CLUSTAL format seed alignment for MF_02240

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSP_BACSU             ------------MKAVFFDLDDTLLWDEKSVRTTFAETCLQAEKKY-GLAPEEFEAAVRE
Q62RR1_BACLD          ------------MKAVFFDLDDTLLWDEKSVSTAFSKTCLKAEEKY-GIHAEEFEAAVRE
D5DTA0_BACMQ          -----------MIKAVFFDLDDTLLWDQKSVKEAFVATCTYASEKY-NLKPEELEEAVRK
Q9KAY1_ALKHC          -----------MVKAIIFDLDDTLLWDKKSVKEAFVATCQYAATKR-SLDPEALEESVRE
E6TQJ2_BACCJ          -----------MIKSIFFDLDDTLLWDKRSVKEAFRATCEYANTKY-DLQPEQLEAAVRE
W4QEU7_9BACI          -----------MLKAIFFDLDDTLLWDQKSVSKAFEETCKVAQDQY-GVNAKALEEAVRE
W9ABJ3_9BACI          -----------MLKAILFDLDDTLLWDEKSVKVAFETTCQLAEEQY-GIQADDFEEKVRE
A0A4Q3X6N3_9BACI      -----------MLKAIMFDLDDTLIWDEKSVDEAFDAACGLAAQTY-DINPDVLKKEVQV
Q8EN60_OCEIH          -----------MVKAIMLDLDDTLLWDKKSVQDAFDLTCQKAKQDI-GVDAKSLENSVRK
D6XSD7_BACIE          -----------MTNAIFFDLDDTLLNDARSVETALRKTCAFAESKA-RVEANSLYEAIRL
A0A2S1H4Y6_9BACI      ----------MAIKTIIFDLDDTLLFDQKSVKTAFEKTCEFASTQK-NIDAKTFEEAVRK
F2F001_SOLSS          ----------MAIKTIIFDLDDTLLFDQLSVKTAFEKTCDYAATKT-SVNSQQLEEAVRS
A0A0A3I5F6_9BACI      ----------MSINTIIFDLDDTLLWDKQSIQTAFDKTCEYAATIH-NVEPKQLEQAVRV
M7NA31_9BACL          -----------MIRTIIFDLDDTILWDKKSIQTAFDRTCEFAAEKT-KVDPKQLEEKVRE
K0J5Z1_AMPXN          -----------MITTLFFDLDDTLLWDKKSIEMAFQATCQHVKE----LDPNVLEQAVRN
S0JPU0_9ENTE          -----------MIKTIFFDLDDTLLWDKKSIKTAFQETCKTVAS----LDPERFEEAVRQ
A0A223KUW2_9BACI      -----------MKKAVFFDLDDTLLWDIRSVQTAFLKTCEYAAEQV-IVNVEELEKAVRV
Q5WGN8_BACSK          -----------MIRAIFFDLDDTLLWDKKSIKEAFRQTCALAATVHTDIDPDALEEAVRT
A0A0L0QUG2_VIRPA      -----------MLKAIIFDLDDTLLWDKKSVAESFKAVCHMAKEIHPELDPEHLERNVRK
A0A0C2W6A3_9BACL      -----------MPKAIFFDLDDTLLWDKKSIALAFHYTCKEAEKEF-GVAAEDLEAAVRR
A0A0B5AN41_9BACL      -----------MPTAIFFDLDDTLLWDKKSIETALEKTVNDAKELY-GTDPDKLLAAVKE
A0A177L5H1_9BACI      -----------MKKALFFDLDDTLLNDKKSIQTAFDVTCGEIAEKY-EKDAGEIEQHVRT
A0A1H2R6Z7_9BACI      ------------MKTLIFDLDDTLLWDKKSITEALRATAFDAEIRT-GVQAPLLMETVQQ
D3E8S0_GEOS4          ----------MPIAAVLFDLDDTLLWDERSVEEAFEVTCQAGAAETGVDA-GALLAAVRE
W7YS96_9BACL          ----------MAISAVFFDLDDTLLWDDRSVEESFHAVCEAAQASSGVDP-QALEKAVRE
X4ZM27_9BACL          ----------MPIAAVLFDLDDTLLWDERSIEEAFEYACKA--AGEAVDP-KELEAAVRR
A0A1C1A133_9BACL      ----------MSLKAVLFDLDDTLLWDDRSVEEAFAATCAEAAKHVDVNP-EELEASVRK
A0A1H4KNR7_9BACL      ----------MTLKAVLFDLDDTLLWDEQSVREAFRATCEEAAKHVSVNP-GDLEEAVRK
H6ND54_9BACL          ----------MGIKAVLFDLDDTLLWDERSVQEAFRATCEEASRVTGVDP-VKLEEAVRR
L0EDX4_THECK          ----------MAKQAVLFDLDDTLLWDERSVKEAFEAVCRYAQERTGADP-EKLEQAVRR
C6CUS6_PAESJ          -------MRIMGKQAVLFDLDDTLLWDDRSVKEAFEATCQAGAEAAGVDP-EQLEEAVRK
H3SBQ4_9BACL          ----------MAIRAVLFDLDDTLLWDERCVEEAFAAVCQYAHSTAGVDA-EQLETEVRN
V9W9K5_9BACL          MIPEDKGEFRMAVKAVMFDLDDTLLWDERSVKEAFKTTCEEAVRYYPQLSSERLEKSVRQ
A0A1C1A465_9BACL      ---------MPTKKALIFDLDNTLLWDERSINEAFLATCQRAANQYV-LDPSVLEQAVRE
A0A168Q4G1_9BACL      -----------MIQAIIFDLDNTLYWDKRSNDEALNATCLLASNDITTISPAKLKYDIIR
PSP_THET2             ------------MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVE-------GFFARVKA
Q5SLK1_THET8          ------------MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVE-------GFFARVKA
Q67KB9_SYMTH          ------------MRAVLFDLDETLILDEPVTREALAAAAALAGSR---ADPERLAARAWA
D7BFN5_MEISD          -----------MIRAILFDLDDTLILDEAVCEHAFREAGFVAAQRY-SLDLERLAYTAKA
D6TEM0_9CHLR          ----------MPVQAIIFDLDETLIEDRQATQCALRKACLYAQARV-QLDSARLRIDAYR
A0A146G418_TERSA      ------------MKALLFDLDDTLVVDEAVSSEAFAATARAASTGH-GADAASFQRDAMR
                                     :::***:*:  *       :                  :      

PSP_BACSU             AARELYMSYETYPYTVMIGINPFEGLWSNFSEPISEGFQKLNKIVPEYRRNAWTNGLKAL
Q62RR1_BACLD          AARKLYMSYETYPYTVMIGINPFEGLWSNFSEPISEGFQKLNKIVPEYRRNAWTNGLKAF
D5DTA0_BACMQ          EARELYASYETYEFTQMIGINPFEGLWGNFLDD-HDEFRKMKDIVPTYRKEAWTRGLRAL
Q9KAY1_ALKHC          VARELYASYETYEFTQMIGINPFEGLWGQFLDD-NDHFRKMKEIVPTYRKDAWTQGLAKL
E6TQJ2_BACCJ          EATTLYASYETYDFTKMIGINPFEGLWGNFLDD-DDNFRKMKDIVPTYRKEAWTRGLNAL
W4QEU7_9BACI          EARKLYSSYETYEFTQMIGINPFEGLWGNFLDD-HEHFKKMSEIVPVYRRDAWTNGLKSL
W9ABJ3_9BACI          IAKRQYATYDTYSFTQMIGINPFEGLWAQFQDE-GEEFAKLRELAPGYQQKVWTKALEAF
A0A4Q3X6N3_9BACI      IAPKLFASYDTYEFTKMIGISPFEGLWGTFDDM-GESFQQLKELVPEYRKRVWTEGLLAL
Q8EN60_OCEIH          HARNLYASYETYEFTKKIGINPFEGLWASFNDT-GSEFKKLKEIAPLYQKEAWNQGLRDL
D6XSD7_BACIE          KAPEVYARYDAYPFTKKIGINPFEGLWGEFDDP-SDGFRELKSIITHYQKTSWTEALQYC
A0A2S1H4Y6_9BACI      AARTLYEGYDTYDYTVLIGINPFEGLWGTFDDP-TPQFQRMKEIVPGYRAAAWTNGLQAL
F2F001_SOLSS          AARSLYESYPTYDYTVLIGINPFEGLWGTFDDP-TPQFQQMKEIVPAYRTEAWTKGLAAV
A0A0A3I5F6_9BACI      EARKLYESYETYDYTVLIGINPFEGLWGTFDDP-TPEFQKMKEIIPQYQKEAWTNGLKAV
M7NA31_9BACL          SARELYASYDTYEFTQMIGINPFEGLWGSFEDE-GDDFRRMRDIIRTYQKDAWTKGLKKV
K0J5Z1_AMPXN          EARKLYESYPTYPFTQMIGINPFEGLWGTFNDA-GEDFEKMYQLMPEYQKAAWTNGLKAC
S0JPU0_9ENTE          EATKLYQSYPTYPFTQMIGINPFEGLWGTFDDS-GVEFQQMHQLINKYQVDAWTNGLKAC
A0A223KUW2_9BACI      EATKLYDSYETRPFTLLIGINPFEGLWGTFDDG-TFSFPALNKIIREYQHQAWYNGLQKV
Q5WGN8_BACSK          HATELYQSYETYEFTKLIGINPFEGLWGAFRDD-TEDFNRLREIAPVYQQAAWEKGLAEI
A0A0L0QUG2_VIRPA      EARALYASFPTYSFTQMIGINPFEGLWGEFQDE-GKEFEKLKEIAPFYRQAAWEKGLETT
A0A0C2W6A3_9BACL      IAPILYAELSTYSFTQSIGINPFEGLWGEFGDPIHHQFREMGKLIPAYRKKAWTEGLKAL
A0A0B5AN41_9BACL      AAPRLYQEYDFYEFTKMIGINPFEGLWGQFGDPIHHTFRQMGEEIADYQKRVWQKVLQSQ
A0A177L5H1_9BACI      AAHAQYETYSFYPVTVSIGINPFEGLWGDFGDVHYSLFRDMGENIADYQLKTWKNGLSAA
A0A1H2R6Z7_9BACI      TAPELYKNLSVYDFTKTIGINAFEGLWGHFDDIEHRRFQEMSRLISSYQKETWTRSLAAH
D3E8S0_GEOS4          EARALYESYDTFAFTKMIGINPFEGLWANFTAGSQPEFRKLQELAPVYRKESWRRGLHRL
W7YS96_9BACL          EARTLYESYDTFAFTKMIGINPYEALWANFTAGEQPEFRKLEELAPTYREESWRRGLEKL
X4ZM27_9BACL          EARNLYESYETYPFTQMIGINPFEALWGNFTAGEQEEFRKMEQLAPIYRKESWRRGLAAV
A0A1C1A133_9BACL      EARSLYESFETFPFTKMIGINPFEGLWANFTEGEDENFRKLQKLAPGYRTESWTRGLAAL
A0A1H4KNR7_9BACL      EARALYESYEPFPFTKMIGINPFEALWANFSEGDNENFRKLEQLAPGYRTESWTRGLMTL
H6ND54_9BACL          EARALYESYETFPFTKMIGINPFEGLWANFTSGEQEEFRKLEALAPGYRTASWTRGLLAL
L0EDX4_THECK          EARALYESYETYPFTRRIGINPFEGLWANFREGEQEEFRKLEALAPAYRRESWIRGLRVI
C6CUS6_PAESJ          EARALYESYETFPFTKMIGINPFEGLWANFREGEQEEFRKLEQLAPGYRKEAWTRGLRAL
H3SBQ4_9BACL          AARALYESYATYAFTTNIGINPFEALWGHFTGGEHEQFRSLQQLAPAYRTASWTTGLRQS
V9W9K5_9BACL          EARSLYESYETYPYTKQIGINPFEALWARFTMEEDENLRKLKQIAPLYRKEAWKRGLAAL
A0A1C1A465_9BACL      AAHDLFKSLDLYDWLHMIEVTDLEALWGNFQQGAHPNFRIMQEFAPLYRKNVWHRGLQAV
A0A168Q4G1_9BACL      EAEVQFTSSTFFEFASSIEVTALEALWARFDAGDHPMFDTMRVEAPTYRFNAWHAALQHS
PSP_THET2             RAEALFREAPFYPWAEAIGHSALEALWARYST---PGLEALAAWAGPFRERVFREALEEA
Q5SLK1_THET8          RAEALFREAPFYPWAEAIGHSALEALWARYST---PGLEALAAWAGPFRERVFREALEEA
Q67KB9_SYMTH          EARRRWAEGPYAAYCRRIGHSAAEGLWARYDRGDHPAIQGLRQWAPDYRVAVWREALAEQ
D7BFN5_MEISD          SARRLWTEGPYYSYALRIGHSALEGLWAGYSQ-TQPEIRGLREWTPGYRLALWREALADQ
D6TEM0_9CHLR          HAKLLWAEAPTYAYCYAIGISASEGMWGRFEG-EAPDLQALFQWAPVFQQLLWKRALAEQ
A0A146G418_TERSA      HARSLWAAGPCQSYCKAIGISAFECLWGKFEG-DSEELTALRNWAHTYREQVFDAALREQ
                       *   :           *  .  * :*. :       :  :      ::   :   *   

PSP_BACSU             GIDDPAYGEYLGEFFAAERRKRPFVYDETFAVLDQLKGK-YELLLLTNGDPSLQKEKLAG
Q62RR1_BACLD          GIDDPAFGEELGEYFAAVRRKSPFVYEETFAVLDELKGK-VELLLLTNGDPSLQKEKLAG
D5DTA0_BACMQ          GIHDDAFGAELAERFPLERRKTPFVYEETFEVLDQLKGK-YKLLLLTNGSPDLQNTKLDI
Q9KAY1_ALKHC          GIEDQALGEELAERFPEERKKHPFVYEETFRVLDQLKGN-YQLLLLTNGSPHLQQTKLDI
E6TQJ2_BACCJ          GIDDPTFGEELAERFPEERKKKPFVYEETFNVLDQLKDD-YCLVLITNGSPDLQNTKLNI
W4QEU7_9BACI          GIDEPNFGQKLAERFPEERRKHPFVYEETFSVLDKLKGS-YKLLLLTNGSPDLQQTKLSI
W9ABJ3_9BACI          GVKDTAFGSKLAEAFPEARIANAFVFEQTFEVLDKLNPH-YSLLLLTNGSPDLQHKKLSL
A0A4Q3X6N3_9BACI      GIDDPKLGTQLAATFQEERRTKQFVYEETFEVLNELNDD-YQLLMLTNGSPDLQWTKLSI
Q8EN60_OCEIH          GIENENFAKQLANAFRENRKRTACVFSDTIKVLEKLYTK-VPLLLLTNGSPSLQNLKLEL
D6XSD7_BACIE          GINDEQLGRQLATTFRTERLANPFLFDDALPVLEELKES-YELVLLTNGSPQLQNIKLKL
A0A2S1H4Y6_9BACI      GVEDATFGAELGERFVEERKKAPFFYEDTFAVLDALKGK-YQLVLLTNGAPSLQNLKLEI
F2F001_SOLSS          GIEEAALGAELGERFVEERKKAPFFYDDTFAVLDELKGK-YELVLLTNGAPSLQNLKLEI
A0A0A3I5F6_9BACI      GINDPALGVALSERFVEERKKSPYVYEDTYAVLDELKGK-YQLVLLTNGAPSLQNLKLQI
M7NA31_9BACL          GVEDYELANELVAKFISERRKAPFVFDESFEVLEALKKD-HRLVLLTNGAPSLQNEKLTI
K0J5Z1_AMPXN          GIDNPTLGDTLAKQFIKERLNHPYVYPETFDVLDQLKDK-YQLLLLTNGAPSLQNTKLTL
S0JPU0_9ENTE          GIDDKVLGKQLAQQFVVERKKHPFVYSETFAVLDQLKDK-YQLVLITNGSPSLQRTKLTL
A0A223KUW2_9BACI      GVDDSRLAKNLANRFIKERIKHPFVYEDTFPVLDALKNT-YSLVLITNGAPSLQNMKLSL
Q5WGN8_BACSK          GIEDGELANQLASHFPSERRKNPYVFEDTFAVLDELQHS-YRLLLLTNGSPDLQNTKLEI
A0A0L0QUG2_VIRPA      GIRDESLAAELADAFPQLRKQKPFVFTDTFAVLDALRAD-YKLALLTNGSPDLQRTKLDM
A0A0C2W6A3_9BACL      GIENPEAGEKLSERFREHRREQPVLYEETYEVLEALKKKSIRLLLLTNGAPSLQLEKLAI
A0A0B5AN41_9BACL      GVS--QSGDTLREKFITHRKNSPFLYEETLDVLDQLKEH-YQLVVVTNGAPSLQLEKLRI
A0A177L5H1_9BACI      GIPS-FEAEWARERFRSVRRESPFVYEETFTVLNELREKGYRLLLLTNGAPSLQLEKLTM
A0A1H2R6Z7_9BACI      GVHQPETGEWLKDRFIMHRRHLPYVYADTFEVLHTLKDD-YQLLMLTNGSPSLQRLKLSL
D3E8S0_GEOS4          GVDNEALAETLAAQFAAERRTRPYVYEETFEVLKELQGN-VKLLLLTNGSPDLQQEKLDG
W7YS96_9BACL          GVNNTELAKQLAEKFGSERRSRPLVYEETFRVLDELKGN-VKLLLLTNGCPALQQEKLTG
X4ZM27_9BACL          GIDDESLAETLAARFGAERRSRPYMYEETLEILTALRGR-VKLLLLTNGCPALQQEKLDG
A0A1C1A133_9BACL      GVEDRELGHKLGEFFAADRRTRPYVYEETFRVLDALKGN-YKLLLLTNGSPDLQKEKLAG
A0A1H4KNR7_9BACL      GIENRELGYKLGELFPAERRARPLLYEETFQVLDALKSK-YRLLLLTNGAPDLQMEKISG
H6ND54_9BACL          GIDDPELGYRLGELFPAERRSRPIVYEETFEVLDSLKGR-YQLLLLTNGSPDLQKEKLAG
L0EDX4_THECK          GIEDEQLGEELAERFPAERRARPLVYDETFEVLDQLRGR-YKLLLLTNGSPDLQREKLAG
C6CUS6_PAESJ          GVDNEELGAKLAEQFPAERRKRPLVYDETFRVLDALKGK-YKLLLLTNGSPDLQREKLAG
H3SBQ4_9BACL          GCEDEALGAELAERFMRERRARSYVYEETYDILRALKPH-YQLLLLTNGAPDLQQEKLDG
V9W9K5_9BACL          GIEDGLLAEQLGERFIDERRKRPYIYEDTFEVLDQLKGR-YTILLLTNGAPDLQQEKIDG
A0A1C1A465_9BACL      GIENSILASELAEQFMQERRNRPFVYDDTFKVLETLHKE-YALLLMTNGAPGIQQEKIDS
A0A168Q4G1_9BACL      GQYNPDLALLLAERYPVERRKRSFIYDDMFETLTLLRSN-YRLLLLTNGTPDLQQEKVDS
PSP_THET2             GGAPE-RARELAEAFFRERR-RYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVG
Q5SLK1_THET8          GGPPE-RARELAEAFFRERR-RYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVG
Q67KB9_SYMTH          GVRDDALAEAMAERFAAARR-RYLRYPEVDPLLAALRERGYLLGIVTNGVPDLQREKLAV
D7BFN5_MEISD          NISDENLLFELADAWRTARA-LYPRFSEVDALLAALTPK-YKLGIVTNGVPDLQRAKIRG
D6TEM0_9CHLR          DIINDALAEALAACFREERRSCYRVFSDVEAALSTLKQR-YALALLTNGAPDLQREKIRA
A0A146G418_TERSA      LIEDPEGAADLAKTFAKERRLLQRLMPEARETLARLTPN-YKLAMLTNGAPDLQREKIAA
                                    :   *        :    *         : ::*** * :*  *:  

PSP_BACSU             VPELAPYFNEIVISGAFGKGKPDVSIFEHCLKLMNIEKDDAIMVGDNLNTDILGASRAGI
Q62RR1_BACLD          VPELAPYFNEIVISGEFGKGKPDPSIFEHCLTLLGMTKDDAVMVGDNLNTDILGASRAGI
D5DTA0_BACMQ          TSELVPYFDEIVISGAFGRGKPDPSIFDHALSLMDLKKDEAIMVGDNLMTDILGSSRVGM
Q9KAY1_ALKHC          TPELVPYFDHIVISGGFGRGKPDPSIFEHALSLLSLTKDEAIMVGDNLMTDILGASRVGI
E6TQJ2_BACCJ          TPELVPYFDHIVISGGFGKGKPDPSIFEYALSLVPYNKDEVVMVGDNLMTDILGANRVGI
W4QEU7_9BACI          TPEIAPYFDEIIISGGFGKGKPDPSIFEHALARVNVQKDEAIMVGDNLMTDILGANRVGI
W9ABJ3_9BACI          TPELKRYFDHIVVSGAFGKGKPDQAIFEHALDLLSVVREEVVMVGDNLKTDILGASRAGI
A0A4Q3X6N3_9BACI      TPELKPYFEHIVISGAYGKGKPATDIFAYACDLLSVEKEEALMVGDNLHTDILGASDAGV
Q8EN60_OCEIH          SPELVPYFEHIIISGDVGVGKPDTVIFDVALSKLNVSSEDVLMVGDNLHTDIIGANRHGI
D6XSD7_BACIE          TPELVPYFSTIIISGEFGIGKPDPSIFEHALSLAGQKAQDVLMVGDNLMTDIKGANATGI
A0A2S1H4Y6_9BACI      TPEIVPYFDHIVISGDFGIGKPAASIFEYVMEKAQVTKENGIMVGDNLMTDILGSSRVGM
F2F001_SOLSS          TPEIVPYFDHIIISGDFGKGKPDASIFEFVMEKAQVTKDEAIMVGDNLMTDILGSSRVGM
A0A0A3I5F6_9BACI      TPEIRAYFDHVIISGDFGIGKPDASIFEFVMDKAGITAEEGIMVGDNLNTDILGSSRVGM
M7NA31_9BACL          TPEISQYFDLIVISGDFGRGKPDASIFRHVLEKSDTRPEEALMVGDNLMTDILGANRAGI
K0J5Z1_AMPXN          TPEIAERFNHIVISGDFGRGKPDPGIFEYALNIANVTAEEVIMIGDNLMTDILGANRTGI
S0JPU0_9ENTE          TPEIAPYFTHIIISGEVGVGKPDLQIFEFALTTAAVVPQEAIMVGDNLMTDILGANRTGI
A0A223KUW2_9BACI      TPQLRPYFDHIIISGEFGEGKPNSLVFQTALQRTGLSPTEVWMVGDNLKTDILGANEIGI
Q5WGN8_BACSK          TPQLVPYFDHILISGAYGKGKPDVAMFKHALELSGTAKEEVLMVGDNLHTDILGGNQAGI
A0A0L0QUG2_VIRPA      TPQLEPYFDEIVVSGAFGRGKPDPTIFQYMLAKLGVDKTEAVMVGDNLNTDILGASHIEM
A0A0C2W6A3_9BACL      TKELVPYFEHIVISGNVGVGKPSTPVFGHALRLMELSPEDVWMVGDNKKTDIMGANRIGM
A0A0B5AN41_9BACL      TPELVPYFDHIVISGNIGEGKPGQAIFDHALRVSGQSAEDVWMVGDNLRTDILGANGAGI
A0A177L5H1_9BACI      TPELVPYFDYILISGHFGFGKPEKAIFDHALKLMNVEAADALMVGDNQGTDILGATRAGI
A0A1H2R6Z7_9BACI      TPALVPFFDHIIISGEFGTGKPDPAIFTHALRLAGTAPEDTLMVGDNMNTDIAGAKKAGI
D3E8S0_GEOS4          VPELVPYFDHIIISGDFGKGKPDVSIFKHALDLLGVEADQAVMVGDKLTTDIKGGNAAGL
W7YS96_9BACL          VPELSPYFDEIIISGQFGKGKPDPSIFAHALSLFNIAPQEAIMVGDKLTTDIKGGLSAGI
X4ZM27_9BACL          VPELIPFFDHIVISGTFGKGKPDPSIFEHALKRLEISPEQGIMVGDKLTTDIRGGLAAGL
A0A1C1A133_9BACL      VPEIASYFDHIVISGDFGQGKPAVSIFKYAMGLLDIEAEEGIMIGDKLTTDILGSNSVGM
A0A1H4KNR7_9BACL      VPELAGYFEHIVISGEFGEGKPAAAIFNHVLSLLNITANEGIMIGDKLTTDILGSGRVGM
H6ND54_9BACL          VPELVPYFDHIIISGEFGRGKPNPAIFEHAVSLLGIKPEEGLMVGDKLTTDIMGSNAIGM
L0EDX4_THECK          VPELAPYFDHIVISGEFGDGKPAASIFRHALSLLGIGPDAGVMVGDKLTTDILGANSVGM
C6CUS6_PAESJ          VPELTPYFDHIIISGEYGEGKPAASIFRHAMERLGIEPDHGIMVGDKLTTDILGANTVGM
H3SBQ4_9BACL          IPDIIPFFDHIVISGHHPEGKPAPSLFRHAMSLLGIGPHEGLMVGDKLTTDILGAQNVGM
V9W9K5_9BACL          IKELAPYFDHIIISGKFGEGKPSVAIFHHALDLLKVKKEEVIMVGDKLTTDILGASRAGI
A0A1C1A465_9BACL      IPSLASYFDHIIISGTYGVGKPNPSIFQHALDLLRIPPNEAVMIGDTLATDILGAHNVGI
A0A168Q4G1_9BACL      VPELASFFEHIIISGDFGEGKPSESIFRHAIGLLNLEPHEVVMVGDNLYTDILGANRSNI
PSP_THET2             A-GLAHHFSLVLISGEVGIGKPDPRLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGV
Q5SLK1_THET8          A-GLAHHFSLVLISGEVGIGKPDPRLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGV
Q67KB9_SYMTH          S-GLEREVDAVVISGEVDCGKPDPGIFRHICRSLGVAPHEAVMVGDNPGRDVAGGRAAGL
D7BFN5_MEISD          S-NLVQHFQAVAISGELNIGKPDPGIFEWICERLEVAPAECVMVGDNPERDVAGAIQAGM
D6TEM0_9CHLR          S-GLESYFDTIAVSGEVGIGKPEPEIFVHVLRELGVAPEQAVMVGDSLPRDIAGSYHSGM
A0A146G418_TERSA      S-GLGNHFQAIAVSGEHGIGKPKPEIFHRLLSELGVQASEAVMVGNSLERDIAGANNAGV
                         :   .  : :**    ***   :*               *:*:.   *: *.    :

PSP_BACSU             KTVWINRTDKKNE---TDVKPDYIISSLHDLFPILEK----------
Q62RR1_BACLD          QTVWVNRKGKKNE---TDVAPDHEISHLSELFDILRGQAADKLSKKA
D5DTA0_BACMQ          KSVWINRHDKE-R---NEVIPTYEITHLSELHSILDELNS-------
Q9KAY1_ALKHC          KSVWINREQKE-Q---GEVEPTYEIEHLEQLLDILKKLNVQNNMA--
E6TQJ2_BACCJ          KSVWINREDKT-R---NEVIPTYEIKHLEELFSVIK-----------
W4QEU7_9BACI          PSVWINRHEKE-R---NEVTPSYEITHLNDLFTLIEQIENQK-----
W9ABJ3_9BACI          QSIWINHHGKK-P---TNVQPSFEITDLGELAPLIKQLEGKKEA---
A0A4Q3X6N3_9BACI      PSAWINHHRTK-H---QEIVPTYELSRLRELLPIVKGHTKEKN----
Q8EN60_OCEIH          HSVWLNRFNQTNE---TDIQPAYEIKSLDELVTLVDSFSY-------
D6XSD7_BACIE          TSVWLNR-EGKQP---KVVRPDHEIASLDELKKLLPC----------
A0A2S1H4Y6_9BACI      RNVWINRENKPQH---PDVTPTFEVTSLTEFLALLKSL---------
F2F001_SOLSS          RNVWINRESKPHN---PDIVPTYEVTSLTEFLQLVKTL---------
A0A0A3I5F6_9BACI      RNVWINRENKEQN---PEIPTTYEVTSLTEFLNLVKTL---------
M7NA31_9BACL          RSVWLNREGTEPH---PEVKPTYEIDHLGKLAEVISDANR-------
K0J5Z1_AMPXN          KNIWINHHK-QTA---DNVIPTYQVDRLKEIIPIIESISRQK-----
S0JPU0_9ENTE          PNIWINHHQ-QTP---ETVQPTHEVARLAEILPIIEKL---------
A0A223KUW2_9BACI      DTIWINHHNMEAP---EHITPTYTVKGLNGILPIINE----------
Q5WGN8_BACSK          ETIWLNRDGIENT---TDIRPTYEIRRLTEIKNVIAEKKDCSL----
A0A0L0QUG2_VIRPA      ASIWINWQNMENN---G--LPTFEVENLSQVTDLVNVQLKEA-----
A0A0C2W6A3_9BACL      KSIWIQHDGSVGTGSPDEGKEDVKVKRLREVLELL------------
A0A0B5AN41_9BACL      HSVWIQHEASKTPGEGD-GTPDRTISRLKEILDLL------------
A0A177L5H1_9BACI      ESVWIDHGEGKII---DGANPHHTIGRLKEILTIV------------
A0A1H2R6Z7_9BACI      NSAWINHHGSVPS---HEFRAEHELTSLGDLLPLLR-----------
D3E8S0_GEOS4          HTVWINRVDRPHD---PAIQPKFEIKHLSELHAIVASL---------
W7YS96_9BACL          TTVWINRTEKQPD---PEIHPDFEIKHLSELHEVIAKL---------
X4ZM27_9BACL          TTVWINRTGKPSD---PEIIPHYEIKHLSELLPLVESL---------
A0A1C1A133_9BACL      RNIWINHHGLQAG---DEIVPANEVKRLQEILPIITNG---------
A0A1H4KNR7_9BACL      KNIWINHHAIQRT---NEIVPTHEVSRLRDILPIIEGA---------
H6ND54_9BACL          RSLWINRHEITRT---DEIIPVHEIRSLRDIQDIIDSIA--------
L0EDX4_THECK          DSVWINRHGLERS---GEIEPACEIRSLRELPALLERL---------
C6CUS6_PAESJ          TSVWVNRHGAVRN---DEIIPSHEIAHLEELLLLLEQ----------
H3SBQ4_9BACL          HHAWINRKGVTLT---GNIRPEHQIANLMEMTGVIESINQAALK---
V9W9K5_9BACL          KNVWINRHKMSRT---DEIIPTFEITQLKELLPLISSI---------
A0A1C1A465_9BACL      TNIWINRHPEHAP---APIRPSYEVRSLTEIPQLLLSMQVLQQPS--
A0A168Q4G1_9BACL      PSIWINRSNSPKP---DHIHPTREALSLSELHPLLLSM---------
PSP_THET2             RAVWVDRG--LRPED-PEASPDLRVGDLREVF-LAEAL---------
Q5SLK1_THET8          RAVWVDRG--LRPED-PEASPDLRVGDLREVF-LAEAL---------
Q67KB9_SYMTH          LTVWVQRG--GRERD-ERHPADLACTDLSALLPWLEALG--------
D7BFN5_MEISD          RSVWVDRG--FKPRD-KRYPADLEVKNLLEMLPWLEELG--------
D6TEM0_9CHLR          RGMWINRYDDACQEE-YRPMIASQISVLDELEAVL------------
A0A146G418_TERSA      KSIWIKVK--GSEEP-DSAIPDYTIESLSEIPAILEALK--------
                         *:.                     *  .