKYVLTWTYHPKPLNTAVANSSLLIATKFGMDVTLLCPTEEYLLDPRFMSASEENVKRSG
                      : ::::*. ** .********:: :*:: * :: :* *   : *.  :   .        

S4XMX9_SORCE          RKLSITYDIESAYRGAHVVYAKSWGAIPYFGRWEQEKPIRDRHKHFIVDEQKMALTAGGL
A9GL64_SORC5          QKLSITYDIKSAYEGAHVVYAKSWGAIPYFGRWEQEKPIRDKNKHFIVDEQKMALTAGGL
AOTC_XYLFA            STFQVSHDIDNAYRGADVIYAKSWGALPFFGNWAMEKPIRDQYRHFIVDEAKMALTNNAV
Q3REX4_XYLFS          STFQVSHDIDNAYRGADVIYAKSWGALPFFGNWAMEKPIRDQYRHFIVDEAKMALTNNAV
AOTC_XANCP            GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
G0CG84_XANCA          GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
A0A3R7G3K2_XANCA      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
D4T6H1_XANCI          GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
G7TIE8_XANOB          GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
AOTC_XANAC            GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
A0A2K2RAU8_XANCI      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKLIRDQYQHFIVDERKMALTNNGV
W4S5N0_9XANT          GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
A0A0A3WII7_XANCH      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
A0A563JKH7_XANVA      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGV
A0A125PWB3_XANCT      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWGPEKPIRDQYQHFIVDERKMALTNNGV
A0A0G3LR80_XANCT      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWGPEKPIRDQYQHFIVDERKMALTNNGV
A0A0K2ZFF0_XANCT      GSLQVSHDIDSAYAGADVVYAKSWGALPFFGNWGPEKPIRDQYQHFIVDERKMALTNNGV
D2U8N7_XANAP          GSLTISHDIDSAYAGADVVYAKSWGALPFFGNWGPEKPIRDQYQHFIVDERKMALTNNGV
A0A2W6J7J1_STEMA      GSLKISHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQFKHFIVDERKMALTNNGV
A0A2J0V2D2_STEMA      GSLKISHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQFKHFIVDERKMALTNNGV
B2FME2_STRMK          GSLKISHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQFKHFIVDERKMALTNNGV
M5CP89_STEMA          GSLKISHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQFKHFIVDERKMALTNNGV
A0A427BZM3_9GAMM      GSLKISHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYKHFIVDERKMALTNNGV
A0A1J1EKL3_LYSEN      GSLRVSHDIESAYAGADVVYAKSWGALPYFGNWAPEKPIRDQYKHFIVDEAKMALTNNGV
A0A0S2DF31_LYSEN      GSLKVSHDIDSAYKDADVVYAKSWGALPYFGNWGPEKPIREQYKHFIVDEAKMALTDNGV
E6WSC3_PSEUU          GSFQVSHDIEDAYRGADVVYAKSWGALPYFGNWEPEKPIRDQFKHFIVDEQKMALTNNGV
A0A0A0ELS5_9GAMM      GSLAVSHDIDSAYAGADVVYAKSWGALPYFGNWAPEKPIRDRYRHFIVDEAKMARTNDGV
A0A0S1AZ11_9GAMM      GSLTVSHDIESAYRGADVVYAKSWGALPYFGNWAPEKPIRDQYKHFIVDEAKMALTNNGV
G7UUH4_PSEUP          GSIQVSHDIDSAYANADVVYAKSWGALPYFGNWDREKPIREQYRHFIVDQAKMALTNNGV
A0A087ML92_9GAMM      GSFRMSHDIEEAYTGADVVYAKSWGAIPYFGRWDQEKPIRDAHKHFIVDEAKMALTNRGV
A0A372DMI5_9GAMM      GSLQVSHDIESAYAGADVVYAKSWGALPYFGRWEAEQPVRDRYRHFIVDEAKMALTNDAV
A0A410UH90_9GAMM      GSLKVSHNIEEAYRGADVVYAKSWGALPFFDRWEQEKPIRDAHKHFIVDEAKMALTHNGV
A0A316IB75_9GAMM      GSLKVSHDIEEAYSGADVVYAKSWGALPFFGRWEQEKPIREAHRHFIVDEAKMALTHHGL
I4WVL0_9GAMM          GSLKVSHDIEEAYSGAHVVYAKSWGALPYFGKWEQEKPIRDAHKHFIVDEAKMALTDHGL
H8L3H6_FRAAD          GSLQVSHDIEAAYRGADVVYAKSWGALPFFGQWEGEKAIREASKHFIVDEAKMALTNQAV
A0A1T5G4A3_9GAMM      GSLQVSHDIESAYSGAHVIYAKSWGAIPYFGRWDEEKAIRDANKHFIVDEAKMALTDNGL
A0A1I0MD22_9GAMM      GSLQVSHDIESAYSGAHVIYAKSWGAIPYFGRWDEEKAIRDANKHFIVDEAKMALTDNGL
A0A3R7QTI4_9BACT      GSFQISHDL-SAYDDADVVYAKSWGCLPLXGQAXAQSEAASAXQHFIVDEAKMARTNHAA
K6H476_9GAMM          TAFDISYNIENGYSGADIVYAKSWGSLNLYGDTEKQIASNSQFKHFIVDSKKMGYTNNAV
A0A2D8WT91_9GAMM      STFAVSHDIERAYSGKEIVYAKSWGSLVNYGNPEIQSAENEQHKHFIVDGQKMNLTNNAV
A0A368BDU8_9GAMM      KSFSIHHDIKEAYEGADIVYAKSWGSLNYYGSVEDEKLIRDKYKHFIVDQEKMDHTNKAL
A0A1Z9R0Q9_9GAMM      TSFQITHNIEEGYRNAHIVYAKSWGSLNYYGNPEEEKLIRDDFKHFIVDEQKMSLTKDAK
A0A2E6QZJ6_9GAMM      MTFEITHDIXXGYKDADIVYAKSWGSINFYNDPENEKIIRXKYKXFIVDSXKMNMTNNGV
C7R8V0_KANKD          QNLTVTHNIEEAYTGAEIVYAKSWGALPYFGQWEKEKIIRDQYKHFIVDEKKMAMTNQGL
A0A2N1WIP3_9GAMM      GSLEVTTDIETAYSGADWVYAKSWGALPLYGRPEEEAKLRAPFRHFMVDGAKMALTANAR
Q0AST0_MARMM          GSVSLMTDVEAAYDGADVVYAKSWGALPFYGNWGDEAPLRAKGADFMITPEKMALTNNAT
E0TIE3_PARBH          GSLTISHDPQTAYRDADVVYAKSWGALPYFGRWEEEKPIRDAHRHFRVDEDKMALTNNAL
                        . :  :   .* . . :******.:   .    :         * :   **  *  . 

S4XMX9_SORCE          FSHCLPVRRNVKVTDAVIDSPASMVIDEAENRLHVQKAVMDVLANGW-------------
A9GL64_SORC5          FSHCLPVRRNVKVTDAVIDSPASMVIDEAENRLHVQKAVMDVLANGW-------------
AOTC_XYLFA            FSHCLPLRRNVKATDAVMDGPNCIAIHEAGNRLHVQKAIMAALASQ--------------
Q3REX4_XYLFS          FSHCLPLRRNVKATDAVMDGSNCIAIHEAGNRLHVQKAVMAALASQ--------------
AOTC_XANCP            FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG---QSRP--------
G0CG84_XANCA          FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG---QSRP--------
A0A3R7G3K2_XANCA      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG---QNRP--------
D4T6H1_XANCI          FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG---QGSRDS------
G7TIE8_XANOB          FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG---QGRRDS------
AOTC_XANAC            FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALAS---QAGIGNRE----
A0A2K2RAU8_XANCI      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALAS---QAGIGNRE----
W4S5N0_9XANT          FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALAS---QAGIGNRE----
A0A0A3WII7_XANCH      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALAS---QAGIGNRD----
A0A563JKH7_XANVA      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALAL---QGGIGNWD----
A0A125PWB3_XANCT      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAVMAALV---RDSGRGTRDS---
A0A0G3LR80_XANCT      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAVMAALV---RDSGRGTRDS---
A0A0K2ZFF0_XANCT      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAVMAALVGQRRDQGPGTGSR---
D2U8N7_XANAP          FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAVMAALVR---DAGRDTRDA---
A0A2W6J7J1_STEMA      FSHCLPLRRNVKATDGVMDSPQCIAINEAENRLHVQKAIMAAVAGR--------------
A0A2J0V2D2_STEMA      FSHCLPLRRNVKATDGVMDSPQCIAINEAENRLHVQKAIMAAVAGR--------------
B2FME2_STRMK          FSHCLPLRRNVKATDAVMDSPQCIAINEAENRLHVQKAIMAAVAGR--------------
M5CP89_STEMA          FSHCLPLRRNVKATDAVMDSPQCIAINEAENRLHVQKAIMAAVAGR--------------
A0A427BZM3_9GAMM      FSHCLPLRRNVKATDGVMDSPQCIAINEAENRLHVQKAIMAAVAGR--------------
A0A1J1EKL3_LYSEN      FSHCLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAVMAALIGQ--------------
A0A0S2DF31_LYSEN      FSHCLPLRRNVKATDGVMDSPNCIAIEEAENRLHVQKAVMAALI----------------
E6WSC3_PSEUU          FSHCLPLRRNVKATDAVMDSPNCIAIEEAENRLHVQKAVMAALVRGR-------------
A0A0A0ELS5_9GAMM      FSHCLPLRRNVKATDAVMDSPRCIAINEAENRLHVQKAIMAALVKSQGGSRPAAVSP---
A0A0S1AZ11_9GAMM      FSHCLPLRRNVKATDAVMDSPQCIAIDEAENRLHVQKAIMAALVR---------------
G7UUH4_PSEUP          FSHCLPLRRNVKATDAVMDSPQCIAIDEAENRLHVQKAIMAALVAQGATTRDPGPGTRDR
A0A087ML92_9GAMM      FSHCLPLRRNVKATDAVMDSPQCIAIDEAENRLHVQKAVMAALATQ--------------
A0A372DMI5_9GAMM      FSHCLPLRRNVKATDAVMDSPRCLAIDEAENRLHVQKAVMTTLAGGQ-------------
A0A410UH90_9GAMM      FSHCLPLRRNIKVTDAVMDSPACIAVDEAENRLHVQKAVMASLIAQH-------------
A0A316IB75_9GAMM      FSHCLPLRRNVKATDAVMDAPYCIAVDEAENRLHVQKAVMAALAGQG-------------
I4WVL0_9GAMM          FSHCLPLRRNIKATDAVMDSPACIAIDEAENRLHVQKAVMALLAGQG-------------
H8L3H6_FRAAD          FSHCLPLRRNVKATDAVMDSPACIAIDEAENRLHVQKAVMAALIGQG-------------
A0A1T5G4A3_9GAMM      FSHCLPLRRNIKATDAVMDSPACIAIDEAENRLHVQKAVMASLISHASGAKSGLGF----
A0A1I0MD22_9GAMM      FSHCLPLRRNVKATDAVMDSPACIAIDEAENRLHVQKAVMASLISQ-PGTTSGLGF----
A0A3R7QTI4_9BACT      FSXCLPARRNVKATDAVMDAPTSLIIPEAENRLHVQKALMARLLAPTPVHL---------
K6H476_9GAMM          FSHCLPLRRNIKATDEVMDSDYCLAINEAANRKHVQKAMLSKIL----------------
A0A2D8WT91_9GAMM      FSHCLPLRRNIKATDEVMDAKYCLAVKEAANRKHVQKSLLTNIL----------------
A0A368BDU8_9GAMM      FSHCLPLRRNIKATDEVMDSNYCVAIQEAQNRKHVQKSLLTKLIGKKL------------
A0A1Z9R0Q9_9GAMM      FSHCLPLRRNIKATDAVMDSDSCVAIQEAGNRLHVQKSLLTKLLKD--------------
A0A2E6QZJ6_9GAMM      FSHCLPLRRNVKATDAVMDSDYCLAIEEAGNRLHVQKSLLTNLLGDLTK-----------
C7R8V0_KANKD          FSHCLPLRRNVKATDAVMDADYCVAIQEAENRLHVQKSLMNSLVNHHSS-----------
A0A2N1WIP3_9GAMM      FSHCLPLRRNIKASDEVMDANYCAALDEAENRLHVQKALMLELMGG--------------
Q0AST0_MARMM          VSHCLPMRRNVKIADAVVDSPAFMGIEEAANRLPVQMAVMEALAGQAGGAE---------
E0TIE3_PARBH          FSHCLPLRRNVKVTDAVADSPQSMIIEEAANRLPVQKAVLQRLLKGN-------------
                      .* *** ***:* :* * *.     : ** **  ** :::  :