CLUSTAL format seed alignment for MF_02239

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HEMJ_HELPY        ---------------------------------MGFLNGYFLWVKAFHVIAVISWMAALF
HEMJ_HELPJ        ---------------------------------MEFLSGYFLWVKAFHVIAVISWMAALF
D5V480_ARCNC      -------------------------------------MEYYSWILAFHVISVLSWMAMLF
D1AZ15_SULD5      -------------------------------------MEYYKWVLAFHVMAFLSWMAMLF
Q30TK9_SULDN      ---------------------------------------MYSWIVWFHILSFISWYAVLF
Q0PBE8_CAMJE      --------------------------------MTEWINDYYFWIKWVHYLAFVSWMAGLF
Q5GT75_WOLTR      -----------------------------------------------------MWMAGML
Q3YT07_EHRCJ      ------------------------------------MIDYKHWIEAFHIISIITWMAGML
B9KHD2_ANAMF      --------------------------------MLTWICAYHRWVEAFHIIAAISWMVGML
Q2GE58_NEOSM      -------------------------------------------MEALHIIVVTMWMAGLF
F7XVD7_MIDMI      --------------------------------MKEFVLNNYLLIKSLHIIAIICWMAGSL
B6JAK5_OLICO      ---------------------------------------MYEWIKALHILAVISWMAGML
D6ZYW1_STAND      --------------------------------------MLYEWIKALHVIAVISWMAGML
Q3SWH2_NITWN      ---------------------------------------MYEWIKAFHVIAIISWMAGML
F8JDV2_HYPSM      MRQVMAETTSGRTVAIRAGVALAITAIAAAAMMLIFGDAAYLWIKALHVIAIIAWMAGML
D5BUD8_PUNMI      --------------------------------------MSYEIIKALHIISVISWMAGLL
HEMJ_RHOS4        ---------------------MRMADHFEETTMGTFLADYYLWTKSLHVISVLAWMAGLF
Q16CZ3_ROSDO      --------------------------------MSDLLAIGYPWIKSFHIMSVIAWMAGLF
S5XQ71_PARAH      --------------------------------MTELLSLTYPWAKALHIMAVISWMAGMF
A1AXX4_PARDP      --------------------------------MTDFLPLAYPWIKALHVMAVLSWMAGLF
Q1GCM2_RUEST      ------------------------------MDLTDLMFTLYPYVKSLHIMAVISWMAGLF
A3SKU2_ROSNI      -------------------------------MISDILGSAYPYVKSLHIISVVAWMAGLF
B4RD09_PHEZH      --------------------------------MSWPEFLSYDLLRGLHIIAVIAWMAGML
HEMJ_RICPR        ------------------------------------MESYYLWFKSAHLISAICWMAGLL
Q0BWA6_HYPNA      -------------------------------------MDLYNWLKAGHVIFVVALMAALL
Q1NDA2_SPHSS      ---------------------------------MAYLGAAYLWVKAAHLIFVIFLMAGLF
HEMJ_SYNY3        ---------------------MPKREYFSLPCPLSTFTMAYYWFKAFHLIGIVVWFAGLF
B7K0Q9_RIPO1      --------------------------------------MAYYWFKAFHLIGIVVWFAGLF
B0C9C0_ACAM1      --------------------------------------MAYFWFKAFHIIGVVVWFAGLF
A3PCX6_PROM0      -----------------------------------MAAEAYLWFKSLHIIGIIVWFAGLF
Q46L07_PROMT      ---------------------------------MNFSPETYLWFKSFHIIGVVVWFAGLF
A4ANR5_MARSH      ------------------------------------MSEYYNYIKALHLIFVVTWFAGLF
C0BHT7_FLABM      --------------------------------------MYYNYIKALHLIFVITWFAGLF
G8XBB7_FLACA      -------------------------------------MELYNYIKSLHLIFVITWFSGLF
L0FQS4_ECHVK      --------------------------------------MGFEYVKALHIIFIVTWFAGLF
F4C4U8_SPHS2      ---------------------------------------MYLYAKAVHIIFVVCWMAGLF
C7M5R9_CAPOD      -------------------------------------MTDYLIAKSIHIIFVVSYFAGLF
E4RUX6_LEAB4      ------------------------------------MLEYYGYFKAFHIVGFVSWFAGLF
D3SDU3_THISK      -------------------------------------MEAYNWLVSLHVIFMVTWFAGLF
Q609H6_METCA      -----------------------------------------MWLKAFHLIFMVTWFAGLF
Q9I5R0_PSEAE      ---------------------------------------MYMWLKAFHIIAVVCWFAGLF
S6AQZ5_PSERE      --------------------------------------MLYLWLKALHLIAVVCWFAGLF
Q88QQ7_PSEPK      --------------------------------------MLYLWIKALHIVSVVCWFAGLF
F3G4L4_PSESJ      --------------------------------------MLYLWIKALHVISMVCWFAALF
Q8PAX1_XANCP      -------------------------------------MTLYLWIKTFHLLFVIAWMAAVF
Q5H1G3_XANOR      ------MASDVGMQLRAIVHANRGNYRSSYASQRSQRMTLYLWIKTFHLLFVIAWMAAVF
Q9PGU6_XYLFA      -------------------------------------MALYFWVKTFHLLFVIAWMAAVF
H8L6E0_FRAAD      ------------MAVAAGLPGQRGGLTMAGFFQCGRMLMWYFWIKALHVLFVMGWVAAVF
Q12GY1_POLSJ      ----------------------------------------MLWVKSLHIVFVASWFAGLF
A1WEW2_VEREI      ---------------------------------------------------MTCWFAGLF
Q8XVT7_RALSO      ----------------------------------------MLWVKAFHIVFVASWFAGLF
D8IYF0_HERSS      ----------------------------------------MLWIKALHIVFIASWFAGLF
F2L961_BURGS      --------------------------------------MTYLWVKTFHIVLIAAWFAGLF
E1T9D5_BURSG      ----------------------------------------MLWIKTFHIVLIASWFAGLF
B1XT76_POLNS      ------------------------------------MSNAYLWVKTFHIVFITSWFAGLF
Q47JE1_DECAR      ----------------------------------------MLVVKTLHIWMVISWFAGLF
Q7P1Q8_CHRVO      --------------------------------------MSYLYLKALHIFFVVSWFAGLF
Q5QVQ1_IDILO      -------------------------------------MTWILWVKALHIAFMVAWFAGIF
Q3IHP8_PSET1      -------------------------------------MSALLIYKTLHIFFMIAWFAGIF
                                                                             :

HEMJ_HELPY        YLPRLFVYHAE-----NAHKKEFVGVVQIQEKKLYSFIASPAMGFTLITGILMLLI----
HEMJ_HELPJ        YLPRLFVYHAE-----NAHKKEFVGVVQIQEKKLYSFIASPAMGFTLITGILMLLI----
D5V480_ARCNC      YLPRLFVYHVE-----NSDKKDFVDVVKIQEYKIYKYIGMPAMWTTIISGIAMIYL----
D1AZ15_SULD5      YLPRLFVYHVE-----HAEKKSFVDVVKIQEYKMYKYIGLPAFWATLASGLLMIIL----
Q30TK9_SULDN      YLPRLFVYHAE-----NADNEGFVKVVKVMEMKIYKYIGVPAMWATLLSG---TYL----
Q0PBE8_CAMJE      YLPRLFVYHAE-----HKDNKGFVEVVKIQERKLYYYIQTPAMIVTLITGSLMLHA----
Q5GT75_WOLTR      YLPRLYVYHAT-----VKPGSESDSLLQTMERRFLRYIINPAMLFSLSFGIA-LMI----
Q3YT07_EHRCJ      YLPRIYVYHAQ-----VPLHSDSYNLFNTMESKLLFYIINPSMISSIALGTA-LSI----
B9KHD2_ANAMF      YLPRLYVYHSK-----VRYGSEGDSLLSLMERRLLLYIMNPAMLATLATGIS-LAV----
Q2GE58_NEOSM      YLPRIMVYHAE-----VDVGTETDSVFRVMERRLLRYIMTPAMVVSIVLGLL-LAI----
F7XVD7_MIDMI      YLPRLFVYHTR-----FSPKSEAYETFLTMEFKLIRYIMTPSMLCAFLSGEL-LIY----
B6JAK5_OLICO      YLPRLMVYHCV-----AEPGSKQSETFKIMEWRLLKIIINPAMIVTWLAGGW-LVW----
D6ZYW1_STAND      YLPRLMVYHCD-----APVGSQQSETFKVMERRLLKAIINPAMGVTWLPGLY-LAW----
Q3SWH2_NITWN      YLPRLFVYHCD-----AEIGSKQSETFKVMERRLFKAIINPAMMIAWGLGLY-MMW----
F8JDV2_HYPSM      YLPRLFVYHAD-----TPVGSPQSETFKVMEARLLNIITTPAMVVAWVLGLW-LAW----
D5BUD8_PUNMI      YLPRLFVYHAD-----APLGSVQAETFKVMERRLLKAIMNPAMIASFIFGLWMLAL----
HEMJ_RHOS4        YLPRLFVYHAEV----VKAGTETDALFQTMERRLLRAIMNPAMIATWIFGLLLVF-----
Q16CZ3_ROSDO      YLPRLYVYHTEQ----VGQSGDTHVLFQTMELKLLRVIMNPAMIATWVFGICLVL-----
S5XQ71_PARAH      YLPRLFVYHAER----GRSGTEPTASFVIMEEKLLRMIMNPAMIVTWIAGLWLVA-----
A1AXX4_PARDP      YLPRLFVYHAER----GHLGQEPVQSFRIMEDKLLRLIMNPAMIVTWIAGLALVL-----
Q1GCM2_RUEST      YLPRLFVYHVEE----AEKVKDVAPIFLTMEHKLLRVIMGPASVVTWIAGLFMVF-----
A3SKU2_ROSNI      YLPRLFVYHVEA----AERGDSRDEIFQVMEQKLFRVIMNPAMMATYLFGLTLAF-----
B4RD09_PHEZH      YLPRLYAYHTET----APPGTEFDAHFQVWERKLLRIIINPAMTITWVLGVTLILW----
HEMJ_RICPR        YLPRIYVYHTK-----AKIGSELDSTLQVMELKLLRFIMNPAMISTFIFGLINAH-----
Q0BWA6_HYPNA      VYPRYKIHQLS-----STPGEPLFEAMKKSSGQLRMIILNPSLILVWLFGLGMVFV----
Q1NDA2_SPHSS      MMPRFFVYHQE-----TVPGSPEDQRWIEREGRLLKIILNPSLVLVWVLGL-MLMV----
HEMJ_SYNY3        YLVRLFVYHAEADQEPEPAKTILKKQYELMEKRLYNIITTPGMVVTVAMAIGLIFT----
B7K0Q9_RIPO1      YLVRLFVYHAEASQQPEPAQTILKTQYEIMEKRLYNIITTPGMAVTVVMAIGLIST----
B0C9C0_ACAM1      YLVRLFIYHVEANEEPEPAPAILKQQYTLMEKRLYSIITSPGMMVTVTMAIGMLVT----
A3PCX6_PROM0      YLVRLFIYHEESKNMDNELKIAFNKQYTLMEKRLANIITTPGMILALSMAICMVIM----
Q46L07_PROMT      YLVRLFIYHVEVQTQKEEIREVFNKQYTLMEKRLANIITTPGMVLAVIMATGLLYM----
A4ANR5_MARSH      YIPRLFIYHIEASEKSSPEKEILTTQLKLMTKRLWNIITWPSAILCTIFAIWLLVL----
C0BHT7_FLABM      YVPRLFIYHIEATKKSKIEADILIPQFKIMTKRLWYIITWPSAILAILFAVWLLYL----
G8XBB7_FLACA      YIVRLFVYHAEAKEKPEPEQSILIKQYQLMQYRLWYIITWPSAVLASIFAFWMLLF----
L0FQS4_ECHVK      YVVRLFIYQTEALEKTPEEQKILKPQLDLMAKRLWLGITWPSAILTLIFGTWTLTY----
F4C4U8_SPHS2      YMVRLFIYHTEAKQQSENEYHILHKQFVLMERKLWWIIATPSMYLTIIAAAVMMHL----
C7M5R9_CAPOD      YMVRLFIYHTEALEKDDPERSILHKQFSFMEERLWNIITVPALVLMTLSGLYMLYD----
E4RUX6_LEAB4      YLVRMFVYRAEVNEKPEHLREDWKKQFSIMEWRVYKMIATPAMVITWICGLSMLAL----
D3SDU3_THISK      YLPRLFVYHAM------TDDALGHERFKIMERKLFYGIMTPGGVLTIAFGGAMLA--LIP
Q609H6_METCA      YLPRLFVYHTM------TSDAVGIARFKIMERKLFWGIMTPAMLLTLLFGVWMLADYAWA
Q9I5R0_PSEAE      YLPRLFVYHAM------SEDQTSRERFCVMERKLYRGIMMPSMLATLVLGLWMLY-LTP-
S6AQZ5_PSERE      YLPRLFVYHAT------AEDEPSRERFKVMERKLYRGIMGPSMVATLVFGLWMLY-LNP-
Q88QQ7_PSEPK      YLPRLFVYHAQ------SQDSISQERFVTMERKLYRGIMNPAMIATYVFGAWMLY-LTP-
F3G4L4_PSESJ      YLPRLFVYHSM------SEDTVSRERFIVMERKLYRGIMTPAMIATLVFGGWLIS-FDPS
Q8PAX1_XANCP      YLPRILVNIAE-----AGTDTAVRARLVLMGRRLYK-FGHSMLGLALLLGAVLW---LGY
Q5H1G3_XANOR      YLPRILINIAE-----AGDDAGVRARLVLMGRRLYG-FGHSMLGLALLLGAVLW---QGF
Q9PGU6_XYLFA      YLPRILVNVAE-----TDGQPAVQARLRQMGRRLYI-FGHIMFGLSGLLGVLLW---LGY
H8L6E0_FRAAD      YLPRILVNLAEV--KAAGEPAAVSARLELMGRRLYR-FGHIMFGLSVICGLLLW---QGW
Q12GY1_POLSJ      YLPRIFVNLAL----VPPESVAERERLILMARKLMR-FTTILAVPALGFGLWLY---LGY
A1WEW2_VEREI      YLPRIFVNLAL----LAPGAAAERERLLLMARKLLR-FTTLLSAPALALGVWLW---LGY
Q8XVT7_RALSO      YLPRIFVNLAM----ETQPAAVTR--LLLMARKLFR-FTTLLAIVAIVLGLWLF---LGY
D8IYF0_HERSS      YLPRIFVNLAQ----ETEVASRER--LLGMARRLYR-FTGMISLVALALGVWLLV--LTW
F2L961_BURGS      YLPRIYVNLAM----ETDPGAVRR--LLTMARKLFR-FMSFIAVPALACGAWLW---LVA
E1T9D5_BURSG      YLPRIFVNLAM----ETEPAATKR--LLLMARKLFR-FMSFIAVPALACGLWLW---LVV
B1XT76_POLNS      YLPRIFVNLAE----EKNTEAYAH--LLGMADRLFR-FMTILAVPAILLGLTLW---LYF
Q47JE1_DECAR      YLPRIFVNLAM----VPADSHAERDRLLLMAGKLYK-FMTPLGVLAIVLGFWLW---FGY
Q7P1Q8_CHRVO      YLPRLFVNLAL----AAEGD--EYGRLLLMAKKLLR-FMTPLGLLALATGLGLW---LGF
Q5QVQ1_IDILO      YLPRLFVYHAM------NAKPAVDEQLCIMERRLLY-FVTPFAILTLVFGVVLI---FAY
Q3IHP8_PSET1      YLPRLFVYHAM------SEERACNSMLKVMERRLLF-FVTPFAVLTAVFGVLTI---VEY
                     *                            :.   :           .          

HEMJ_HELPY        EPTL------FKSGGWLHA-------KLALVVLLLAYHFYCKKCMRELEKDPTRRNARFY
HEMJ_HELPJ        APEM------FKSGGWLHA-------KLALVVLLLIYHFYCKKCMRELEKDPTGKNARFY
D5V480_ARCNC      APEL------FKSGAWLHA-------KLTVVFLLIIYSFSLEYFRKQLEENKCKRSGKFF
D1AZ15_SULD5      DTQL------LSSGGWIYA-------KFAVVLALTLYSFSLEKYRLELANGTCMKSGKFF
Q30TK9_SULDN      AIELG-----FSGNAWLHA-------KILFVVILVAYFFSLGYFREKFLNDECKKSGKFF
Q0PBE8_CAMJE      HKEVL-----MVGAGFMHV-------KLTCVTLLIIFHIHNYYCLKALANDTSTKSGKYF
Q5GT75_WOLTR      IREA-------YREGWFHV-------KALALFFMFGIHGLLAMHRKKFAMGSNEKNHVYF
Q3YT07_EHRCJ      ITEA-------YYFLWFKI-------KIVCVILMCIIQVMLFKHRKDFAAKNNTKSSLYF
B9KHD2_ANAMF      AEGY-------YVFLWFKI-------KFLLILAMLTIHALLAKYGRDLRRNACRHSPLYF
Q2GE58_NEOSM      DTGH-------ILSTWLHL-------KLLFVAALVSLHIFFWRCSVAFGRGCNRYSSTFF
F7XVD7_MIDMI      AQE---------MTTWLHV-------KLTAVMLLATMHGLMIRYYKNFYNHTNTQSEKFF
B6JAK5_OLICO      DGGW-------YLSGWFHA-------KFALVIVMSAIHGMLVRRVKEFRQDRNTRSEKYY
D6ZYW1_STAND      DGGW-------YLSGWFHA-------KFALVLVMSGFHGALSRWVKDFAADRNIRPARFY
Q3SWH2_NITWN      ERQW-------YAVGWFQG-------KLGLVILMSAVHGYFARRVRDFAADRNVMSQKFY
F8JDV2_HYPSM      QGAF-------WSAPWLHA-------KLALVLALSGLHGYLSAATRAFREDRNTKPARHW
D5BUD8_PUNMI      NHAL-------IYELWFIV-------KFVCVILMAGCHGKFSKMRRLLENDEKPLSSKAY
HEMJ_RHOS4        --TP-------GIVDWSML---WPWTKAACVLAMTGFHMWLAARRRDFAAGANRHKGRTY
Q16CZ3_ROSDO      --TP-------GIVDWSSI---WPWLKFLGVFGMTAFHMWLAKKRKVFAAGENQLTGKQY
S5XQ71_PARAH      --TP-------GIVDWSSI---WPWTKAAGVLAMSGYHGWLSKQRKELLAGR-GASGRTY
A1AXX4_PARDP      --TP-------GIVDWTMI---WPWTKAAGVLGMTWFHMWLAGQRKALLLGQ-GLSGRRY
Q1GCM2_RUEST      --TP-------GLVDWSYV---WPWTKGASVLAMTWFHHWLMFRHKDFKEGKNTITGRQY
A3SKU2_ROSNI      --TP-------GVVDWASV---WPYTKIAGIGVLTWFHHWLGAQRKAFVAGENIVSGRTY
B4RD09_PHEZH      HVYA-------TGAGWGFLLQPWMLVKLAVVTFLSGWHGFLAGARKKLAAGQRPKSAKFW
HEMJ_RICPR        ------------IYGFVAL-DTWFQFKMFAVLILVIFHGLLARWRKDFAKGKNVHSKKFY
Q0BWA6_HYPNA      DWQRGG---QLYLEGWFHA-------KLLLVLTLSGMHGYFIGVGKKVDNVTGTVQAKTL
Q1NDA2_SPHSS      EIGA-------WQFGWFHL-------KLLFVLGLTGYHGWIASYTKKLAKGQRPLGDRQL
HEMJ_SYNY3        --EPE-----ILKSGWLHI-------KLTFVALLLLYHFYCGRVMKKLAQGESQWSGQQF
B7K0Q9_RIPO1      --EPE-----ILKSGWLHI-------KLAFVVLLLAYHFYCGRIMRQLAKGECQWTGQQF
B0C9C0_ACAM1      --QPD-----LLKQGWLQV-------KLAFVALLLVYHFYCRRLMKKLEEGTCGWSGQQL
A3PCX6_PROM0      --QPS-----WLSEKWLQI-------KISFVLGLVIYHSYCYKIMYSLQNGTSTISAKSL
Q46L07_PROMT      --QPS-----YLSQAWMQV-------KLLFVLFLLIYHFYCYRIMNQLTNNQFNFSGQQL
A4ANR5_MARSH      --MPG-----FLKMPWMLI-------KLGFVLLLFIYHLKCHQIYKQLQRDEIKYTSRFM
C0BHT7_FLABM      --MPS-----WLYQPWMHL-------KLSLVFLLGVYHMRTHRFFKQLQKDENRHTSNFM
G8XBB7_FLACA      --TDTG--NLWLTQSWMHI-------KLTFVFLLYLYHLKCHQIFNQLQKNEVKKSSTFF
L0FQS4_ECHVK      --RLG-----YLELGFMHA-------KLAFVVLLYVYHFICHHIYKKLQQGLATWNSTQL
F4C4U8_SPHS2      --NPA-----WWSQPWMHV-------KLTFVLGLIVYHFICQRIMFQLAGETSKWTSIKL
C7M5R9_CAPOD      --DGE---WTLIKQGWFHV-------KLLFIAFLFVYHYYSWRIMKRLQAGRASLTSVQL
E4RUX6_LEAB4      --NPG-----IFQQSWIHV-------KLTLLVLLVVYHFSCRRVIIMQDKDIDTRSSMFY
D3SDU3_THISK      GYLDE---------PWMHF-------KLTLVALLVIYHIWCGWIVRDFRDDLNRREHTWF
Q609H6_METCA      VYGGS---------GWLHV-------KLVLVALLVGYHVLCWQWLRSFAEDRNRRSHLFY
Q9I5R0_PSEAE      GWLSQ---------GWLHA-------KLTLVVLLIGYHHACGAMLKRFARGEPGRSHVFY
S6AQZ5_PSERE      SWLSQ---------GWLHA-------KLTLVVLLIGYHHACGSLLKRFARDENRRGHVFY
Q88QQ7_PSEPK      GWLSQ---------GWLHA-------KLTLVILLTGYHHVCGAQRKRFANGTNTRSHVYY
F3G4L4_PSESJ      GYFSQ---------GWMHA-------KLALVVLLIGYHHVCGAQMKRFARGENGRSHVFY
Q8PAX1_XANCP      RVIPDFPTMVA--GGWLHA-------KLFAVALILAHYIVAGRWLKGVDQGRALPSGRAL
Q5H1G3_XANOR      RFIPDFPTMVA--GGWLHA-------KLAAVALILAHYSVSGRWLKGVEHGCPVPSGRAL
Q9PGU6_XYLFA      RVIPAFPTMVGDGSGWLHA-------KVGLVVLILVHYIVAGYWLKRAERGGVLPGAGAL
H8L6E0_FRAAD      RMTASLPPVVGQ-AHWIHA-------KLGLVAVLFVYYIFTGRRLKKHA-SKGLPSALQL
Q12GY1_POLSJ      GIGRG------PGNAWMHA-------KLGVVVLALGYHHACGRLLGKFVSNRSTRSHVWF
A1WEW2_VEREI      GIGRG------PGSGWMHA-------KLAVVLLVIGYHHGCGRLLRQLADGRCRRSPVWL
Q8XVT7_RALSO      RIGLV------PPNGWMHA-------KLALVLVAIGYHHGCGVLLRKFEAGANKRSHTFY
D8IYF0_HERSS      QFWKG------PGNGWLHA-------KLFLVVLVIGYQHACGSLLKKFEHGKNVRSHVWY
F2L961_BURGS      GVGR--------GQGWIHA-------KLTIVLLLIVYHAYCGHLLRVFERGENRRSDRWY
E1T9D5_BURSG      GIGR--------GQGWIHA-------KVGVVVLLVIYHAYCGVLLRTFERRQNRRSDKWY
B1XT76_POLNS      GIGA--------GDIWMHA-------KLFFVILVIGYHHACLSLLKKFRAGANKRSGIWF
Q47JE1_DECAR      GFSG----------GWLHA-------KTTLVAVLAGYHWHCGRVLKRFQLGDNAKSHVWF
Q7P1Q8_CHRVO      GIAG----------GWLHA-------KVALVLLLVGYHGYCARLYADFAARRNRRSHTWF
Q5QVQ1_IDILO      GSAWF------AASGWMHT-------KLVLVLLLFVYHGYCFKLLKDFKTGTNRRSHRFY
Q3IHP8_PSET1      GRDWF------KYSMWLHY-------KLVLVIILYLYHGYCFKLLADFKHDRNTKSDRFY
                                 :          *   :                             

HEMJ_HELPY        RVFNEAPTILMILIVILVVVKPF-------------------------------------
HEMJ_HELPJ        RVFNEIPTILMILIVILVVVKPF-------------------------------------
D5V480_ARCNC      RAYNEIPTLFAILIVTYVVVKVVSVTFTLAMVLLFAFIIYMIMKPKRVKNAQ--------
D1AZ15_SULD5      RAYNEVPTALAVLIVGYVITKSFSWAFTLITLGILAMIMDMILDGKEKK-----------
Q30TK9_SULDN      RAYNEVPTILLLVIVAMVIIKPF-------------------------------------
Q0PBE8_CAMJE      RIYNEFPTIMFIIIALMMVVRPF-------------------------------------
Q5GT75_WOLTR      RVLNEMVTVLIIIIVIMIVVKPF-------------------------------------
Q3YT07_EHRCJ      KCLNESVTLLIIIIVIMVVVKPFM------------------------------------
B9KHD2_ANAMF      RILNETVTALMVAIVVMVVVRPFM------------------------------------
Q2GE58_NEOSM      KFANEGVTIAFIAIVILAVTKPF-------------------------------------
F7XVD7_MIDMI      RFLNEIPTILMILIVMMAVMKP--------------------------------------
B6JAK5_OLICO      RILNEAPAVLMIGIVILVVVKPF-------------------------------------
D6ZYW1_STAND      RIANEVPTVLMIGIVILVIVKPF-------------------------------------
Q3SWH2_NITWN      RIINEVVTALMVGIVILVIVKPS-------------------------------------
F8JDV2_HYPSM      RIVNEIPTVLMIGIVILVIVKPF-------------------------------------
D5BUD8_PUNMI      RIWNEVPTVLMIVIIVMAVVKPF-------------------------------------
HEMJ_RHOS4        RMMNELPTLLMLVIVFSAVAKWNYWGF---------------------------------
Q16CZ3_ROSDO      RMMNEVPTILMVIIVISVVVKF--------------------------------------
S5XQ71_PARAH      RIANEVPTLLMIVIVLSVILKF--------------------------------------
A1AXX4_PARDP      RMMNEVPTLLMVLIVLSVIVKF--------------------------------------
Q1GCM2_RUEST      RLMNEVPTLLMVVIVVSVIFKF--------------------------------------
A3SKU2_ROSNI      RLMNEVPTICLVVIVLSVVVRF--------------------------------------
B4RD09_PHEZH      RATNELPFVAAIVAVLAVTLQFGG------------------------------------
HEMJ_RICPR        RIVNEIPAICMVIAVIMVIVKPFD------------------------------------
Q0BWA6_HYPNA      RMLNEIPFLLLIAIAILVIVKPF-------------------------------------
Q1NDA2_SPHSS      RLLNEIPGIAAAVIVIAVIVKPF-------------------------------------
HEMJ_SYNY3        RALNEAPTILLVVIVLLAVFKNNL--PLDATTWLIVALVIAMAASIQLYAKKRRRDQALL
B7K0Q9_RIPO1      RALNEAPTVLLVVIVLLAVFKGSL--PLDLTTWLIVALVISMAASIQLYAKKRRLD----
B0C9C0_ACAM1      RALNEAPTLMLVAIVLLAVFKNSL--PTDTTVWVIFAMVIAMVVTIQLYAKKRKRD----
A3PCX6_PROM0      RLLNELPTLLLFIIVLLVIFKNNF--PTSIATWSVVGLIIFMLASIQLYAKIRKKN----
Q46L07_PROMT      RALNELPTLLLVVVVMLVVFKNQF--PTSAASWLIFGLILFMAASIQFYAKWRR-N----
A4ANR5_MARSH      RIWNEGATLILFAVVFLVILKGTF--NWIFGVIGIVVLGVLLMLGIRLYRRTQQKNPNA-
C0BHT7_FLABM      RIWNEGATLFLFAIVFLVILKDSF--HWISGLLGMIGLAFILYLGIRLYKKTRKK-----
G8XBB7_FLACA      RLWNEGATIILFAVVFLVILKNAI--NWIFGVIGIILFSILLMLGYKFYKNIREKK----
L0FQS4_ECHVK      RLWNEGATVLLFAIVFLIVLKNLM--NMLWGMAGLVGLSILLMLAVKWYKKQREKK----
F4C4U8_SPHS2      RLWNELATVLLFAIVFTVVLKSAI--NWIYGVVGLVLFAVMLMIAVKIYKKIREKSN---
C7M5R9_CAPOD      RMLNEIATIILFVVVFAVILKGLFITYWYFSLIAFVVMGALIMLVVKLVNKGKN------
E4RUX6_LEAB4      RLFNELPTLFLVAIVLLAVMRDLL--DFVKLFFGILIFGFLLYTFVKAYKRRREKSNV--
D3SDU3_THISK      RWFNEFPVPILVGVVVLVINRSIEDALIAIGVVLAIFVLAALIGWWKRRREAA-------
Q609H6_METCA      RWINEVPVLFLFAIVLLASLKPF-------------------------------------
Q9I5R0_PSEAE      RWFNEVPVLFLLLIVLLVVLKPF-------------------------------------
S6AQZ5_PSERE      RWFNEVPVLFLIAIVILVVVKPF-------------------------------------
Q88QQ7_PSEPK      RWFNEVPVLILLAIVILVVVKPF-------------------------------------
F3G4L4_PSESJ      RWFNEIPVLILIAIVILVIVKPF-------------------------------------
Q8PAX1_XANCP      RLFNEVPVVLLVGVIWLVLAKPF-------------------------------------
Q5H1G3_XANOR      RWFNELPVILLVAVIWLVLAKPF-------------------------------------
Q9PGU6_XYLFA      RVFNEIPVLVLIGILWLVFAKPF-------------------------------------
H8L6E0_FRAAD      RLANELPVFLVLGVLYLVMARPF-------------------------------------
Q12GY1_POLSJ      RWFNEVPVLLLAAAVILVVVKPWQG-----------------------------------
A1WEW2_VEREI      RWFNELPLLLLTAAVLLVVLKPF-------------------------------------
Q8XVT7_RALSO      RWFNELPVLLLLAITILVVVKPF-------------------------------------
D8IYF0_HERSS      RWFNEVPVLLMLAIVILVVVKPF-------------------------------------
F2L961_BURGS      RFFNELPVLGMLGAVALAVIKPF-------------------------------------
E1T9D5_BURSG      RMFNELPVLGMLAAVALVVIKPF-------------------------------------
B1XT76_POLNS      RWFNEVPVILLVIIVALVLFKP--------------------------------------
Q47JE1_DECAR      RFYNELPVIILLVVLFLVVLKPF-------------------------------------
Q7P1Q8_CHRVO      RVFNELPVLVLLAVVILVVVKPF-------------------------------------
Q5QVQ1_IDILO      RVFNELPVLALFAIIILAVVKPY-------------------------------------
Q3IHP8_PSET1      RIFNELPVIALLIIVALAVIKPSL------------------------------------
                  :  **               :                                       

HEMJ_HELPY        -------------
HEMJ_HELPJ        -------------
D5V480_ARCNC      -------------
D1AZ15_SULD5      -------------
Q30TK9_SULDN      -------------
Q0PBE8_CAMJE      -------------
Q5GT75_WOLTR      -------------
Q3YT07_EHRCJ      -------------
B9KHD2_ANAMF      -------------
Q2GE58_NEOSM      -------------
F7XVD7_MIDMI      -------------
B6JAK5_OLICO      -------------
D6ZYW1_STAND      -------------
Q3SWH2_NITWN      -------------
F8JDV2_HYPSM      -------------
D5BUD8_PUNMI      -------------
HEMJ_RHOS4        -------------
Q16CZ3_ROSDO      -------------
S5XQ71_PARAH      -------------
A1AXX4_PARDP      -------------
Q1GCM2_RUEST      -------------
A3SKU2_ROSNI      -------------
B4RD09_PHEZH      -------------
HEMJ_RICPR        -------------
Q0BWA6_HYPNA      -------------
Q1NDA2_SPHSS      -------------
HEMJ_SYNY3        TEQQKAASAQN--
B7K0Q9_RIPO1      --QEKLSSSQG--
B0C9C0_ACAM1      --KERLALETASE
A3PCX6_PROM0      --ENSLSNE----
Q46L07_PROMT      --KKQLT------
A4ANR5_MARSH      -------------
C0BHT7_FLABM      -------------
G8XBB7_FLACA      -------------
L0FQS4_ECHVK      -------------
F4C4U8_SPHS2      -------------
C7M5R9_CAPOD      -------------
E4RUX6_LEAB4      -------------
D3SDU3_THISK      -------------
Q609H6_METCA      -------------
Q9I5R0_PSEAE      -------------
S6AQZ5_PSERE      -------------
Q88QQ7_PSEPK      -------------
F3G4L4_PSESJ      -------------
Q8PAX1_XANCP      -------------
Q5H1G3_XANOR      -------------
Q9PGU6_XYLFA      -------------
H8L6E0_FRAAD      -------------
Q12GY1_POLSJ      -------------
A1WEW2_VEREI      -------------
Q8XVT7_RALSO      -------------
D8IYF0_HERSS      -------------
F2L961_BURGS      -------------
E1T9D5_BURSG      -------------
B1XT76_POLNS      -------------
Q47JE1_DECAR      -------------
Q7P1Q8_CHRVO      -------------
Q5QVQ1_IDILO      -------------
Q3IHP8_PSET1      -------------