CLUSTAL format seed alignment for MF_02243

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

I7A2X4_MELRP          ------MEMQKLYEEVENKNIVKNDLVDLTIGESLKIKAYPLSVLKK------DDAFFFI
A0A2E9F380_9BACT      ------------------------------------------------------------
D7CTE2_TRURR          ----------------------------MPSQLPEPLPVPPEARAHP------SFRLHEG
A0A4Q2EDJ3_9ACTN      --------------------------------MSTDYAASRVSYEGA------EFRLQRN
I0I6W2_CALAS          --------------------------------MNDAVYALGRSSRNG------TLQLIVR
F0STN2_RUBBR          ------------------------------------------------------------
L0DE41_SINAD          ------------------------------------------------------------
D5SVB9_PLAL2          ------------------------------------------------------------
D2R2D8_PIRSD          ------------------------------------------------------------
C7M9N2_BRAFD          -------------------------------------MTLRTDALTA------SISYDGS
A0A2A3YL22_9MICO      -------------------------------------MTLRNDSLEA------SIRYDGS
A0A4V1FKD3_9MICO      -------------------------------------MTLRTASLTA------DVTRTSD
UXAE_THEMA            ---------------------MVLKVFKDHFGRGYEVYEKSYREKDS------LSFFLTK
A8F5F7_PSELT          ------------------MAENIVEKFEKLFKGKYKIYYSSIRKLEK------SFFFMIR
Q8R8Q1_CALS4          ---------------------MINKVAEYLSREGFYFYEKSFRKFSE------DIYIFVV
D9TSK1_THETC          ---------------------MIGNVLSTLEENGFKVYPDSLRKLGE------NIYIFVV
B8E1J8_DICTD          ---------------------MLKLLNESLKPLSIFIYSESLRKIND------DLYIFVA
A0A2H5X238_9BACT      ---------MRLSDNIARFEPEWQEAARFLQEHGLRFYPRSIRQAGE------VSIAFAK
A0A212Q100_9CHLR      ---------MMLSP---------EALAEGLRLYGLHLIVGSIRELPD------GGAIFAA
A1HM20_9FIRM          ----------------MQSREELKRAILSEFGDYN-IYSESIYRAGG-----CVLFLAKD
F4LWC3_TEPAE          ----MTTVVEKFCSKVISNGLNIEEAKAEAVDNFDDIYPDSIHEIDA-----NMIFLARI
F5YF09_TREAZ          ----------------------------MDYLGFN-AYEKSINRKGA-----STVFLAAD
L7VIG5_THES1          -MGNWKDFVKDFCTKEK-NIEVLRAEAEKAFGNYG-VYPRSINEVGN-----AIVMMARG
A0A2X4Z8Y1_BACLE      ------------MKHLLAAIELLEQSKIDFDITNMKVYKKSYIYHDN-----VHLIMIKD
Q8ET95_OCEIH          ------------------MLSNLKSGEIGKETGDIKIYKQSFSQYQG-----TFLVMIKE
F0RRZ2_SPHGB          -------------MELYDSKQINTQVLEARLGKPVRLYERSVTSLGE-----CLIALIRA
E4RPZ0_HALHG          -------MPWRDFAEELVGTSKEAIKKLAEYAEDYRIYPRSINKLGK-----SFFFLAKV
M5DZ00_9FIRM          -------MSWKDFAEELVGTSKDAVKKVAEYAEDYRIYPRSIIKKEK-----SFYFLAKI
E1R2I9_SEDSS          MIETLLSLFFDVGIKSFFKKDFRERQALFLCIKDKSEALNDIHILGSEKVLERTLFFICL
A0A2U1B1T2_9BACT      -----MINIAESALALLKKSEAEARKLLKKESGPVSVAASSVHKLGE------ALVMIGQ
C2D2C0_LACBR          ----MEELMMNLNQLLDDVKEILAADGNYDQLSNKDIYTPSIQVDRR-----NVYFILHQ
M5AAI2_LACBR          ----MEAILMDLQKLVSDVYEIIDAQGNYDNLSDKEVYAPSIQVERR-----NVYFILHE
R0EQ81_PEDAC          ---------MALENLLLDVKKLIE---NPDADVDEGIYRPSVQIDRR-----NVYFIYRE
D2EH76_PEDAC          ---------MALENLLLDVKKLIE---NPDADVDEGIYRPSVQIDRR-----NVYFIYRE
A0A512K7U7_PEDPE      ---------MNLKNLLTDVKTLIE---DRNADVDSGIYKPSVQIDRR-----NVYLIYRE
F8EY78_TRECH          ------------------------------------------------------------
B4CUN3_9BACT          ------------------------------------------------------------
E8X1V5_GRATM          ------------------------------------------------------------
E8V2A9_TERSS          ------------------------------------------------------------
Q01NV0_SOLUE          ------------------------------------------------------------
C1F2M1_ACIC5          ------------------------------------------------------------
Q7UT39_RHOBA          ------------------------------------------------------------
D5EN49_CORAD          ------------------------------------------------------------
F0SA09_PSESL          ------------------------------------------------------------
A0A1T5G6S5_9BACT      ------------------------------------------------------------
A0A371QLW9_9BACT      ------------------------------------------------------------
G0GEJ7_SPITZ          ------------------------------------------------------------
S3XC99_9ACTN          ------------------------------------------------------------
A0A2R3ZAY0_9FLAO      ------------------------------------------------------------
A0A1I1JC37_9FLAO      ------------------------------------------------------------
                                                                                  

I7A2X4_MELRP          GKENYDKFLFVISAGKENGLLNEFEGELIDAGKDVTVKKCNLSTKNRKAVQKIFPHTAPI
A0A2E9F380_9BACT      ---------------------------------MVHDRIATVEPQTRNSL-------APS
D7CTE2_TRURR          AALWLAGARLAVLAPPEHPALTRFRGEVQHVGDHRLLRAERRAENAAALRALLPDL-QPR
A0A4Q2EDJ3_9ACTN      DD----RSQSLVITGAPESLTAAFSGR----RDGDAFVAPATGENAAALRSVLPWL-KPR
I0I6W2_CALAS          GN------------------STGFHGE----QQGDALICPLDAENARTLQERLPWL-RPQ
F0STN2_RUBBR          --------------------------------------------MSEQSK--------CT
L0DE41_SINAD          --------------------------------------------MTQRTTDQANPP-ACV
D5SVB9_PLAL2          --------------------------------------------MS------------AQ
D2R2D8_PIRSD          --------------------------------------------MALLPIR------PPQ
C7M9N2_BRAFD          AR-------SLRLEAATAAPLAPFEGSASAAGDGHVLTGPLSTANAKALQSVFPALRPQL
A0A2A3YL22_9MICO      AR-------SLQLVASAADALTAFEGQASAAGDSHVLTGPLSTANARALQTAFPALRPQK
A0A4V1FKD3_9MICO      GS-------RLLLRASDAAALAGFDGELSTDGGDHLLAGPLSHENAVALRAAIPALRPQL
UXAE_THEMA            EEEGK-ILVVAGEKAPEGLSFF-----KKQRAEGVSFFFCERNHENLEVLRKYFPDLKPV
A8F5F7_PSELT          DQKQKYLISIAKKRICEKFEGK-----KIGRINDLDILMCPTNDYNCKVIRTLF-NINPS
Q8R8Q1_CALS4          KKANEKSIGLLTQGD-FTLSSPYFTERKYLKEIGYYLNLYPLTYENFVILKDKF-SIAPS
D9TSK1_THETC          KRQNEKMVGILSSSD-VKLNGAYFSEDKNVSD-KLRLNIYPFTFENYVTLNGKF-HIGPT
B8E1J8_DICTD          KIKDLKKIGIVKQNQILYFSSPYFSEDKKIEGTNFLVNLYPLNFENYQKLKEII-PISPK
A0A2H5X238_9BACT      YEGQ----GFVVCRQPLPMAEP----GALLQLGE--LYLYPVDWHNYLALRELL-SLSPT
A0A212Q100_9CHLR      RQGSERRIGWIGETSPFPAPDP----RMSMRVQEHLVWIHPWTWAHYRILRERLPALSPT
A1HM20_9FIRM          MGQKLL---VVVEEETGSAFDRFVGPQVYHPSGKRVKEAPLQPVNAGIVRELLPFTAPVA
F4LWC3_TEPAE          EGCKKL---VLIENKSPALTDEFQTESKINLKDKKIKFASLSHKNADALRKLLPFTSPVT
F5YF09_TREAZ          -GNETF---LVVQGKNPGFKGTKLPGNKFKI--------PLDHKNAVILRKLFPFTAPSR
L7VIG5_THES1          ENEKCL---VVVGEDS---RLQELKGNQTEENGLKVKVCPLSNENCYVIRKIFPYTNPQP
A0A2X4Z8Y1_BACLE      KAKKGI---LAVGNGQ---LFDDLEGTDIEG---KGKFCSLSHANRLVLNRYFDYTVPRA
Q8ET95_OCEIH          SADKFL---LASGEGE---LYSELEGEEIGG---EGKVCPLTHHNRLVLNRYFDYTVPSA
F0RRZ2_SPHGB          GRNKYL---VCQGSGP---VFEELSGENFP----LCKICPANHANRLVLNKYLPYTIPVA
E4RPZ0_HALHG          EQKKKL---IILNESK---HFESFNGEIEEFAGFKAKVAPLNHHNAQRLRKLFPHTAPKV
M5DZ00_9FIRM          DQKKKL---VILNKSK---NFDIFQGKTEKLAGFKAKIAPLSHYNAEIIREVFPFTAPSK
E1R2I9_SEDSS          DVRRSE---KFLVLLSDKVIEPQFIGVIRSYKNIYYQIVPINWENTKVLHRLFPFTKPIS
A0A2U1B1T2_9BACT      GTERRF---LLVVADYPQVLPAGFEGELHRLSDGAALVGKLSAANAAALRRHFPWTAPSS
C2D2C0_LACBR          TDSEGIIQKSLVVYENRLTAGDFDAEDSLTDVDSTLLVGELNEKNNDALAKRFQWMRPTS
M5AAI2_LACBR          TQNK-QTVKTLVVYEDRDDAKEFDAKDSIQDANKTLIIGDLNETNWHALAKRFAWIKPTS
R0EQ81_PEDAC          GIKK-----SLVVYEDARNARDFQADETLVDDDYVLLKGPLNFFNNQALAKRFAWIKPSS
D2EH76_PEDAC          GIKK-----SLVVYEDARKARDFQADETLVDDDYVLLKGPLNFFNNQALAKRFAWIKPSS
A0A512K7U7_PEDPE      GRNK-----SLVVYEDARAIKDFQADECLIDDDYALIKAPLNFFNNKALAKRFAWINPSS
F8EY78_TRECH          -----------------------------------------------------------M
B4CUN3_9BACT          --------------------------------MQKAAISRRRNWAKWLQTTSLNLSMQSF
E8X1V5_GRATM          --------------------------------------------------------MSDD
E8V2A9_TERSS          --------------------------------------------------------MAET
Q01NV0_SOLUE          -----------------------------------------------------------M
C1F2M1_ACIC5          -------------------------------------------------------MAGNT
Q7UT39_RHOBA          -----------------------------------------------------------M
D5EN49_CORAD          -----------------------------------------------------------M
F0SA09_PSESL          ------------------------------------------------------------
A0A1T5G6S5_9BACT      -----------------------------------------------------------M
A0A371QLW9_9BACT      ------------------------------------------------------------
G0GEJ7_SPITZ          ------------------------------------------------------MTTPGS
S3XC99_9ACTN          ------------------------------------------------------------
A0A2R3ZAY0_9FLAO      ------------------------------------------------------------
A0A1I1JC37_9FLAO      -----------------------------------------------------------M
                                                                                  

I7A2X4_MELRP          VLGLCNSFGCGDRLGVANAGHIRAIKQSN------FRPILAQQSIRELTRTNRTPDDVMD
A0A2E9F380_9BACT      LLGLHPSFGFGDRLGLATPGHILATQSGQ------LLPVXAQQSVREMDRTNRTPLEVMS
D7CTE2_TRURR          PLGLVTSAGFGDRLGVATPGHVRAAQRYG----AGVAPVFAQQSIREMTRTGRTPQEVLD
A0A4Q2EDJ3_9ACTN      RWGLETSAGTGDRLGLATPGHVQAFKDV-----AGVNPVFAQQSTREMGRTHRTPRNVLD
I0I6W2_CALAS          PLGNRLSFGFGDRIGLATPGHVDALRSADPT--GRIAPIFAQQSVRENQRLNRTPQEVMT
F0STN2_RUBBR          PLGLSASFGFGDRIGLATPGHVAAMKRSG----NGIEPIFPQQSIREMTRTQRTPQQVMD
L0DE41_SINAD          TLGLEPSFGFGDRIGLATPGHVEAMQRSG----AGIQPIFPQQSIREMARTGRTPLQVMN
D5SVB9_PLAL2          CLGLSPSFGFGDRTGLATPGHIAAVNASS----SGILPIFAQQSIREMARTGRTATQVME
D2R2D8_PIRSD          PLGLAPSFGFGDRLGLATLGHVDAMRSHS----GPILPVFAQQSMRELSRTGRRPADVLT
C7M9N2_BRAFD          IGGHRTSVGTGDRTGLATPGQARAFAADG----GDVMPVLAQQSIREMDRLGRSARAVMD
A0A2A3YL22_9MICO      ISGHRTSVGTGDRTGLATPGQARAFATQG----PGVMPVLAQQSIREMDRLGRSARSVMD
A0A4V1FKD3_9MICO      VTGHRTSVGTGDRLGLATAGQAAAFAAVG----GEVLPVLAQQSIREMDRLGRSAREVMD
UXAE_THEMA            RAGLRASFGTGDRLGITTPAHVRALKDSG------LFPIFAQQSVRENERTGRTWRDVLD
A8F5F7_PSELT          VCKKNTSFGFGDRLGLATPAHTTLINKYD------VFPVLAQQSVRELSRTHRNFKDVLD
Q8R8Q1_CALS4          PCNKKVSFGMGDRLGLVTAAHIRAVENYD------VFPVLAQQSPRELMKTHRSFKEAIL
D9TSK1_THETC          VCRGNSSFGTGDRLGLVTAAQLTALKKYD------VFPILAQQSPRELIKTNRDFKDVLL
B8E1J8_DICTD          VCDKKISFGTGDRLGLITSAQLSALKEYD------LFPILAQQSPRELIKTKRDFKDVLL
A0A2H5X238_9BACT      PCNKPASFGTGDRLGMVTAAHLQALQSYD------VFPVIAQQSPRELVRTGRDFREVLL
A0A212Q100_9CHLR      RCDRPASFGAGDRLGMATAAQIAALERYP------VFPVLAQQSPRELARTGRDFRSVLL
A1HM20_9FIRM          LGATGLSLGLGDRLGVASPGHLRLIKKT------GVRPVLAQQSVRELTLTNRTYSDVLD
F4LWC3_TEPAE          FGKNGMSMGLGDRLGLASPGHLRLIKNT------AVKPVLAQQSIRELDLTERTYEEVMD
F5YF09_TREAZ          VLKQERSFGVGDRLGIAAPGHIRVFEKY------DAWPVFAQQSIRELNLTNRTYEDVLD
L7VIG5_THES1          HKGKNITIGLGDRLGLASPGHIRLIRDL------DVFPVLAQQSIRELNLTGRTYEDVIS
A0A2X4Z8Y1_BACLE      FGTKIATMGLGDRLGLASPGHIETVKGK------SVKPILAQQSIRELTLTNRTMNDMLD
Q8ET95_OCEIH          FGKNTATIGLGDRLGIASPGHIEAVRDR------DVKPILGQQSIRELTLTKRTMEDMID
F0RRZ2_SPHGB          NTARRPSLGLGDRLGEATAGHIEALKGT------NVFPIFAQQSIRELNFTNRTFDDVID
E4RPZ0_HALHG          LGNKNPSIGLGDRLGIATPGHIDAVKES------EVMPVFAQQSVRELNLTNRSFEAVLD
M5DZ00_9FIRM          IGNQTASIGLGDRLGIATPGHIEAVKKS------NAMPVFAQQSVKELKLTGRSFKSVLD
E1R2I9_SEDSS          LRAKKTTFGCGDRIGLATAGHIQAISAYG-----EVYPVLAQQSIRELNLTKRNYRDIIA
A0A2U1B1T2_9BACT      LHDCRTTIGCGDRLGLAGRGQLASIRKF------KVKPVLAQQSKRELSMTNRSFQDVVD
C2D2C0_LACBR          RRNYKYTFGLGDRLGNASNAHLRLFKGR------GIMPVLAQQSIRELVLMHRTNTDVFQ
M5AAI2_LACBR          RHGYKYTFGLGDRLGNASNAHLRLFKGR------GIVPVLAQQSIRELLLMNRTETDVLL
R0EQ81_PEDAC          RHGHKYTLGLGDRLGIASNAHLKLLKGR------GIFPVLAQQSIRELLLSNRTFTDVIE
D2EH76_PEDAC          RHGHKYTLGLGDRLGIASNAHLKLLKGR------GIFPVLAQQSIRELLLSNRTFTDVIE
A0A512K7U7_PEDPE      RHGHKYTLGLGDRLGNASNAHLKLLKGK------GIFPVLAQQSIRELLLSNRTFTDVIQ
F8EY78_TRECH          KQLERFSMGIGDRFGHQGKAQLEALAEAKHL-GCTIIPVWNK-SYREHSIIHTEPGQVRK
B4CUN3_9BACT          KSVEKYTLGMGDRFARQGKAQLAAIAQARTM-GIGVTPVWNK-SNREHSLVGTEPASVLA
E8X1V5_GRATM          LKLPRFSVGVGDRFAHQAKAQLQACIMAADA-GVEVVPVWNK-SNREHMIIGSEPSATRL
E8V2A9_TERSS          LQLPKYSIGMGDRFAHQAKAQLAACVLAEKA-GVTIAPVWNK-SNREHLIIGSEPSGTRS
Q01NV0_SOLUE          LTLEKFSLGVGDRFAHQAKAQLRACLMAAER-GATVIPVWNK-SNREHGIVGSEPPSVRA
C1F2M1_ACIC5          LTLPKYSLGTGDRFAHQAKAQLQACILAAKQ-GVEIIPVWNK-SNREHTIIGSEPASVRA
Q7UT39_RHOBA          LTIEKYSFGVGDRFAHQAAAQLRSFTRLAEK-GIHVAPVWNK-SNREHTFVGSEPQSVYD
D5EN49_CORAD          KKLPRFTFGMGDRFGHQGEAQLKAVLEARAT-GIDLAPVWNK-SKREHTLIGTEPQSLRD
F0SA09_PSESL          MQIGKYSFGTGDRFAHQGEAQLKALIDAKEKLGVDFVPVWNK-SNREHMIVHSSPADLRK
A0A1T5G6S5_9BACT      KKLSKYSIGMGDRFAHQAKAQLSAVIEAEKK-GFSITPVWNK-SNREHTTIGSQPADTRN
A0A371QLW9_9BACT      -MLGKYSIGTGDRFGQEGEAQLKAVLNANNGDGVTIYPVWNK-SHREHQIIGTNHDEVRE
G0GEJ7_SPITZ          LSLPRYSIGTGDRFGHEAEAQLRAVIEAERL-GMALGIVWNK-SYREHTIIGSRPEDVRR
S3XC99_9ACTN          MTIARFSMGAGDRFGTEGAAQVAAFEKIQAD-GVEVDIVWNK-SNREHVTVGTTPADQRA
A0A2R3ZAY0_9FLAO      MKLGKYSFGTGDRFGKEGKAQLQAILKMEEK-GVEVTPVWNK-SHREHRTVGTQPESIRK
A0A1I1JC37_9FLAO      AELGRFSFGTGDRFGKEGKAQLNAILKIQED-GIPVTPVWNK-SNREHETVNTKPKSVLE
                            : * *** .    .:                 :  : * :*             

I7A2X4_MELRP          AAVWAVLQEGYKDGFGSDADHLKTFEDIDLMLNAGFTMFTFDPSEHVDNEADNYSEDQLK
A0A2E9F380_9BACT      TAQEAIRTSGWQGIWGADADHLKTETDVINLANAGFTFFTIDPSEFVNNAADNLVQNXLK
D7CTE2_TRURR          DATWGAFAAGWRGALGADADHQKTVADLERCAAAGFTLFTVDPSDHVDDSAHGAPASDLE
A0A4Q2EDJ3_9ACTN      DATWGAFQEGWTGGVGADADHQKTEESLSECAEAGFVFFTIDPGDEMDMAAHDDDEATVR
I0I6W2_CALAS          AAVWSLFAENWRLPWGADADHVKEPEHLAPYVAAGYTFYTIDPSDHVDNAAHTDDLAVLR
F0STN2_RUBBR          DAMNGARDAGWTGRIGADADHLKTPNDVEVTAAVGFTFFTIDPSDDVDQRADDYDEATLR
L0DE41_SINAD          DALGGMRAAGWNGRTGADADHLKTTADVDVTAAVGFTFFTIDPSDSVDAHADDYDEATLR
D5SVB9_PLAL2          DAFRAVRNAHYEGPVGADADHLKTEADVEVTAEAGFVFFTIDPSAEVDQKADNYSFDELK
D2R2D8_PIRSD          DTTFALESTGYTGIWGADADHITTQEHLNATAGAGFTLFTIDPTHHVDPHADSYAPAVLE
C7M9N2_BRAFD          DAVFGLLEAGWDRGFGADCDHIKTTEGIDRGLEAGFVMFTLDPGDLVADVTGGVSAADAE
A0A2A3YL22_9MICO      DAVFGLVEAGWESGFGADCDHIKTTEGIDRGLEAGFVMFTLDPGDLVADVTAGVSAADAE
A0A4V1FKD3_9MICO      EATFGLVEAGWDRGYGADCDHIKTTEGIDRGLDAGFTMFTLDPGDAVQDVTAGATLEQAL
UXAE_THEMA            DATWGVFQEGYSEGFGADADHVKRPEDLVSAAREGFTMFTIDPSDHVRNLSKLTEKERNE
A8F5F7_PSELT          SAIWGIFESGYEGEFGADADHVKDINDLMQAAYEGYSMYTVDPSDHVKNIDKINQGELVE
Q8R8Q1_CALS4          KAILGVLEEGYTGKFGADADHIKDENYLMEAIDAGYTMYTLDLSDMLVKLSDYTESQLKE
D9TSK1_THETC          KVVLGVLETGYIGHFGADADHIKDEYNLLEGINAGYTMYTLDLSEQLIDISSLNASEMRN
B8E1J8_DICTD          KSAMGVLETGYTGKYGADADHIKDEKYLMEAIDAGYTMYTLDISDFIEKIKDLSEKALKE
A0A2H5X238_9BACT      SAVCGVLETGYTGQFGADADHIKHEQQLLQAVEAGYSMYTIDLSDPLRDVTRLTQPEIVD
A0A212Q100_9CHLR      DAAWGVFASGFAGPFGADADHLQDDEQLRAAAEAGYSLYTFDLRRALARGPR--------
A1HM20_9FIRM          AATWAVLQEGYEGGFGADGDHLKTAEEIKGALDLGFTMITLDASAHIDNTVGQKAAKQVA
F4LWC3_TEPAE          AASWAVLQEGYHSGFGADGDHLKTEDEVKMALNLGFTMITLDCSEKINNDVPLMNDDEVV
F5YF09_TREAZ          AVTFAVFREGFKKPWGADGDHLKTAKDVKYALSLGFTMITLDCSEHIKNDVTDENAPELP
L7VIG5_THES1          AAAWAVFQEGYTKGYGADGDHLKTAEEVKMSLNVGMTMITLDCSEHIDNSAAHAGLSELR
A0A2X4Z8Y1_BACLE      AACFAVFQEGYKDGFGADGDHIKEEKDIQYALSLGISMLTLDCSDQIPKGIEKKSAEQLS
Q8ET95_OCEIH          AATFAVFQEGYRDGFGIDADHIKTEDDIKRSLEIGVTMLTLDCSDYIQKNVESASEKQVQ
F0RRZ2_SPHGB          AAAYAVFQEGYTTGYGADGDHLKKCPDIEKSLSQGATMITLDSSEQIDNSIQSLDEDALL
E4RPZ0_HALHG          DVSWAVFQEGYEDGFAADADHLKNKNEVETALDIGYTMITLDCTDYINNLREGITFQELK
M5DZ00_9FIRM          DVSWAVFQEGYQNGFGADADRLKEKPEIKEALDLGYTMLTLDCTDYINDNFDQTAESDIE
E1R2I9_SEDSS          EVSFQVFQEGFERGYGADGDHLKTIEDINLALDAEMPMITLDLSDHLHPAVFKWSDDEIV
A0A2U1B1T2_9BACT      AACFSVFEADWREGWGADGDHLKTIADLEPALAAGMPMVTLDLSDQIVAAAAAWEDGEVS
C2D2C0_LACBR          SASWAVFEEGFTYGWGADGDHVKTPYEVDYAVKIGCSMITLDCTEEINNDIVNLKDDELD
M5AAI2_LACBR          DAGWSVFEEGYTDGWVDDGDHVKNPHEVDYAVKAGCTMITLDATEKIHNEVADFSDEELD
R0EQ81_PEDAC          AASWSVFEEGYRDGWGADGDHVKNAYEIDYAVRSGATMITLDLTEKTHNEYLAYSDEDLD
D2EH76_PEDAC          AASWSVFEEGYRDGWGADGDHVKNAYEIDYAVRSGATMITLDLTEKTHTEYLAYSDEDLD
A0A512K7U7_PEDPE      AASWSVFEEGYTDGWGADGDHVKNAYEIDYAVRSGATMITLDLTEKTHTEFLNYSDEDLD
F8EY78_TRECH          EADWAVAALGWQDPYHVDADHISM--KTVDLFLDSSDFFTLDVADYTGKA--ADEASIAR
B4CUN3_9BACT          EAEAAVAALEWAGGFHVDADHIHL--QTVDRFIAPSDFFTLDVADYVGQR--ATEESIEG
E8X1V5_GRATM          AADAAVKELGWTKPYFLDADHINL--KTVQRFLDPCDFFTLDVADLIGQP--AKPEDVTQ
E8V2A9_TERSS          AADVAVKELGWTGPYFLDADHINL--KTVDRFLAPCNFFTMDVADDIGHP--AAAEDVAA
Q01NV0_SOLUE          AADQAVSQLGWKQPYHVDADHINL--STVDRFIDASDFYTLDVAGAIGQP--ASPEDVAA
C1F2M1_ACIC5          AAEAAVKELGWSKPYFCDADHITL--QTVDRFLAPCDFYTIDVADMIGQA--APIEAIEA
Q7UT39_RHOBA          AAAAAVEKLGFDRPWHVDADHIGL--KTVEPFLPCSDFFTLDVADSIGKP--ADQADIDA
D5EN49_CORAD          EVDAAVKALAYEGDYFVDADHINY--ETVDDFIACSDFFTLDVAEELGKP--PASVDTAV
F0SA09_PSESL          EADDAVKVLGYTGPYFVDADHINF--SNIDKFIDYSDFFTIDVADYIGKK--ASDSDLDA
A0A1T5G6S5_9BACT      AVDVDLKEMGWNKPYFIDADHINL--DNVEKFMDSSDFFTIDVASYIGKQ--GDCAEKDA
A0A371QLW9_9BACT      EADSAIKKLKWDKPYFVDADHITR--KIVDPYIQSSNFFTIDVADYIGKP--ADESDKEE
G0GEJ7_SPITZ          MADKAVSALEWEGPYFVDADHITT--KTVELFLDSSDFFTIDVAEAIGQEEISPQEEEDL
S3XC99_9ACTN          AAEAAIARTGYSRPYYIDADHVGM--DNVDWFIGHSNFYTIDVTNCIGRS--ATPESAAA
A0A2R3ZAY0_9FLAO      EADKAVQELQFQKAYFVDADHINA--EIVEPYIPVSNFFTIDVADYIGKS--ASNKEKKE
A0A1I1JC37_9FLAO      EAKNAIKALNFTQDYFIDADHIDR--DTVDPFLENSNFFTIDVAKFIGEQ--SISEDIVG
                                :      * *:                : *.*                  

I7A2X4_MELRP          QKLGEIDWSGLQDTSADAAKRYVDMTFNISERLSLTIQESD-FLRAYAKYGNAIAHIKKM
A0A2E9F380_9BACT      KALDXVVKSQAFESIGQIEDLYLGKGIEVSNDLTLDFKDREKLYRAVVKYGRAIAYAEKM
D7CTE2_TRURR          AKVAALPWRELETTRADF-ERYAGRRLELG-DRELVLAREA-VLRAGAKYARAVLHVATL
A0A4Q2EDJ3_9ACTN      SKAAAIDLSSLDTSADDIVSRYAGQTIELE-SGPLTLDEES-VLRAVAKAGPALVRGLQL
I0I6W2_CALAS          SKCEALPWDILETTYLSLCENYCGRTIVAE-KTTLHFDKET-LLRALAKYGRALAHTVRI
F0STN2_RUBBR          EKFETA------RNTATWYDGYLGKSISLPTGTKIELTEEA-CMRAAVKYGAAIQKALEL
L0DE41_SINAD          TRFAAV------ADEVDWVQSYQGKSVGLATGTVVQLNEEA-CLRAAVKYGRALNHALRI
D5SVB9_PLAL2          YRFHDV------RELSPWVETYLGRTISLSTGSTIEMTEPV-LYRAAVKYGRAIQLAIRL
D2R2D8_PIRSD          HRYRDL------RDDIGWADDYFGKQYVFA-GETVVFEPLA-VKRAAVKFGLAIAHAIKL
C7M9N2_BRAFD          ALPWDA----LEDTLADLTARYVGMTLDIGHSQI-EVTEQD-VLTAAVKYGPAVVEAMRL
A0A2A3YL22_9MICO      ALPWDQ----LEDSLEDLKKRYVGMTLDVGHSQI-EVTEQD-VLTAAVKYGRAVVESMRL
A0A4V1FKD3_9MICO      ALPWDV----LEDTWEGTLARYAGIRVEVAPGLVLEPDEQE-VLTAVVKYAGAVAEAIGL
UXAE_THEMA            KFEEILR--------KERIDRIYLGKKYSVLGEKIEFDEKN-LRDAALVYYDAIAHVDMM
A8F5F7_PSELT          FYKSHPL--------RKEIEMIYSGKVFSFEKSKFTMEDKE-LFRIFVTYVDAIEHVVKC
Q8R8Q1_CALS4          KAEKLNIT------SKRIIERFKGKKFVMPTKEAFTVSEEE-LYKSALTYEKAMDFVEKV
D9TSK1_THETC          KAQELSQV------SKDIIKDFSGKKLDIISDSGYVVSEEE-LYKSAVAYENAMKFVDKV
B8E1J8_DICTD          KYEKVSSF------SKKIIDKYAGKRVKISDEEYFELSYNE-LCKSAIVYEKALSFVEMV
A0A2H5X238_9BACT      KMRTLSPL------SQTIIRDHANMRLRTEDGEQYVLEAER-LVQSAITFEEAVQQAVRF
A0A212Q100_9CHLR      PWEALSPL------ARSVVAELADRRVEAPQG-PRTLEESA-LRAAACRYEPALEEVVRG
A1HM20_9FIRM          ELYHTLPA----DYTADMEEHYLGKAFIVG-GMAITFDTET-LQRLVLTYGKALAFMGYI
F4LWC3_TEPAE          KAYDELKS----DYRKRIEKDYLDNEFVID-QYKIKFDDKN-LQRLALIYGKALDFIAHI
F5YF09_TREAZ          KKY---------------SDKYLGKQFDVGEGLVLSFTETD-LKKIAAIYGEAITFAVDM
L7VIG5_THES1          EKYSRFTE----EERERWERKYLNRDVKIG-NYSFHISEED-LIRMACVYGGAIRHTLDI
A0A2X4Z8Y1_BACLE      VDYEKLPR----AIKDHYNEQYLNKTFDVD-GLYISFDEKL-LMENVLQYNEALNYMVHV
Q8ET95_OCEIH          DEFEKLDA----KVKEYYLHTYCNQEFNIK-ERKIVFNELD-VKRNVLIYEKAIDYMVHV
F0RRZ2_SPHGB          ARYQAVEE----QIRELYERLYQEQLLTIG-EYTLKLDRKH-LMQDVLTYHKALDFIQLV
E4RPZ0_HALHG          AQYEEIAD----YLKDGLESQYLNKTFVLGSNHELEYNKMN-FYKIVLTYYQIIDFAKEI
M5DZ00_9FIRM          SAYAEVPD----YLRDGLESKYLNKTFVLNSGYQLEYNKVN-FKKIVLSYYQILDFVKEI
E1R2I9_SEDSS          RSFAKLSL----DDRNFVIDLFLGKKWEIK-GEQYVPSQTE-IERCTLIYLEAIRYTKIV
A0A2U1B1T2_9BACT      ERFGDCDP----AEQERIRSEYENQVFVVG-ESEVAVDGAT-ARRCAVMYGAALDFAVKV
C2D2C0_LACBR          KRFNTLDP----DQISYFNDTYLNKTFDLGNGRSVKFTKHD-VEESVLTFYDAILFAAGI
M5AAI2_LACBR          AKYNALNK----DLVDRFNETYLDKTFQISDDAAVHFSKRD-LEESVLIFFGAVKYAIFI
R0EQ81_PEDAC          AKYNELAP----EIREKFEKKYLNHRFELGNGDVVEFSPRD-LKEAVLAFNEGVLFAEWV
D2EH76_PEDAC          AKYNELAP----EIREKFEKKYLNHRFELGNGDVVEFSPRD-LKEAVLAFNEGVLFAEWV
A0A512K7U7_PEDPE      AEYNKLSD----EIRHGFEEKYLNKKFDLGNGQTVEFTNRD-LKESVLVFNEGVLFAEYV
F8EY78_TRECH          FVAKHQ--------------HCIGKLQIPGIEQPITITETT-LTSVARKYLLAIQEAGKL
B4CUN3_9BACT          FIQENW--------------HLRGRVFIPGLDEPLAIDEQL-LRATAEKFLWAMEEAGRI
E8X1V5_GRATM          FIHNHP--------------ELVGEVVIPKITEPFKTDKAF-VEGVANKFLAAVKHAGEI
E8V2A9_TERSS          FVARHP--------------ELIGNVAIPRIEKPFEIDEAF-VRGVANKFLAAVQQAGAI
Q01NV0_SOLUE          FVAAHP--------------ELTGTVTIPGIDHPFTITREA-VAEIAGTYLAAVQQAGAI
C1F2M1_ACIC5          FVNKHP--------------ELLGKIELSGIDESFTITAED-LRGTASKFLAAVKQAGEV
Q7UT39_RHOBA          FVAKHS--------------ELIGTLELEGLSAPLTITEED-VRRVAGQYMLATKEAGEI
D5EN49_CORAD          RYSEAL--------------LALGSVELEGLDGPMVFDAET-VKELVATYGGAVEAAKKL
F0SA09_PSESL          FIVSNK--------------KYTGKLHIPGIANPFDVSEDL-LRAIAEKFLYAVQEAGRI
A0A1T5G6S5_9BACT      FLKKME--------------SYVGSFSIPGIAKQITVSREQ-LENITSQYLYAACMAGET
A0A371QLW9_9BACT      FINNNK--------------SLTGEVSIPGISKSFNVSETF-LQNWCDQYLHAIQEAAEL
G0GEJ7_SPITZ          LSSLDD--------------LLNRELAIPGLSNPLTISEET-ARETIRAYWPAVREAARI
S3XC99_9ACTN          FRERSQ--------------QLLGSFTPEGSNQSIDITPEV-LDRFITKYLFAVEEAGRI
A0A2R3ZAY0_9FLAO      FLRYFE--------------KYTKGFKIDGFSSEIKISEAE-LEEMTNSFLLAMKKAGEV
A0A1I1JC37_9FLAO      FKKFFQ--------------QYLSSFNIEGIDAKIDISEAD-FKEMTKTFLFAMKKASEV
                                                                                  

I7A2X4_MELRP          YDYLASKAD--KDTFEIEVSVDETESVTSPFEHFFFANELNRLGVKYVSLAPRFIGDFEK
A0A2E9F380_9BACT      SGWITEATS--GADFEIEXSVDETDTPTTPIEHLFIGMELKRREVQCVSLAPRFVGQFEK
D7CTE2_TRURR          YRHLEGK----GAPFELEVSVDETATPTSHAEHAVVALELRRLGVRWVGLAPRFVGRFEK
A0A4Q2EDJ3_9ACTN      INHVEGL----GVEHELEFAIDETDKPTTLVEHVVVVKELQRNGVELISFAPRWVGQFEK
I0I6W2_CALAS          AAALRTALG--GTSFDLEMSVDETDTPTSAHEHFFIANELLRRNIPLVSLAPRFVGKFQK
F0STN2_RUBBR          GDYIRKVHEAKNADYEIELSVDETDQPTTLAEHYIIADQCLKGGMKLVSLAPRFIGELEK
L0DE41_SINAD          AEHIATVHDQAGRDYEIELSVDETEQPTTLAEHYIVADQCLKRGMKLVSLAPRFIGDLEK
D5SVB9_PLAL2          GQYIQQVQDRAGRPCEIELSVDETDQPTTTAEHFIIAQQLLNAGIRLVSLAPRFIGEFEK
D2R2D8_PIRSD          AAHVDRLVAKKGSQYELELCIDETPQRTTALEHFIIADQCLKSSVRLTSIALNYVGDLEP
C7M9N2_BRAFD          YRHVVDNAP---HEVEIEFAVDETAWLTTFFEHYYLASELSRLGASWFSFAPRYVDGFEK
A0A2A3YL22_9MICO      YRHVTDNAQ---HEVEIEFAVDETKWLTTFFEHFYLASELKRLGASWFSFAPRYVDGFEK
A0A4V1FKD3_9MICO      YRHLREGAARAGYEVEAEIAVDETAWQTSFFEHYFLAAELRRLGAEWFSFAPRYVDGFEK
UXAE_THEMA            YQILKDET----PDFDFEVSVDETETPTSPLFHIFVVEELRRRGVEFTNLALRFIGEWEK
A8F5F7_PSELT          YEAIKNTK----KNFDFEVSIDETSIPTSPLAHIFIVHELRRRGVDFQTLALRFVGQWQK
Q8R8Q1_CALS4          YGILKDKV----KNFDLEISIDEGDKDTTVEDHIFVAEYLHEKGIDFWSLAPKFPGEFQK
D9TSK1_THETC          NNILKEKL----SDFDMEISIDEGGKVTTLEDHLYVAEYLHRNGIDFFSIAPKFPGEFEK
B8E1J8_DICTD          YEILKSKL----SEFDIEVSIDEGERDTTPEDHFFVAQFLHDKGIDFKSLAPKFPGEFQK
A0A2H5X238_9BACT      YMMLKEHL----AEFDFEVSIDESARVTTPEDHLYVVEYLRRSGVQLWSLAPRLPGEFQK
A0A212Q100_9CHLR      AEILRDQG----IDADLEVSVDETEEETTPEAHAFIAVYLQRRGVALWSLAPRFPGVFEK
A1HM20_9FIRM          YHTLIVNAG---REVDFEISIDETATPTTPAAHYFVASELGRMGVKFTSLAPRFCGEFQK
F4LWC3_TEPAE          FFDIVKPIG---KTIDFEVSIDETQTPTTPEAHFFVASELEKMKVEVTSIAPRFCGEFQK
F5YF09_TREAZ          YKKFLKK-----GQADFEISIDETSTPTTPLQHYFVARELIDEGVSFATIAPRFCGEFQK
L7VIG5_THES1          YHNIIAKCG---RPIDFEMSIDETLTPTSPASHYFVAQELIDGGVEITSLAPRFCGEFQK
A0A2X4Z8Y1_BACLE      YNEYIITEK---REIDFEISIDETETITSPTAHFFVANELRLKGVEVTSLAPRFCGEFQK
Q8ET95_OCEIH          FNTYIRHLE---RDFDFEISIDETEAITSPEAHFFVANELKKAQVEVTSLAPRFCGEFQK
F0RRZ2_SPHGB          YETYISTSP---KPVDFEISIDETDTPTDPKSHLFIALELKRRHVTIATLAPRFIGEFQK
E4RPZ0_HALHG          YH-LIKKES---KEIDFEISIDETSLPTSAEAHFFVANELKRNGININSLAPRFVGSFEK
M5DZ00_9FIRM          QH-LIKRSA---RDVDLEISIADSLNSTSPEAHFFVANEFKRNNIEVNSLALNFVGEFQK
E1R2I9_SEDSS          DDHLQDRRG---HDYDLEISIDETTTPTLPFHHLFVATCLSALNVRFTSLAPRFIGEFQK
A0A2U1B1T2_9BACT      FQYLKSKRG---SDFDLELSFDETGVETVPAHHLFIARELRKRGVELASLAPCFPGEFQK
C2D2C0_LACBR          YKKFVVP-----YNLDFEISMDETPYQTTNPNHFFFANELHRRGITPTTMAPRFYGEFQK
M5AAI2_LACBR          YHKFIVP-----YNLDFEISMDETIVPTTPANHYFFANELNREGITPETLAPKFYGEFQK
R0EQ81_PEDAC          NEKFVKP-----YALDFEVSVDETPVSTTPAQHYFFANELADAGITPETLAPRFYGEFQK
D2EH76_PEDAC          NEKFVKP-----YALDFEVSVDETPVSTTPAQHYFFANELADAGITPETLAPRFYGEFQK
A0A512K7U7_PEDPE      NEKFVKP-----FALDFEISVDETPVSTTPAQHYFFANELADANVTPETLAPRFYGEFQK
F8EY78_TRECH          YRHIANKKGPE--NFITEVSIDETDQPQGPEDLLFILAMIADEGIPAQTIAPKFTGRFNK
B4CUN3_9BACT          YRYIAERKERN--RFITEVSVDETDRPQTPAELLLILAMIAREGIPVQTIAPKFTGRFNK
E8X1V5_GRATM          YRLLVENKGVG--RFVPEVSMDETDYPQTPVELLIILAMISDEKIPIQTIAPKFTGRFNK
E8V2A9_TERSS          YRSIVDKKGEG--SFVPEISMDETDSPQTPVELLVILAAIADEKIPIQTIAPKFTGRFNK
Q01NV0_SOLUE          YRHIAAERGAR--AFITEVSMDETDSPQTPPELLVILAAIAGEKIPIQTIAPKFTGRFNK
C1F2M1_ACIC5          YRKIAAAKGEG--QFIPEISMDETDRAQSPVELLIILVAIADEGIPIQTIAPKFSGRFNK
Q7UT39_RHOBA          DRHIASVKGEG--NYIAEVSMDETDEPQTPPELLIILAMLADENIRVQTIAPKFTGRFNK
D5EN49_CORAD          FEKISASKDAD--SFAVEVSMDETDNPQGPKELLGILCMLSVEGVPAQTIAPKFTGRFNK
F0SA09_PSESL          YRHIEQAKGVG--NFVPEVSMDEVNDPQSPVELFFILSAIAQEKIPVQTIAPKFTGRFNK
A0A1T5G6S5_9BACT      YKKIVAAKGEG--NFITEVSMDEVPNPQTPVELFFILAMLAHYNVPAQTIAPKFTGRFNK
A0A371QLW9_9BACT      YQYIKNNKTNG--EAVFEISMDEVETPQTPVELFFILKALADHDVQLHTIAPKFTGDFYK
G0GEJ7_SPITZ          HQRIEKGTSR---PFVVEVSMDETADPQRPPELLLILAMIRKAGIPARTIAPKFSGSFYK
S3XC99_9ACTN          YEHV-KASGAV--LGHVEVAMDESPETQGPDDLFIVLAEIKHLGIPADTVAVKFRGRFNK
A0A2R3ZAY0_9FLAO      YSIIKSAKKE---QFHTEVSIDEVEDPQSPVELFFILSALAYYQVPVNTIAPKFTGEFNK
A0A1I1JC37_9FLAO      YFYIKSKKEE---RFFTEVSIDEVENPQTPTELFFVLAALTFYKVPVNTIAPKFTGNFYK
                                       * .. :            .             .*    .    

I7A2X4_MELRP          GIDYKGDLNVFKTEYEKHLDITKYFGS-------YKISLHSGSDKFSAYRVIGSLKGAY-
A0A2E9F380_9BACT      AIDYKGDLGLFESTXXQHVAIARWCGP-------YKISVHSGSDKFSIYPIIGRVCGNL-
D7CTE2_TRURR          GVDYRGDLGELKADLAGHAALARSLGP-------YKLSLHSGSDKFSVYPLIAEATGGM-
A0A4Q2EDJ3_9ACTN      GVEYIGDREALAKNFSDHAEIARVLGP-------YKLSLHSGSDKFSIYPSFVEATRGV-
I0I6W2_CALAS          GVDYMGNLAEFEAELIRHVAVMRHFHC-------YKLSVHTGSDKFSIYPILARCAGEN-
F0STN2_RUBBR          GVDYKGDVSALEASLNDHAAIAELLGP-------YKLSLHSGSDKLSMYAALARATKGR-
L0DE41_SINAD          GVDYKGDVAALEHSLHDHAAIATLLGP-------YKLSLHSGSDKLSMYAALARATRGR-
D5SVB9_PLAL2          GVDFKGDISTFERSLADHAAIAKVVGP-------YKLSLHSGSDKLTVYRQLAAYTGGM-
D2R2D8_PIRSD          AIDYQGSLEEWTEALRLHRAVAVALGP-------YKLSLHNGSDKFSLYKILANETQGQ-
C7M9N2_BRAFD          GLDFLGDAEELRRNLEAHHAISQQFGG-------YKISLHSGSDKFSIYPLCVEATQGL-
A0A2A3YL22_9MICO      GLDFLGDTEELRLNLEAHHAISEQFGG-------YKISLHSGSDKFSIYPLCVEATQGL-
A0A4V1FKD3_9MICO      GLEFLGDHEELRSNLAAHHAIGELFGG-------YKISLHSGSDKYSIYPLAVEATEGL-
UXAE_THEMA            GIDYKGDLAQFEREIKMHAEIARMFEG-------YKISLHSGSDKFSVYPAFASATGGL-
A8F5F7_PSELT          AIDYIGDLSVLESELSMHCEIVKSLSG-------YRLSLHSGSDKFSVYRIFTHYCDGK-
Q8R8Q1_CALS4          AIDYIGDVDKFAVELKKHQFLSREFGG-------YKLSLHSGSDKFSIYKVFSEITEGE-
D9TSK1_THETC          AVDYIGDLDEFLLELKKHYQLSRMIGG-------YKISLHSGSDKFSIYRIFSDITEKN-
B8E1J8_DICTD          GIDYIGDIKEFERALKKHYALTKALEG-------YRLSLHSGSDKFSIYKIFYKITEGN-
A0A2H5X238_9BACT      GVDYAGDTAELERAFRLHVALCRELQG-------YRLSLHSGSDKFSIYRIFREATGGN-
A0A212Q100_9CHLR      AVDYEGEVERFAQAAALHTAVARTFGG-------HRLSLHSGSEKFRILPVFREATGGR-
A1HM20_9FIRM          GIDYIGDLYQFEDEFKRHAAIADHFG--------YRLSIHSGSDKFSVFPIIGQYTRGR-
F4LWC3_TEPAE          GIDYIGDLDQFEKEFKVHAKIAEHFD--------YKLSIHSGSDKFKVFPIIGYYTKGR-
F5YF09_TREAZ          GIDYIGDLTQFNKEIKAHAIIARHFK--------YKLSIHSGSDKFSVFPGIGKETRRI-
L7VIG5_THES1          GIDYIGDLKQFTDEFAVHAAIADHFG--------YKISVHSGSDKFKVFPVVGEKTNGR-
A0A2X4Z8Y1_BACLE      GIDYIGDIEQFEYELSEHALIAEHFG--------YKLSIHSGSDKFKVFPIIAKYTKGI-
Q8ET95_OCEIH          GIDYIGDIGQFEKELSEHVDIAKHFG--------YKISIHSGSDKFSVFPIISKHTERI-
F0RRZ2_SPHGB          GIDYIGDLSLFSENLEQHAVIARHFG--------YRLSIHSGSDKFSIFPILAKTIKGS-
E4RPZ0_HALHG          GIDYIGSLDKFEKHFKIHAEIADRFG--------HKLSIHSGSDKFSLYPIIGHHTKGR-
M5DZ00_9FIRM          GIDYIGDLEKFEKDFEIHADIADRFG--------YKLSIHSGSDKFSIFPIIGRQTEGR-
E1R2I9_SEDSS          GIDYLGNINEFRKQFVQHVAIADYFGF-------YKISVHSGSDKYSVFRIIGDVTRMK-
A0A2U1B1T2_9BACT      GVDYRGNLAEFERQLRLHVRIAHAYGD-------YKLSIHSGSDKFSVFPIIGRETGGR-
C2D2C0_LACBR          AIDYIGDTKRFEREYVIHEAIAEHFG--------YKLSIHSGSDKLSVYEIIGRVSKQHG
M5AAI2_LACBR          AIDYIGDVKRFEDEYVVHEAIAEHFG--------YKLSIHSGSDKLSVYEIIGRLSKKHG
R0EQ81_PEDAC          AIDYIGDLDRFEKDFGEHEAIAEKFG--------YKLSVHSGSDKLSAYPVIARLANQHG
D2EH76_PEDAC          AIDYIGDLDRFEKDFGEHEAIAEKFG--------YKLSVHSGSDKLSAYPVIARLANQHG
A0A512K7U7_PEDPE      GIDYIGDLARFEKEFAEHEAIAEKFG--------YKLSVHSGSDKLSAYPIIARLANGYG
F8EY78_TRECH          GVDYVGNLTQFEREFNQDILVIAYASKEFGLPKNLKLSVHSGSDKFSIYPIIKKAIYTH-
B4CUN3_9BACT          GVDYVGDLAQFEKEFDEDLYVVAFAIREFGLPETLKLSVHSGSDKFSLYPIIRRLIRQH-
E8X1V5_GRATM          GVDYVGDVAQFTKEFNEDLAAIAYAVHTYGLPDNLKLSVHSGSDKFSIYKPMYEAVKAT-
E8V2A9_TERSS          GVDYVGDVEQFTKEFRDDLATIAFAVERYGLPKNLKLSVHSGSDKYSIYKAIRESIKDF-
Q01NV0_SOLUE          GVDYVGDVVQFEKEFSEDLAVIAFAIKQYGLPANLKLSVHSGSDKFSIYGPIRRSLKKF-
C1F2M1_ACIC5          GVDYVGDVAQFEREMQLDVAAIAYAVKHYGLPANLKLSVHSGSDKFSIYPAIHRTMKKF-
Q7UT39_RHOBA          GVDYVGDLAQFEREFNDDVAVLAHAVKAYGLPEVLKLSVHSGSDKFSLYPIIRDCLKRT-
D5EN49_CORAD          GVDYVGDLAQFRVEFEADLIVLKYAVEQLGLPETLKLSVHSGSDKFSLYPIIHELVVKH-
F0SA09_PSESL          GVDYVGDTKQFAKEFEEDLLVIDYAVKEFGLPENLKLSIHSGSDKFTIYPIMGDLIKKH-
A0A1T5G6S5_9BACT      GVDYVGDTKAFAEEFEANLMVIDFAIAKFGLPAELKLSVHSGSDKFSIYDPIRDLTQKH-
A0A371QLW9_9BACT      GVDYVGDIDQFVKEFDEDLWVIDYAIKEFNLPDNLKLSVHSGSDKFSLYPKMRELITDH-
G0GEJ7_SPITZ          GVDYVGDPEVFAREFEDDLCVVRYAREAFRLPEGLKLSVHSGSDKFSLYPLIKDILSRHP
S3XC99_9ACTN          GVDYVGDVDAFLEEFRTDVAVIGHAITEFGLHENLKISVHTGSDKFSLYPGMGRIVREL-
A0A2R3ZAY0_9FLAO      GVDYQGDLQQFEKEFEEDLLVLKFTIKELGFPENLKLSVHSGSDKFSIYPVMKKLIKKH-
A0A1I1JC37_9FLAO      GIDYEGDLDQFSKEFEDDLCVLKFVKSEFDMPKELKLSVHSGSDKFSIYPIINKLIKKH-
                      .::: *.          .                 ::*:*.**:*               

I7A2X4_MELRP          ---THVKTAGTSYLEALRVVAAKEPA----LFRDILDFCRDLYETEKRSYHVSADINKVK
A0A2E9F380_9BACT      ---LHVKTAGTSYLEALRVVARRNPX----AFLEIIKFSLEXFDTDRATYHISADPXRVD
D7CTE2_TRURR          ---VHLKTAGTSYLEALRVAAQVAPG----LFREILTLGRERFAVDKQSYHISAALARVS
A0A4Q2EDJ3_9ACTN      ---AHLKTAGTSWIEALRIVAAHDPQ----LLRDILKLSLESFEENRHSYHLSCDTTRIP
I0I6W2_CALAS          ---VHIKTAGTSYLEALRVAALRAPD----LFRQMLETGRTCYEKDKKTYFLDCRPERVP
F0STN2_RUBBR          ---FHVKTAGTSYLEALRVVARHDEP----LFRRLVQFGRERYDVDKATYHVSAT-NAAV
L0DE41_SINAD          ---FHVKTAGTSYLEALRVVARHDVP----LFRRLVEFARGRYETDRATYHVSATLRSAP
D5SVB9_PLAL2          ---FHVKTAGTSYLEALRVVATVAPG----EFRGMIDFARERYLTDKATYHVSATLEAVP
D2R2D8_PIRSD          ---FHVKTAGTSYLEALRVAARRERR----LFRRIVDFARGRFEADRATYLVSSRLSQAP
C7M9N2_BRAFD          ---VHLKTSGTSYLCGVEIVAEQDPE----LFAAIWDISRASYVKARASYQVSAHEDRTP
A0A2A3YL22_9MICO      ---VHLKTSGTSYLCGVEVVAAHDPE----LFSAIWDISRASYVKARASYQVSAHEDRTP
A0A4V1FKD3_9MICO      ---VHLKTSGTSYLCALEVVARRDPE----LFAEIWRISRAAYARAAASYQVSAQVENTP
UXAE_THEMA            ---FHVKTAGTSYLEAVKVISMVNPE----LFREIYRCTLDHFEEDRKSYHISADLSKVP
A8F5F7_PSELT          ---LHVKTAGTSYLEAIRTVAEASPS----LYRNIHKYALTCFEKDNTSYHVTADINKIP
Q8R8Q1_CALS4          ---FHIKTSGTSWLQAVNLIFEKDKE----LFKELYQIALYNLEESKKAYKVLIDKKDFP
D9TSK1_THETC          ---FHIKTSGTSWLQAVNLIYKFDKE----FYRKLYKIALSNLEESKKSYKVLIKKDDFK
B8E1J8_DICTD          ---FHIKTSGTSWLEAVKVIAKFFPD----LFVELYQIALENLEESKKAYKVNITKEEFP
A0A2H5X238_9BACT      ---FHVKTSGTSWLQAVRLIAQTDAR----LFTELYRLCLLHMEESRQAYHVSISARQLP
A0A212Q100_9CHLR      ---FHVKTSGTTWLQAVRVVARAVPA----LFAELYAIARAHLEESRRDYPIALQPEALP
A1HM20_9FIRM          ---VHIKTAGTNWLEALRVVARINPA----LFREIYAFAGEVFGEAKKYYHVTTDLTRLP
F4LWC3_TEPAE          ---VHVKTAGTNWLEALKVIAVNSPS----LFRRIYAFALEHFKEATKYYHVTTDLSKVP
F5YF09_TREAZ          ---FHVKTAGTNWLEAVRVIAAADPT----LYREIHKYALSAFDEAKKYYHVTTDLKKIP
L7VIG5_THES1          ---YHLKTAGTNWLEAVRVIARHKPD----LYRRMHAFALEHLEDAKKYYHIGAKVENIP
A0A2X4Z8Y1_BACLE      ---LHVKTAGTNWLEAIRVIAQMNPN----LYRRMHVFALEHFEEALAYYHVTPDLAGIA
Q8ET95_OCEIH          ---LHVKTAGTSWLEALRVIANKNPS----LYRKIHAYAEQNVEEALQYYHITPDFGAIT
F0RRZ2_SPHGB          ---FHVKTAGTNWLEAVRLVSQKDPS----LYRRMHNHALKRFADAKKFYHVSTKLDAIR
E4RPZ0_HALHG          ---VHVKTAGTNWLEALRVLAENDPA----LFRDIYYYAQKKYKDAKEYYHVSTELVDIP
M5DZ00_9FIRM          ---AHIKTAGTNWLEAIRVVAENDPS----LYREIHSYALKKFEEAKEFYQVNTDLSKVP
E1R2I9_SEDSS          ---LHVKTSGTSWLEALRVVATTDPA----LYRKIHKKALCFFDTASGYYHVTCQLEKIP
A0A2U1B1T2_9BACT      ---FHLKTAGTSWLVAAGVIAAHEPA----LYREMHRCALENFGRMKQFYHITADPARIP
C2D2C0_LACBR          ---WHVKTAGTNWLEALRVIAHKDPK----FMLELYKFSYENLDDVKAFYVFNAQTDGTA
M5AAI2_LACBR          ---WHVKTAGTNWLEALRVIAHVDPK----FMVEMYKFAYENLDDVASFYVFNAQTDGKA
R0EQ81_PEDAC          ---WHVKTAGTNWLEALRVVAHEDPQ----FMLELYKFSYDNLDDVKDFYVFNAQTDGKA
D2EH76_PEDAC          ---WHVKTAGTNWLEALRVVAHEDPQ----FMLELYKFSYDNLDDVKDFYVFNAQTDGKA
A0A512K7U7_PEDPE      ---WHVKTAGTNWLEALRVVAHEDPK----FMLELYKFSYDNLDDVKAFYVFNAQTDGKA
F8EY78_TRECH          HAGLHLKTAGTTWLEELIGLASAGDE-GLRIVQQIYRETYYRFDELCAPYATVIDIHKDK
B4CUN3_9BACT          DAGLHVKTAGTTWLEELIGLAESGGE-GLTLAAEIYARAMTRFEELVKPYAPVVDIDPAR
E8X1V5_GRATM          GAGLHLKTAGTTWLEEIIGLAEAGGT-GLEIAKEVYSEAYAHQAELCGPYATVINIDHAA
E8V2A9_TERSS          DAGVHVKTAGTSWLEEVIGLAESGGD-GLALAKEVYAEAFGHAAELCAPYATVIDIKTER
Q01NV0_SOLUE          GAGVHVKTAGTTWLEELIGLAEAGGE-GLEMAKYIYGKAFADRDALCQPYATVIDIDYAK
C1F2M1_ACIC5          DCGVHLKTAGTTWLEEIIGLAEAGGK-ALALAKDVYADAFAHREELCGPYATVIDIDPAK
Q7UT39_RHOBA          GAGVHLKTAGTTWLEEIIGLAEAGGD-GLALAKEIYVYALEHVDELCAPYASVIDIDRSQ
D5EN49_CORAD          AAGLHMKTAGTTWLEEVIGLAEAGGD-ALEFVKRLYIEALDHVDALTAPYATVLDITPSE
F0SA09_PSESL          DKGIHIKTAGTTWLEEVIGLAMAEDEVAINIAKGVYAGALGRFDELCGPYATVIDIDKSQ
A0A1T5G6S5_9BACT      NKGFHLKTAGTTWLEEVIGLALAGGE-ALDFVKKLYAKALDNVEKLCAPYADVIDIDKNQ
A0A371QLW9_9BACT      DTGLHLKTSGTTWLEELIGLAESGEE-GLNMVYKIYSEAYNRYDELTGPYLPVIDINKSE
G0GEJ7_SPITZ          QEGVHLKTAGTTWLEEVTGLAESGGE-ALALAKEIALTCYSMIEELCAPYAAVIDINPDR
S3XC99_9ACTN          GAGLHLKTAGTSWLEELIGLAEADGE-GLAIAKDIYRMAHEHREELVAPYADVIDINFAA
A0A2R3ZAY0_9FLAO      NFGLHLKTAGTTWLEELIGLAESDGK-AFEFAKEVYKEALQRYDELTKDYFSVLSIDKVK
A0A1I1JC37_9FLAO      DSGLHVKTAGTTWLEEAIGLAESGEE-AFKFIQNLYNEALDRYEELTENYTEVLNIKKEK
                          *:**:**.::                    :              *          

I7A2X4_MELRP          PANQYSDTEL-IELFNQN-------------DTRQVLHVTFGKVLTEKDSSGHFLFKDKI
A0A2E9F380_9BACT      NPXNLNHKEREAEFLDLD-------------DGRQIMHVTFGSVLAIGKMPDSQPFKEII
D7CTE2_TRURR          EADTLTDD-ELPRLLDDD-------------DARQVLHVTFGSALDR--------YRAPL
A0A4Q2EDJ3_9ACTN      --TDVPDD-KVGELVTAL-------------ESRQVMHVGYGAVLDE--------YGVQI
I0I6W2_CALAS          PAATLDDA-DLPNLLDQF-------------DARQLLHVTFGSILTT--------HGAAL
F0STN2_RUBBR          PFDDSMSAEKLEKLYLECWADV-PQGVGFTEPGRQILHCTFGSTLTHP------EFGPAV
L0DE41_SINAD          PAAEVTEPADLERLYLESWADV-PAGAGFTHPGRQILHCTFGSTLTDP------VLGQAV
D5SVB9_PLAL2          PPHEVSSDDQLRQLYLQDWSSV-LPGQGFTAPGRQILHCTFGSTLQHP------HWGAVL
D2R2D8_PIRSD          TAAAISDDARLEQLYLDE------------PAGRQILHVTFGSVLTDS------ALGPML
C7M9N2_BRAFD          TSLAGVDLVDLIRS----------------SDARQILHVGYGDSLNGTDAAGA-SIHDRF
A0A2A3YL22_9MICO      TSLAGVDLQELIRS----------------SDARQILHVGYGDSLNGTDAAGA-SIHDRF
A0A4V1FKD3_9MICO      ESLEGVDLLALLEG----------------ADGRQILHVGYGDSLTTELVDGT-PLVERL
UXAE_THEMA            EVEKVKDEDLPGLFEDIN--------------VRQLIHVTYGSVLKDAS------LKERL
A8F5F7_PSELT          DVDNVEDSKVVNLLDIPE--------------VRQLIHITYGSVLTEKINGKY-LFRDEI
Q8R8Q1_CALS4          ENINLEDS---QIVSKPE--------------IKQLFHISYGVLLEERK--------KQI
D9TSK1_THETC          DEPELDNP---EFTLRPE--------------IKQLFHISFGVLLDLKG--------KEI
B8E1J8_DICTD          KEIKEDYM---EFLHKDN--------------VRQLFHISYGVLLDEKR--------KEI
A0A2H5X238_9BACT      PMPPADLN---AFLAQPS--------------VRQLFHISYSVLLEEAG--------SAI
A0A212Q100_9CHLR      PALPDDPE---AALADRA--------------VRQLFHISYGVLLRERG--------PAI
A1HM20_9FIRM          DVAAMA-DDGLPTVLDHN-------------DARQMLHITYGLVLTAANADGSYRFKDAL
F4LWC3_TEPAE          DITKLC-DEELDKVLNQN-------------DARQMLHITYGLILTARDANGKFLFRDEL
F5YF09_TREAZ          DVDKVS-DADLPKLFDANPDRS-ND------NVRQLIHITYGLILSKKNEDGSFTYRDKL
L7VIG5_THES1          ALETLA-DSELPELMNRD-------------DSRQVMHITYGHILQAKDENGNPLFKDEL
A0A2X4Z8Y1_BACLE      PLENVP-DSELESYMDDD-------------AARQLFHVTYGLLLTAKDESDKNIFKEEF
Q8ET95_OCEIH          PLEDTK-DSMLSEYLNDD-------------NARQLLHITYGLVLTAS-KNGSSLFKDHI
F0RRZ2_SPHGB          DLDEVQ-DNELWHYLEDD-------------NARQLLHITYGYLLLDENELGGKLIGDEL
E4RPZ0_HALHG          DLARLS-DKELSELLEID-------------EARQLLHITYGFILEAK-KDGDYLFRDKL
M5DZ00_9FIRM          ELAVMS-DQELGELLEID-------------AVRQLLHITYGFILQDK-KDGRYIFRDRL
E1R2I9_SEDSS          PLSEIT-DGQLVAYLDHD-------------DSRQLLHISYGGILNDL------QLRFDF
A0A2U1B1T2_9BACT      ALEAVA-DTALPELLELP-------------EERQLMHISYGPILQG-------ELGGRF
C2D2C0_LACBR          PKPESITTENVMDLLDND-------------DARQVLHTMYGSIMNLK-HNYHYVYRDKL
M5AAI2_LACBR          PKPETINEGNVMTLLEGD-------------DSRQVLHTMYGSLLNAQ-KSYEYVYRDKF
R0EQ81_PEDAC          PKPEDLTEKDVNMLLVDD-------------DARQVLHTMYGSILGYT-ENYQYVYRDRL
D2EH76_PEDAC          PKPEDLTEKDVNMLLVDD-------------DARQVLHTMYGSTLGYT-ENYQYVYRDRL
A0A512K7U7_PEDPE      PKPETLTEDDVKMLLVDD-------------DARQVLHTMYGSILGYT-VNYKNVYRDRL
F8EY78_TRECH          LPEPNSVQAWNGETYAAALRHI-ENHPQYNPHFRQLLHVGYKVAAELG---------ETY
B4CUN3_9BACT          LPIPGEVARWSSAQFVGALRHV-PSCPEYNPHFRQFLHVSFKIAAEFG---------EAY
E8X1V5_GRATM          LPSPETVNGWTSDQFTGALRHD-QSNPAYNQSLRQLLHVGFKVAAKMG---------DRY
E8V2A9_TERSS          LPDPSVVNGWTSDEFVRALRHDGKHDAAFNPDLRQLLHVGFKVAAKMG---------DRY
Q01NV0_SOLUE          LPDPAVVNGWTSEQYTSALRHD-QKNPGFNQDLRQLLHVGFKVAAKMG---------DKY
C1F2M1_ACIC5          LPSPEAVQGWTSEQYTSALRHV-QSNPAYNASFRQLLHVGFKIAAKKG---------RHY
Q7UT39_RHOBA          LPDSAAVEKLDGPAFAELIRHI-PSNPNFNANVRQLLHVSFKVAAKAG---------ARY
D5EN49_CORAD          LPTAEQASEWTSEQVIGMVAHE-QDHPLFNSSLRQFLHVAFKLAAKTG---------DEY
F0SA09_PSESL          LPTVEEVNGWTGEKLANTLRHI-PGHPDYNPNFRQLIHVGYKIAVEYG---------DQY
A0A1T5G6S5_9BACT      LPSADTVNKWSNEDFANALRHI-PDHPLYNANMRQLVHVGYKLAADEI---------DKY
A0A371QLW9_9BACT      LPTPSEFSKWTGQQIVDAVEHN-PDHPKFHSGLRQFFHCSYKIAAEQG---------ESF
G0GEJ7_SPITZ          LPSPGEIEDWSSGRFVEALEHD-PSNPSYNRDFRQLIHVGYKVAAQMG---------ERF
S3XC99_9ACTN          LPSPDEVDGWDSKKYVDTLRHD-QSNPSYDPNVRQLLHVGYKMAARMG---------ERF
A0A2R3ZAY0_9FLAO      LPEVDSFHS--GKEYADALRHD-ENSKAYNPHFRQLLHCAYKIAAEK----------EDF
A0A1I1JC37_9FLAO      LPQKSAFEN--GAAFASALRHD-QKNENYNPHFRQLMHCAYKIAGEK----------DEF
                                                       :*..*  :                   

I7A2X4_MELRP          MKCLVENEE-SHYEFLEKHFLKHLECFK--------------------------------
A0A2E9F380_9BACT      LETLSTNSD-LHNQLLNEHLGHHIRLLSYG------------------------------
D7CTE2_TRURR          LRVLEAHDE-AYQAGLAAHFAKHLTPFAEVAP----------------------------
A0A4Q2EDJ3_9ACTN      KDLLNTHED-EYAALMKEHFIAHIAPFGKR------------------------------
I0I6W2_CALAS          RNLLATYPN-DYRSALRDHFARHIQPFVQA------------------------------
F0STN2_RUBBR          RETLVAHPD-TYAEVLSDHFSRHLEALAAGM-----------------------------
L0DE41_SINAD          RATLERHPD-TYTEVLADHFSRHLDALRLGM-----------------------------
D5SVB9_PLAL2          MQILREHPA-VYADILKTHFMMHLAALKAGL-----------------------------
D2R2D8_PIRSD          RDVLVEHPD-IHREVLAAHLKKHLVSLESGLP----------------------------
C7M9N2_BRAFD          LAVVAANQA-AHTDVVAAHIGKHLAPFAAAPARR--------------------------
A0A2A3YL22_9MICO      LAVVTENQA-QHSDVLAAHIGQHLAPFAAAPTGR--------------------------
A0A4V1FKD3_9MICO      RAVLRERHE-DYAAVLVPHLSRHLEAFGTVAAR---------------------------
UXAE_THEMA            FKTLEQNEE-LFYETVAKHIKRHVDLLEG-------------------------------
A8F5F7_PSELT          YRILHENEF-LHYKRIRDHLGKHLELLKN-------------------------------
Q8R8Q1_CALS4          FEVLNKYEE-EHYEFVRKNIENHFKEIFSK------------------------------
D9TSK1_THETC          KDMLNDYEE-EHYKMVSDNIENHLKEIYYEK-----------------------------
B8E1J8_DICTD          YDLLNQKEK-EHYQYVSENIKKHLKNLFEEE-----------------------------
A0A2H5X238_9BACT      RDLLTAHEQ-EHYRLVTEHIERHLQALL--------------------------------
A0A212Q100_9CHLR      RALLEAHEA-EHFTAVRENLERHLEALLK-------------------------------
A1HM20_9FIRM          YELLFDHED-EYYAALERHIGRHLEKLTENLKG---------------------------
F4LWC3_TEPAE          YETLNLHED-DYYKALEKHIGKHIELLNSNR-----------------------------
F5YF09_TREAZ          YKLWRDREN-DYTAALVKHIGKHMELLGVKKA----------------------------
L7VIG5_THES1          YKVLYEYEE-EYANALKKHIGRHLEGLGLL------------------------------
A0A2X4Z8Y1_BACLE      FYTLDKQEE-EYRAALVKHIGKHVELLEL-------------------------------
Q8ET95_OCEIH          YSTLSEYED-VYRDYLIKHIGRHVDTLDL-------------------------------
F0RRZ2_SPHGB          FDLLVREEE-GYRALLAKHIAKHLALLGFSR-----------------------------
E4RPZ0_HALHG          YKFWEKHDK-EYRKALEFHIIKHLKKLGFYN-----------------------------
M5DZ00_9FIRM          YKLLDEYDK-DYRSGLERHIGRHLNKLGFYKN----------------------------
E1R2I9_SEDSS          FTTIFENLD-MLDRYERENMERHLKKLNGG------------------------------
A0A2U1B1T2_9BACT      FAAMHRFSK-EYDAALERWFDRHLSLLGVGKRQCK-------------------------
C2D2C0_LACBR          WNILLKNQA-LYDKYLNIHIAEHLDLLQGIVKTKQEAQEKNEPKTDISKETIQELQETAK
M5AAI2_LACBR          FKILKENQD-LYDKYLNIHIAEHLDLLQGLAKTKEEVQAKYEPKINE-------------
R0EQ81_PEDAC          FDILLHHAD-EYDKYLSLHMAEHVDLLQGIETTKQAVLDKYEPQD---------------
D2EH76_PEDAC          FDILLHHAD-EYDKYLSLHMAEHVDLLQGIETTKQAVLDKYEPQD---------------
A0A512K7U7_PEDPE      FDILETHTD-EYDRFLNIHMAEHVDLLQGVETTKEAVLAKYEPKN---------------
F8EY78_TRECH          LKALEAHEHHIALQVKENLLDRHIRPIFIQ------------------------------
B4CUN3_9BACT          TAALATNEAIIARNVTGNLFSRHILPLFS-------------------------------
E8X1V5_GRATM          LKALEANEAIVAKNVTTNLFDRHIKPVFLGL-----------------------------
E8V2A9_TERSS          LKALEANEEVVARNVTTNLYERHIKPIFVG------------------------------
Q01NV0_SOLUE          LKMLEACEANVSRNVTENLFERHIRPLFLTE-----------------------------
C1F2M1_ACIC5          LDLLEANEPVVAKNVTENLYDRHIVPVFLGLATAR-------------------------
Q7UT39_RHOBA          TDLLESNEEIVGQQVTQNIYDRHLLALFIDEDGKAIGTGA--------------------
D5EN49_CORAD          LGLLKQHAEIVNRRVYENLHHKHIIKAFPKG-----------------------------
F0SA09_PSESL          TDALKKNKEIVGEQVTKNIYERHIKRLFRMD-----------------------------
A0A1T5G6S5_9BACT      NELLKQNAEIVGKCVYENIYERHLKRLLNL------------------------------
A0A371QLW9_9BACT      INLLVENQSRISARVTDNLYQRHIKPLFVG------------------------------
G0GEJ7_SPITZ          HEALEAHREVIAARVTRNLLERHIIPLFPGGAA---------------------------
S3XC99_9ACTN          TDALEIYRADIERNVTENLYERHLKPLFRAD-----------------------------
A0A2R3ZAY0_9FLAO      EALLLEHRARIEENVTYNLYERHLKQIFPT------------------------------
A0A1I1JC37_9FLAO      YSLLDSCRDKIEENVTLNLYERHLKVLYSS------------------------------
                                            *.                                    

I7A2X4_MELRP          -
A0A2E9F380_9BACT      -
D7CTE2_TRURR          -
A0A4Q2EDJ3_9ACTN      -
I0I6W2_CALAS          -
F0STN2_RUBBR          -
L0DE41_SINAD          -
D5SVB9_PLAL2          -
D2R2D8_PIRSD          -
C7M9N2_BRAFD          -
A0A2A3YL22_9MICO      -
A0A4V1FKD3_9MICO      -
UXAE_THEMA            -
A8F5F7_PSELT          -
Q8R8Q1_CALS4          -
D9TSK1_THETC          -
B8E1J8_DICTD          -
A0A2H5X238_9BACT      -
A0A212Q100_9CHLR      -
A1HM20_9FIRM          -
F4LWC3_TEPAE          -
F5YF09_TREAZ          -
L7VIG5_THES1          -
A0A2X4Z8Y1_BACLE      -
Q8ET95_OCEIH          -
F0RRZ2_SPHGB          -
E4RPZ0_HALHG          -
M5DZ00_9FIRM          -
E1R2I9_SEDSS          -
A0A2U1B1T2_9BACT      -
C2D2C0_LACBR          N
M5AAI2_LACBR          -
R0EQ81_PEDAC          -
D2EH76_PEDAC          -
A0A512K7U7_PEDPE      -
F8EY78_TRECH          -
B4CUN3_9BACT          -
E8X1V5_GRATM          -
E8V2A9_TERSS          -
Q01NV0_SOLUE          -
C1F2M1_ACIC5          -
Q7UT39_RHOBA          -
D5EN49_CORAD          -
F0SA09_PSESL          -
A0A1T5G6S5_9BACT      -
A0A371QLW9_9BACT      -
G0GEJ7_SPITZ          -
S3XC99_9ACTN          -
A0A2R3ZAY0_9FLAO      -
A0A1I1JC37_9FLAO      -