CLUSTAL format seed alignment for MF_02235

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SOTC_BACF6            -------MKKFTCVQDIG-DLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRL
Q5LI27_BACFN          -------MKKFTCVQDIG-DLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRL
Q64Z33_BACFR          -------MKKFTCVQDIG-DLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRL
SOTC_BACTN            -------MKKFTCVQDIG-DLKSALAEAFEIQKDRFKYVELGRNKTLMMIFFNSSLRTRL
A6LE76_PARD8          -------MRHFTCVQDLG-DLKQALNEAFEIKKDRFQFSELGKNKTLLMIFFNSSLRTRL
G8UN80_TANFA          --------MNFTKVKDIG-DVRQAVKEALELKKNRFQYHEAGKNKTALLIFFNNSLRTRL
D8DU58_PREBR          -------MKSFFNVQDLG-NLDTALTEALEVKKNRFGYQELGKNKTLLMIFFNNSLRTRL
C6W245_DYAFD          -------MKHFLSIKDVT-DLPQLITSGIAAKKDPFADQALGKNKTIGLLFFNSSLRTRI
A1ZXA8_9BACT          -------MKHFITSADTD-SVPQLVQKALDVKRNPRRYDQLGRYKTLGLLFFNPSLRTRL
C6XX91_PEDHD          -------MNQFTSVNDVQ-DIGQLVKDALALKENPYAHQHLGKNKTLGLVFLNPSLRTRL
H8KSK7_SOLCM          -------MKHFTSVHDIP-NLNQWVNEALKIKSDPLGFVDIGGQKTLGLVFLNPSLRTRM
Q11QI9_CYTH3          -------MKNFISVKDVT-DIPGLVKEALELKKNPYAFKKLGENKTIGLIFLNPSLRTRI
A3HSU0_9BACT          MDSVSPSILQFTQFESQA-LGQQLIDKALYYKADPRIDIQKGMGKRIGCIFLNPSLRTRV
G0J5P5_CYCMS          -------MKNFTKFENID-LANKLIDKALAFKKDPLVNAVKGNGKRIGLIFLNPSLRTRM
E4TPD4_MARTH          -------MQNFIKFETQS-TAEKLIQSALQFKEKPFLQKELGKELRIGLIFLNPSLRTRV
A8Z5X7_SULMW          -------MKQFISVNDVK-DVKKLIYKAIELKKNTFLSKTIGNNKTIGLVFFNPSLRTRL
F0RCX1_CELLC          -------MKNYVSITNID-SLPNWVDEALEIKKNPKKYKNLGEDKTIVLLFFNNSLRTRL
A4AU33_MARSH          -------MKNYLSINDID-SLTTLMEEAKALKENPRAFSNLGTNKTIGLLFFNNSLRTRL
G2PLE5_MURRD          -------MKHYLTVNDIA-SLPDWVDEAINLKKDPYQFEGLGKRKTICLLFFNNSLRTRL
C0BGP3_FLABM          -------MKNYLTIDDLP-NLDNAVAEALTLKKDPYKYNNIGKNKTLGMLFFNPSLRTRL
F6GDE5_LACS5          -------MKKYTNIKDIS-NLQETIKEAILLKMNPFEFQELGKNKTLVMLFFNASLRTRL
Q26D80_FLABB          -------MKKYTELKDIK-DLSQLVNEAISLKQTPYEFQHLGKNKTLVMLFFNASLRTRL
A3XM38_LEEBM          -------MKKYTGLDDIT-DLQELIAEARALKANPYAYEHLGKRKRLVMLFFNSSLRTRL
A2U1U2_9FLAO          -------MKKYTSINDIS-DINDWIAEAKELKANPLQNIEIGKNKTLGLLFFNSSLRTRL
A5FEC2_FLAJ1          --------MNYISIKDID-SLSKWVKSAIKIKKDPLKNKKLGKNKTLGMLFFNPSLRTRL
A0M373_GRAFK          -------MKNYITLSDID-NLENLISEARSLKSK-NTVPDLGKGKTLGMLFFNSSLRTRL
F4L5T0_HALH1          -------MKNFTSAKDVT-DLAGLVQLARDIKADPFKFRDAGKEKTMVLLFFNPSLRTRL
A4CJ57_ROBBH          -------MKHFCTTDDIT-ELADWLHLGNRLRAEPDLLAHLGRGKTLCLLFFNNSLRTRL
A0A2S7T987_9FLAO      -------MKHYLSIDDLK-QPHSAIEQALQLKTNPLQNSGLGKGKTLILLFFNNSLRTRL
Q1D265_MYXXD          -------MKHVTHIKDLGPEGVEAVLAQAAAWKQKGPEHALFANTLLGMVFFNPSLRTRT
Q08Q32_STIAD          -------MKHLTHIRDLGPEGVETILAQAAAWKGKAPE-PLFLGRILGMVFFNPSLRTRA
                                              :                        :*:* ***** 

SOTC_BACF6            STQKAALNLGMNVIVLDINQGAWKLETERGVIMDGD-KPEHLLEAIPVMGCYCDIIGVRS
Q5LI27_BACFN          STQKAALNLGMNVIVLDINQGAWKLETERGVIMDGD-KPEHLLEAIPVMGCYCDIIGVRS
Q64Z33_BACFR          STQKAALNLGMNVIVLDINQGAWKLETERGVIMDGD-KPEHLLEAIPVMGCYCDIIGVRS
SOTC_BACTN            STQKAALNLGMNVMVLDINQGAWKLETERGVIMDGD-KPEHLLEAIPVMGCYCDIIGVRS
A6LE76_PARD8          STQKAAMNLGMNTIVLDVNQGAWKLETERGVIMDGD-KPEHLLEAVPVMGCYCDVIGVRS
G8UN80_TANFA          STQKAATNLGMNVIVLDVNQGAWRLETEREVVMDGD-KSEHLLEAIPVMGCYCDIIGVRS
D8DU58_PREBR          STQKAAMNLGMNVIVLDVNAGAWKLETERGVIMDGD-KSEHLLEAIPVMGSYCDLIGVRS
C6W245_DYAFD          STQKAAQNLGLNVITMNVGQDGWGLEMEEGVIMNGD-KAEHVKEAAAVIGSYCDIIGIRS
A1ZXA8_9BACT          STQKAAQNLGMSVMVMNFDKDGWQLETEEGIVMNGG-NAEHVKEAAAVIGQYCDIVGLRT
C6XX91_PEDHD          SAQKAALNLGMNVMVMNMDKEGWALETQDGVVMNGT-TVEHIREAAAVMGQYCDVLGLRS
H8KSK7_SOLCM          STQKAAMNLGMNTMVINMDKEGWRLEMNDNVIMDGF-TVEHIKEAAAVLGQYCDVLGLRC
Q11QI9_CYTH3          STQKAAKNLGMDTIVMNMDKEGWALETQDGVIMNHN-TVEHIREAAAVMGQYCDIIGVRS
A3HSU0_9BACT          STQIAASNLGVEPIVLNMDKEGWALEMREGAIMNKG-TVEHIKDAAGVLGTYFDILAIRA
G0J5P5_CYCMS          STQLAASNLGVESFVLNMDKESWALEMQDGAVMNQN-KVEHIKDAAAVLGGYFDILAIRA
E4TPD4_MARTH          STQIAAKNLGMEAIVFNIDKEGWALEFEEGVIMNEN-KAEHIKEAASVLGSYFDILAIRA
A8Z5X7_SULMW          SSQKAAFNIGCNTWILNINSDSWKIETSDGSVMNSTHTQEHIKEAIGVMSLYCDILAVRT
F0RCX1_CELLC          STQKAAQNLGMEVIVMNFGSEGWTLEFTDGTVMDQG-KSEHVKEAAQVVSQYCDVIGIRA
A4AU33_MARSH          STQKAAMNLGLEVIVMNFGSEGWALEYGDGTIMNQG-TSEHIKEAAQVISQYCDIIGIRA
G2PLE5_MURRD          STQKAAMNLGMEVMIMNFGNEGWALEYGDGTIMDQG-TSEHIKEAAQVVSQYADIVAIRA
C0BGP3_FLABM          STQKAAQQLGIHTMIMNFSNEAWALEFEDGTEMSGL-RSEHIKEAAAVVSQYCDIVAIRA
F6GDE5_LACS5          STEKAAKNLGMNVMVLNVN-DAWNLEFEDGTIMNAN-TSEHIKEAAAVISQYADVIAVRA
Q26D80_FLABB          STEKAAKNLGLEVQILNVN-DSWKLEFDDGTVMNAD-TSEHVKEAAQVISQYADVIAVRA
A3XM38_LEEBM          STEKAASNLGMDVTVMNFNSDAWKLEFEDGTVMNAD-TSEHVKEAAKVISQYGDVIAVRA
A2U1U2_9FLAO          STQKAALNLGMEPIVMNVSGDAWGIEFEDGTVMNGS-TAEHIKEAAAVVSQYCDVIAVRA
A5FEC2_FLAJ1          STQKAALNLGMNVMVMNFTNEGWTLEFEDGAVMNSG-ASEHIKEAAEVVSQYCDIIAIRA
A0M373_GRAFK          STEKAAKLLGMEVMTMNVDKDGWTLEFEDGAVMNSD-KAEHIKEAAAVLSQYCDIIAVRA
F4L5T0_HALH1          STEKAALNLGMQVISMNAD-QGWTLEFEEGAIMNAG-SAEHVKEAAAVVSQYADIIGIRT
A4CJ57_ROBBH          STQKAAQLLGMEVMVMNFGSEGWSLEYTDGTVMDQG-TAEHIREAAPVVAQYADLIGIRA
A0A2S7T987_9FLAO      STAKAAQNLGLDVLSLNVGADSWQLEFTDGTIMDQG-KAEHIREAVPVLCQYGDLIGLRS
Q1D265_MYXXD          SFEAVMLRGGGNAIILDVGSGVWKLEHREGAVMNAD-RAEHLKEAAPVLSRFVDMLGVRT
Q08Q32_STIAD          SFESVMLRGSGNAIVMDVGSGVWKLEDRPGAVMNGD-RAEHIKEAAPVLSRFVDMLGVRT
                      *   .    .     ::     * :*      *.     **: :*  *:  : *::.:* 

SOTC_BACF6            FARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTA------
Q5LI27_BACFN          FARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTA------
Q64Z33_BACFR          FARFESREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTA------
SOTC_BACTN            FARFEDRDFDYQETILNQFIQYSGRPVFSMEAATRHPLQSFADLITIEEYKKTA------
A6LE76_PARD8          FARFENKEDDYNEKILSQFIEHSDRPVFSMEAATRHPLQSFADLITIEEYKKTA------
G8UN80_TANFA          FARFENKEDDYSEKILQQFIRYSGRPVFSMEAATRHPLQSFADLITIEEYKRTE------
D8DU58_PREBR          FAGLSDREYDYAETIVNQFVKYSGRPVFAMETATVHPLQAFADLITIHEKWEELKSNPAT
C6W245_DYAFD          FAGLKDRDKDYAEIVFQQFKKYAQVPIVNLESATRHPLQSLADCITIEEFKLKK------
A1ZXA8_9BACT          FARLQDAQADYEEKVIHQFRQYAGVPVVSLESEIRHPLQSLTDLLTIEYHRAKAKLS---
C6XX91_PEDHD          FPKLLNRDEDYNEDFFNKFIKYCKVPVVSLESATRHPLQSLADLVTIKETWKAGG-----
H8KSK7_SOLCM          FPNLKDRNEDYSEEVLNKFIKYCGVPVVSLESATRHPLQSFADLITIKEMATKS------
Q11QI9_CYTH3          FPRLVDKNEDYSEDFFNKFIKYAGVPIVSLESATLHPLQSLADLITIEETKTKP------
A3HSU0_9BACT          FPSLTNKEEDMNDFVFSQFVKYSGIPVISLESATRHPLQSLADQITIREHSSGIK-----
G0J5P5_CYCMS          FPTLTNKDEDTNDFVINQFIKYSGVPVVSLESAIRHPLQSLADMVTIKENFKEKR-----
E4TPD4_MARTH          FPTLTDKKQDMADKVIHQFIKYSQKPVVSLESSSRHPLQSLADMMSIKETWKNVS-----
A8Z5X7_SULMW          FPGLIDREYDSKEILLKKIINYSKVPVVNLESATLHPLQSLADLITIEEFNKIKK-----
F0RCX1_CELLC          FANLQDKEEDEAELVINGFIKHATVPILNMESSVGHPLQALADAITLAENNTKP------
A4AU33_MARSH          FAGLTDKEKDESEVVLNGFKKYASVPILNMESSVGHPLQALADAITIAENNTKK------
G2PLE5_MURRD          FAGLVDKEKDEAEEVINGFAKYASIPVVNMESSVGHPLQALADAITLKENETKK------
C0BGP3_FLABM          FASLTDKESDETEKVMHNFAKYASIPVVNMESATAHPLQALADAITIKEHSTIK------
F6GDE5_LACS5          FPSLTDKKKDESEFVMNSFIKYATVPIVNMESATAHPLQALADAITITELTEKA------
Q26D80_FLABB          FPSLVDKEKDAQEVVLNSFIKYASVPVVNMESATAHPLQALADVITMEELKTKK------
A3XM38_LEEBM          FPTLTDKAKDESEYVISNFVKYATVPVVNMESATAHPLQALADAITITELSEKK------
A2U1U2_9FLAO          FPSLTDKQKDESEQVLSAFVKHASVPIISMESATGHPLQGLTDAITISENCKKK------
A5FEC2_FLAJ1          FAGLVDKEKDYQETVISGFLKYATVPIVNMESAVRHPLQSLADAITMEEYKTKH------
A0M373_GRAFK          FPGLKNKEKDESEQVLNSFKKYASVPVINLESATGHPLQALTDAITIQELKKKD------
F4L5T0_HALH1          FPGLKDREKDYSEQVIEAFKKYASAPIISLESATRHPLQSLADVLTIEEFKKKD------
A4CJ57_ROBBH          FAGLKDREADYAEMVLQGFVQHAGIPVLNMESATAHPLQALADALTIEQFREKD------
A0A2S7T987_9FLAO      FGELQSLEEDLREPVLEAFKALSDKPLINLESAFAHPLQALADAMTLQETFGST------
Q1D265_MYXXD          FSQGGGDEEDELDPVINAFRKWSTVPVVSMESAREHPCQGLADMLTLRETFGNTK-----
Q08Q32_STIAD          FSAGGDDEQDEVDPVISAFRRHVTVPLVSMESAREHPCQGLADMLTLRENFGSTK-----
                      *    .   *  : ..  :      *:. :*:   ** *.::* :::             

SOTC_BACF6            -----RPKVVMTWAPHPRPLPQAVPNSFAEWMNATD----YEFVITHPEGYELDPKFVGN
Q5LI27_BACFN          -----RPKVVMTWAPHPRPLPQAVPNSFAEWMNATD----YEFVITHPEGYELDPKFVGN
Q64Z33_BACFR          -----RPKVVMTWAPHPRPLPQAVPNSFAEWMNATD----YEFVITHPEGYELDLKFVGN
SOTC_BACTN            -----RPKVVMTWAPHPRPLPQAVPNSFAEWMNATD----YDFVITHPEGYELAPQFVGN
A6LE76_PARD8          -----RPKVVMTWAPHPKSLPQAVPNSFAEWMNATD----YEFVITHPEGYELDPRFVGN
G8UN80_TANFA          -----RPKIVLTWTPHPRALPQAVPNSFAEWINAAG----YELVITHPEGYELDPQFVGT
D8DU58_PREBR          APTKKRPKVVLTWAPHCKALPQAVPNSFAEWMNAAD----VDLVITHPKGYELDPKFAGN
C6W245_DYAFD          -----RPKVVLTWLPHFKALPQAVANSFCEWMNPMD----VELVITHPEGYDLSPDFVGK
A1ZXA8_9BACT          ----GRPKVVLSWAPHIKALPQAVANSFLEWTALMD----YEVMLTHPTGAELSPEFTQG
C6XX91_PEDHD          -----KPKVVLAWAPHIKALPQAVPNSFAEWMCKAQEEGMLDFTIAQPKGYELSEDFTPG
H8KSK7_SOLCM          -----KPKVVLTWAPHVKPLPQAVSNSFSEWMIKAQELDMVDFVITHPEGYELAEEFTKG
Q11QI9_CYTH3          -----RPKVVLTWAPHIKALPQAVANSFSEWMCKAD----VEFVITHPEGYDLANEFTNG
A3HSU0_9BACT          -----KPKIVLTWGPHIKAIPHAVANSFAEWSLGMG----HDLTITHPAGYELSEKFTKG
G0J5P5_CYCMS          -----KPKVLLTWAPHIKAIPHAVANSFSEWSIGCG----HDLTITHPHGYELDSKFTKG
E4TPD4_MARTH          -----KPKIVLSWAPHVKALPHAVPNSFAEWTLGLG----HDLTITQPQGYELEEQFTKG
A8Z5X7_SULMW          -----KVKIVLSWAPHIKALPQSVPNSFIEWVKKLKN---IKLYITNPDGYNLNSNFTNG
F0RCX1_CELLC          -----KPKVVLSWAPHPKALPHAVANSFIEMMHLQ----DADFVITHPKGYELNTNITKG
A4AU33_MARSH          -----RPKVVLSWAPHPKALPHAVANSFVEMMKLQ----DAEFVITHPKGYELNPEITDG
G2PLE5_MURRD          -----RPKVVLSWAPHPKALPHAVANSFTQMMKLQ----DADFVITHPEGYELNPEITKG
C0BGP3_FLABM          -----RPKIVLTWAPHPKALPHAVANSFTRMVQKL----DAEFVIAHPDGYTLDPKITKS
F6GDE5_LACS5          -----KPKVVLSWAPHPKALPQAVANSFVEMMQNM----DVELTITHPEGYELNKDVVKN
Q26D80_FLABB          -----KPKVVISWAPHPKALPQAVANSFIEVMLMA----NVDLTITHPLGYELSDEIVKD
A3XM38_LEEBM          -----KPKVVLSWAPHPKALPHAVANSFIGMMQKM----DVELTVTHPKGYELSDATMKD
A2U1U2_9FLAO          -----KVKVVLSWAPHIKPLPHAVANSFTQAMQKM----DVEFVIANPKGYNLNKEITKD
A5FEC2_FLAJ1          -----KPKVVLSWAPHPKALPQAVANSFVEMMQMQK---DMDFVITHPEGYELSPEITQD
A0M373_GRAFK          -----KPKIVLSWAPHPKALPQSVPNSFTEMMQKL----DVEFVITNPEGYDLNPEIRKE
F4L5T0_HALH1          -----RPKVVVSWAPHVRALPQAVPNSFVEWMKIA----NVDLVVTNPEGYELADEFMDG
A4CJ57_ROBBH          -----RPKVVLSWAPHPRALPQAVPNSFAKMMQALP----VDLTITHPEGYELAPEFTGG
A0A2S7T987_9FLAO      -----KPKITLSWAPHPRPLPQAVPTSFLRMMKTLG----ADIQVCHPPGYELNAALTEG
Q1D265_MYXXD          -----KLPVTLTWAPHIKPLPKAVPNSFLLSAAAAG----CEIRVAHPPGFDLHPAVRAE
Q08Q32_STIAD          -----KLPVTLTWAPHIKPLPKAVPNSFLLTAAAAG----CEVRVAHPPGFELHPQVRAE
                           :  : ::* ** :.:*::*..**             .. : :* *  *       

SOTC_BACF6            A-----------RVEYDQMKAFEGADFIYAKNWAAYTGDN---YGQILS---TDRNWTVG
Q5LI27_BACFN          A-----------RVEYDQMKAFEGADFIYAKNWAAYTGDN---YGQILS---TDRNWTVG
Q64Z33_BACFR          A-----------RVEYDQMKAFEGADFIYAKNWAAYTGDN---YGQILS---TDRNWTVG
SOTC_BACTN            A-----------KVEYDQMKAFEGADFIYAKNWAAYTGDN---YGQILS---KDREWTVS
A6LE76_PARD8          A-----------KVEYDQKKAFEGADFIYAKNWSAYKDPN---YGQVIS---TDRSWTVD
G8UN80_TANFA          A-----------RVEHNQRKAFEGADFIYAKNWAAYKDPH---YGEVLS---TDRSWTVD
D8DU58_PREBR          A-----------TIEYDQKKALEDADFVYAKNWSCPGVTNPEDYGKIIN---KDMSWTID
C6W245_DYAFD          G-----------QVIYDQDKALEGADFVYGKNWSSY--NS---YGQVLN---TDPSWMIT
A1ZXA8_9BACT          V-----------TIEYDQKKALKGADFVYIKNWSSF--SN---YGQVIQ---A-PDWKIT
C6XX91_PEDHD          A-----------NITYNLDEALAGADYIYVKNWSSYK-----EYGKVLT---YPEGWMLN
H8KSK7_SOLCM          A-----------KITTNQNEALKDADFVYVKNWSSYS-----KYGEILT---DGKGWMID
Q11QI9_CYTH3          A-----------RIEYNQDKALEDADYVYVKNWSSYE-----DYGKVHS---MDSHWMMT
A3HSU0_9BACT          A-----------TIEYNQKKALQDADFVYVKNWSGFN-----DYGKIIS---TDPSWMLT
G0J5P5_CYCMS          A-----------KIEYDQTKALAEADFVYVKNWSAFS-----PYGKILS---VPGDWLLN
E4TPD4_MARTH          A-----------EIEYDQEKAVADADFVYVKNWSSYH-----DYGKLPK---VEGDWLLK
A8Z5X7_SULMW          I-----------KFIKNQNEAFKNADFIYAKNWSSYD-----NYGKILC---KDLSWTIT
F0RCX1_CELLC          A-----------TIEYDQEKALENADFVYVKNWSSYQ-----NYGQVLN---QDKNWTIT
A4AU33_MARSH          I-----------TIETDQEKALENADFISVKNWSSYA-----EYGQVLN---QDPTWMMT
G2PLE5_MURRD          C-----------TIEYNQDEALKDADFVYVKNWSSYS-----DYGKVLS---KDTNWTIT
C0BGP3_FLABM          T-----------PLYRNQEEAFEGADFVYAKNWCSYT-----DYGKVLR---TDNSWMLT
F6GDE5_LACS5          T-----------PVNLNQEEALKDADFVYVKNWSSYK-----DYGKILS---QDENWMMT
Q26D80_FLABB          T-----------PVIYDQEEALKEADFVYVKNWSSYT-----DYGKILS---QDASWMMT
A3XM38_LEEBM          T-----------PVVYDQDEALKDADFVYVKNWSNYE-----DYGKVLATVDSHSSWTIT
A2U1U2_9FLAO          T-----------PIYHNQEEAFKNADFVYAKNWSSYE-----SYGEILD---VDDNWTIT
A5FEC2_FLAJ1          C-----------KIEYDQDKAFENADFVYVKNWSNFN-----DYGKVTN---SDPNWTVT
A0M373_GRAFK          T-----------RVEHDQEKAFENADFIYVKNWSSYE-----NYGQVLN---VEKNWTVN
F4L5T0_HALH1          V-----------QLEYDQQKAFAGADFIYAKNWSSYR-----EYGQILS---QDETWRIT
A4CJ57_ROBBH          L-----------SPEYNQEKALEGADFVYVKNWSSYS-----DYGAILS---QDPAWMMT
A0A2S7T987_9FLAO      I-----------EVRSDQAACLAESDVVYAKSWCSTE-----QYGQHLP---IEESWTIS
Q1D265_MYXXD          AEAYAKATGGSVTYTHDQDEALAGSRAVYAKSWGPTAAAAF-SPNDVSALLASYSGWMPT
Q08Q32_STIAD          AEAYAKATGGSITYTHDQAEALAGSHAVYAKSWGPATRSAH-TAGDVSALLASHADWMTT
                                      :   ..  :  :  *.*           .           *   

SOTC_BACF6            DRQMAV-TNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Q5LI27_BACFN          DRQMAV-TNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Q64Z33_BACFR          DRQMAV-TNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
SOTC_BACTN            DRQMAV-TNNAFFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLIEGLE
A6LE76_PARD8          AKKMAL-TNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISAQTVLKKILMGLS
G8UN80_TANFA          TEKMAL-TNQAFFMHCLPVRRNLIVTDEVIESPQSLVIPQAANREISAQTVLKRMLDGLQ
D8DU58_PREBR          TEHMSW-TNNGYFMHCLPVRRGLIVTDDVIESNHSLVIPEAANREISAEVVIKRMLESL-
C6W245_DYAFD          EAKMAL-TDNGKFMHCLPVRRNMKVADEVLDGPRSLVIEQAANREWSAQAALKEVLLGL-
A1ZXA8_9BACT          QEKMAL-TNRAKLMHCLPVRRNLVIDDAVLDSAQSIVIEQAGNRETAAQTVLIELLKYLQ
C6XX91_PEDHD          NDKLKE-TNDAKVMHCLPVRRDLELSSEILDGPNSLVIHEAGNRLWAAQAVLKQMLEKL-
H8KSK7_SOLCM          NEKLKL-TDNAKVLHCLPVRRGLELADEILDGPNSLVIHEAGNRVYAAQTALKKLIEINR
Q11QI9_CYTH3          NEKLKL-TNNAKVMHCLPVRRGIELADEILDGPNSLVIQEASNRVWSAQAVLKRMLEAQG
A3HSU0_9BACT          EKHFVN-APNAKVMHCLPVRRNLELSDEILDGPRSLVQKQAENRIYAAQSVISHLI----
G0J5P5_CYCMS          DAKFGD-NKHAKVMHCLPVRRNLELSDEILDSERSLVQNQAKNRIFAAQSVIDSML----
E4TPD4_MARTH          DHQL---KKGAKIMHCLPVRRNLELADELLDGNKSLVPLQAENRIYAAQAVLFEIISNME
A8Z5X7_SULMW          NKKMKL-SNNAKFMHCLPVRRNLVVEDSVLDDKNSLVLNQAENRIFATQTVFLEILENI-
F0RCX1_CELLC          LKKLGA----AKFMHCLPVRRNVIVEDAVLDSNQSLVIEQANNRTFAAQIALKKILENQ-
A4AU33_MARSH          KEKLGN----AKFMHCLPVRRNVVVEDAVLDCDQSLTIEQANNRTFAAQIILKKIVENL-
G2PLE5_MURRD          KEKLGN----AKFMHCLPVRRNMIVEDAVLDSEQSLVVEQAKNRIFSAQIVLKKILEDI-
C0BGP3_FLABM          AEKLKNT-NHAKFMHCLPVRRNIVVSDDVLDSPNSLVIEQANNRTFSAQVVLKKIIENG-
F6GDE5_LACS5          KTKLGA----AKFMHCLPVRRNVIVEDAVLDSEQSVVMQQANNRTFSAQIVLKQILEKL-
Q26D80_FLABB          QKKLGN----AKFMHCLPVRRNVVVEDAVLDSENSIVIEQANNRTYAAQVVLKNILEYIE
A3XM38_LEEBM          DEKLGD----AKFMHCLPVRRNVIVADEVLDGEQSVVIEQANNRTFSAQVVLKKILENLN
A2U1U2_9FLAO          KDKIGD----AKFMHCLPVRRNVVVEDAVLDSDNSLVIKQANNRTYAAQLVLKKILENV-
A5FEC2_FLAJ1          AEKMALT-NNGKFMHCLPVRRNVIVSDEVLDGENSIVIEQANNRTYSAQLVLQKILKKI-
A0M373_GRAFK          QKKLEPS-NNAKVMHCLPVRRNMVIADDVLDSENSIVIHQANNRTFAAQAVLKQLLKDED
F4L5T0_HALH1          QDKMVNWANNAYFMHCLPVRRNVVVEDAVLDGPNSIVIKQANNRTWAAQAVVKRVLEGL-
A4CJ57_ROBBH          AKKLGE----AQLMHCLPVRRNVVVADDALDGGRSLVLQQAANRTLSAQLALAHLIQSNS
A0A2S7T987_9FLAO      LEKLKE----AYFMHCLPVRRNVVVQDAVLDSSKSLVIEQANNRTYSAQWVLQELLKSKE
Q1D265_MYXXD          RLTMSRAQKDAAFLHCLPVRRNVEVADEVLDHPSSRVVDEAGNRYHVQRALLHWMRSR--
Q08Q32_STIAD          RKTLEQAAADALFLHCLPVRRNVEVADDVLDHPSSRVIDGAENRFHVQRSILSWLLSA--
                         :      . .:*******.: : .  ::   * .   * **       .  :     

SOTC_BACF6            --------------
Q5LI27_BACFN          --------------
Q64Z33_BACFR          --------------
SOTC_BACTN            --------------
A6LE76_PARD8          NL------------
G8UN80_TANFA          STA-----------
D8DU58_PREBR          --------------
C6W245_DYAFD          --------------
A1ZXA8_9BACT          TQDEPSDLAQSLIL
C6XX91_PEDHD          --------------
H8KSK7_SOLCM          I-------------
Q11QI9_CYTH3          --------------
A3HSU0_9BACT          --------------
G0J5P5_CYCMS          --------------
E4TPD4_MARTH          S-------------
A8Z5X7_SULMW          --------------
F0RCX1_CELLC          --------------
A4AU33_MARSH          --------------
G2PLE5_MURRD          --------------
C0BGP3_FLABM          --------------
F6GDE5_LACS5          --------------
Q26D80_FLABB          --------------
A3XM38_LEEBM          --------------
A2U1U2_9FLAO          --------------
A5FEC2_FLAJ1          --------------
A0M373_GRAFK          --------------
F4L5T0_HALH1          --------------
A4CJ57_ROBBH          --------------
A0A2S7T987_9FLAO      L-------------
Q1D265_MYXXD          --------------
Q08Q32_STIAD          --------------