CLUSTAL format seed alignment for MF_02244

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F8A0U6_CELGA          -------------------------MSHAPTD--------------------VEALNSTV
A6W8D4_KINRD          -------------------------MTEQHTEPSPEQQ---------PPAPSVDEINSTI
D7GH54_PROFC          ---------------------------MAHTA---------------------DEINHMQ
X8F7J4_MYCUL          -----------------------------------------------MARLDYDVLNATI
B2HM25_MYCMM          -----------------------------------------------MARLDYDVLNATI
CHDC_MYCTU            -----------------------------------------------MARLDYDALNATL
I0S1B4_MYCXE          -----------------------------------------------MPRLDYDALNATI
CHDC_MYCS2            -----------------------------------------------MAKLDFDALNSTI
A1UF50_MYCSK          -----------------------------------------------MAKLDFDALNSTI
I4BI58_MYCCN          -----------------------------------------------MAKLDYDALNSAV
F5YVK1_MYCSD          -----------------------------------------------MAHLDYDKLNSTI
U5E4U5_NOCAS          -----------------------------------------------MARLDYQALNSTI
K0F286_9NOCA          -----------------------------------------------MARLDYQALNSTI
F6ELI1_HOYSD          -----------------------------------------------MARLDYKALNDTI
E9SV53_RHOHA          -----------------------------------------------MARLDFDKLNSTL
G7H5I6_9ACTN          -----------------------------------------------MARLNYEELNATV
D0LCJ2_GORB4          --------------------------------------------MTVMSRLDYAELNSTI
A4FAS5_SACEN          -----------------------------------------------MARLNYSELNDTI
K0JWM2_SACES          -----------------------------------------------MARLNYNELNDSI
B1VE13_CORU7          ------------------------------MSK----------------KIDFEKLNNTI
Q4JVC0_CORJK          ----------------------------MTELN----------------AQEIKRLNAVV
Q6NGV6_CORDI          ------------------------------MAE----------------KLNFEELNSMQ
L1MGC4_9CORY          ---------------------MCIIERMSRMTES--------------RRLDYAALNSVQ
Q8FPI6_COREF          ---------------------MAVSTTIHPLSDRGCPQPRSMKGRQPVSELDYDKLNDVQ
S5T2Z6_9CORY          -----------------------MADNTEKTAD----------------ELDYVALNRVQ
Q0SJX2_RHOJR          -----------------------------------------------MTRSRFTELNQRV
H2K5X7_STRHJ          -----------------------MSDDAPTTESGRIP----------NKGKLAKDLNEVI
Q82KZ1_STRAW          -----------------------MSDDAPTTESGRIP----------NKGKLAKDLNEVI
K4R0B0_STRDJ          -----------------------MSDDAPTTESGRIP----------NKGKLAKDLNEVI
S5VBD3_STRC3          -----------------------MSDDAPTTEPGRIP----------NKGKLAKDLNEVI
C9YVV6_STRSW          -----------------------MSDVAPTPETGRIP----------NKGKLAKDLNEVI
G2GPA7_9ACTN          -----------------------MSDDASTTESGRIP----------NKGKLAKDLNEVI
CHDC_STRCO            -----------------------MSDDASTPAAERIP----------NKGKLAKDLNEVI
F2RAQ0_STRVP          ----------------------MTGENRRMSAPEKIP----------NAGKKAKDLNEVI
E8VZY5_STRFA          -----------------------------MSAPEKLP----------NAGKKAKDLNEVI
D6X9U8_STRE2          ----------------------MRRDNSRMSAPEKLP----------NAGKKAKDLNEVI
M2ZZB7_STRMB          ----------------------------MTTDAQKIP----------NAGKKAKDLNEVI
D9W893_9ACTN          -----------------MTAAPETPDTPDTVTSSKAP----------NAGKKAKDLNEVI
E4NIF9_KITSK          -----------------------------MTESTEQP----------VK-KKARDLNQVI
G8SFH3_ACTS5          -----------------------------MSEQ--------------TNAARINELNATI
I0HGB1_ACTM4          -----------------------------MSEQ--------------TNAARINELNATI
R4LT68_9ACTN          -----------------------------MSEQQ-------------TNAARINELNATI
F4FDY1_VERMA          -----------------------------MTEQ--------------SNAARLKELNSTI
A1SMY6_NOCSJ          -----------------------MGPMSAKA-------------------KRAREINDSI
C7Q1S6_CATAD          -----------------------MSDSGNETQDERPAGV----VSNVRIGKRAVELNEVT
D6Y396_THEBD          -------------------------MTETQTRPESRP--------------SAEELNKVI
Q47NP0_THEFY          -------------------------MSTETTTPD------------------VEELNKLI
A8L0J8_FRASN          ----------------------MPTSSVPATPPTGVPPTGASGPADGESTKSARELNDEL
F9ECK2_9ACTO          MTSHENTHPAVDSGEGAPHLHRFEEEERRPHHDPRDA-----------ADVDLDAVNDRL
I6WVW6_PSEPQ          -----------------------MSHPHHTHTDPRD------------HLIPAEEVNATP
C5C0U5_BEUC1          ---------------------MSADTGTTGATAPHVD-----------HSAVAERVNDEL
D3F509_CONWI          ------------------------------------------------------MTTDQN
C8XF55_NAKMY          ------------------------MTNEQTAAPAR-------------TRPTARQINEQI
D2NS34_ROTMD          -------------MSHDHAAHGHGGYTHAGHGYGGAPKGYAVQHSAADENRRGREEGETL
B2GL22_KOCRD          ----------------------------------------MSEHENGTAQDAAHEGGDTL
C5CB90_MICLC          ----------------------------------------MTKDSTTTPAEAGKD-----
A0JYM8_ARTS2          --------------------------------------MSHTSAESVSKTENSVAEETEQ
F0M889_PSEPM          --------------------------------------MSHTSAESVTKTE----ESAEQ
A9WPH4_RENSM          -------------------------------MRSRLLAMSDTLAESVSKTVE--IDPSNT
E1VXL5_GLUAR          ------------------------------------MSTAPEHNSPVIRERENAGENPTF
A0A0M2H5P3_9MICO      ----------------------------------------------MSETAAPQSEREPL
A4AF07_9ACTN          ----------------------------------------------MDDMTDGENATEVL
E8NBZ8_MICTS          -----------------------------------------------------MSDDSSS
U2T284_LEIAQ          --------------------------------------MSTPAAVPAESTAPEETSDTPT
Q83FJ1_TROWT          --------------------------------------------------------MLGA
Z9JPP3_9MICO          ----------------------------------MSSSHHPGPTPSDAAERGTGSGGDVT
C7MH02_BRAFD          -----------------------------------MNDATTQPAPSASAAQSPEEIAQTT
S3ZA86_9MICO          ---------------------------------------------------MSEDVTEEI
                                                                                  

F8A0U6_CELGA          RYAMWSVFALEEVLPE--------ADDERAELVADALAAVAEDT---GLVVRGWYDVAGL
A6W8D4_KINRD          AYAMWSVFAVESPLGE--------GERTDLTREVQDLLDELTGR---GLVVRGSYDVAGL
D7GH54_PROFC          RYTMWSVFRSEAAAGP--------GAGE---QALEQLQAVAADT---DLVIRGWYDVAGL
X8F7J4_MYCUL          RYLMFSVFSVRPGELGDH--------REAVIDDAATFFKQQEER---GVVVRGLYDVAGL
B2HM25_MYCMM          RYLMFSVFSVRPGELGDH--------REAVIDDAATFFKQQEER---GVVVRGLYDVAGL
CHDC_MYCTU            RYLMFSVFSVSPGALGDQ--------RDAIIDDASTFFKQQEER---GVVVRGLYDVAGL
I0S1B4_MYCXE          RYLMFSVFAVRPGALGDD--------RERVVDETATFLKQQEER---GVVVRGLYDVAGL
CHDC_MYCS2            RYLMFSVFAVAPGELGED--------RADVIDEAATFLKQQEDK---GVVVRGLYDVAGL
A1UF50_MYCSK          RYLMFSVFSVRPGELGYD----E-QARAAVVDETATFLKQQEER---GVVVRGLYDIAGM
I4BI58_MYCCN          RYLMFSVFAVQPGTLPDD----E-DARAAVIDDATTFFKRQEDN---GVVVRGLYDIAGM
F5YVK1_MYCSD          RYVMFSVFSVRSGALDEG----S-ASRDEVADQAATFLKQQEER---GVVIRGVYDVAGL
U5E4U5_NOCAS          RYLMFSVFQVQPGVLGED--------RAGAIKEARAFFDGLADK---GVVLRGIYDVAGL
K0F286_9NOCA          RYLMFSVFQVQPGVLGED--------RAAAIKEARAFFEGLADR---EVVVRGVYDVAGM
F6ELI1_HOYSD          RYLMFSVFQVEPGILGDE--------RDAAIKEFDAFVASLEER---GIVVRGVYDVSGL
E9SV53_RHOHA          RYAMFSVFQVQPGVLGED--------RAAAVKNAQDFFASYEDT---ETVVRGIYDVAGV
G7H5I6_9ACTN          RYLMFSVFTVRPGELS-D--------RDAAAAEFGAFLDEIQRD---GLVVRGVYDVAGM
D0LCJ2_GORB4          RYLMFSVFAVRPGELPAD--------RDQVKSDAADFFKTLEDS---GVVVRGVYDVSGL
A4FAS5_SACEN          RYTMWSVFRIEQDTLPED--------REKAALATKEYLDSLEES---GVVVRGVYDVSGL
K0JWM2_SACES          RYTMWSVFRVEPGRLPDD--------RGPAAAEAQDYLDGLAAK---GVVVRGVYDLAGL
B1VE13_CORU7          QYAMWSAFEIKAGVLGED--------RAAVAEDFQKFLDSYKDS---SVTVRGVYDLTGM
Q4JVC0_CORJK          RFATYSVFKIEPGVLG-D--------RAEAAADFQAFIDSFEDE---DLVIRGVYDLSAL
Q6NGV6_CORDI          RYSQFAVFRAIPGALGSD--------RAEIVAQAQSFFDGLETAG--KVEVRGIYDLAGC
L1MGC4_9CORY          RYTQWAVFRIIPGGLGVE--------RADIISQTQDFFAQLESAG--TVVVRGIYDISSI
Q8FPI6_COREF          RYTQWAVFRAIPGSLDDD--------RTAVIEQAREFFTNLVNEG--RVVIRGIYNATGL
S5T2Z6_9CORY          RYSQFAVFRAIPGALGSE--------RDALTAEARDFFAALAEEG--KVTVRGLYDVSAI
Q0SJX2_RHOJR          RFMMFTVFQVVPGALPDV--------RDEVVDDAHTYLDRVAES---GVAIRGIYDVAGL
H2K5X7_STRHJ          RYTLWSVFKLKDVLP---------EDRAGYADEVQELFDQLAAK---DVTIRGTYDVSGL
Q82KZ1_STRAW          RYTLWSVFKLKDVLP---------EDRAGYADEVQELFDQLAAK---DVTIRGTYDVSGL
K4R0B0_STRDJ          RYTLWSVFKLKDVLP---------EDRSGYADEVQELFDQLAAK---DVTIRGTYDLSGL
S5VBD3_STRC3          RYTLWSVFRLKDVLP---------EDRAGYADEVQELFDQLAAK---DVTIRGTYDVSGL
C9YVV6_STRSW          RYTLWSVFRLKDVLP---------EDRAGYADEVQELFDQLAAK---DVTVRGTYDVSGL
G2GPA7_9ACTN          RYTLWSVFRLKDVLP---------EDRGGFAEEVQELFEQLAAK---DVTVRGTYDLSGL
CHDC_STRCO            RYTLWSVFKLKDTLP---------EDRAGYADEVQELFDQLAAK---DVTIRGTYDLSGL
F2RAQ0_STRVP          RYTLWSVFKLRDVLP---------EDRGGYADEVQELFDQLAAK---DITIRGTYDLSGL
E8VZY5_STRFA          RYTLWSVFRLKDVLP---------LDRAGYADEVQELFDQLAAK---DVTVRGTYDVSGL
D6X9U8_STRE2          RYTLWSVFKLRDVLP---------EDRSGYAEEVQELFDQLAAK---DVTVRGTYDVSGL
M2ZZB7_STRMB          RYTLWSVFKLRDVLP---------EDRSGWAEEVEELFAALAKE---DVTVRGTYDLSGL
D9W893_9ACTN          RYTLWSVFRLRDVLP---------EDRTGYADEVEQLFAQLAAK---DVTVRGTYDVSGL
E4NIF9_KITSK          RYTMWSVFKLKDALP---------EDRTALTAEVDALFEQLAAK---DVVVRGTYDVSGL
G8SFH3_ACTS5          RYTMWSVFRASSPLP---------ALRDELAGEVDTLFEQLAAK---DVTIRGTYDVSGL
I0HGB1_ACTM4          RYTMWSVFRAATPLP---------ALREDLAGEVDALFEQLSGK---DVTIRGTYDVSGL
R4LT68_9ACTN          RYTMWSVFKATTPLP---------ALRDELATEAGTLFEQLADK---DVTIRGTYDVSGL
F4FDY1_VERMA          RYTMWSVFRVSAPLP---------SLRDNVTGEVESLIEELAGK---DVVVRGTYDVAGL
A1SMY6_NOCSJ          RYTMWSVFRVADPLGPPD----SGADRAAEGAEVEQLFAELEAA---DVVVRGVYDVAGL
C7Q1S6_CATAD          RYAMWTVFKVREDL--PA----SDDARADLAAEVETLLETLAKD---DVVLRGSYDVSGF
D6Y396_THEBD          RYTMWSVFRLRERLP---------EDRGGIADEVEELLAQASQK---GVVTRGCYDVAGL
Q47NP0_THEFY          RYTMWSVFRIGDITA---------LDRAAAGDELTGLLDAAAEK---GTATRGVYDVQGF
A8L0J8_FRASN          LYTGWFVFAARQPLP---------ADRAGITAEAGELLDGALAK---DVYTRGIYEVSGY
F9ECK2_9ACTO          HYALYAVYRLTSSLP----------ALEDTRRRLVGESNYFVDQS--EVTTRGWYDVAGF
I6WVW6_PSEPQ          HYVMYSVFRTAGPLR----------DPD------TAAAEKAVLDT--GVSIRGWYDIGGF
C5C0U5_BEUC1          RFTMWSVWRTAAPLA----------GDAEEVDALAASAETAVTSA--GADLRGWYDVGGF
D3F509_CONWI          LYTLYAAFGAPAVRRL----------PEARRAAAAEEAQAALDAA--DVVVRGSYSLAGF
C8XF55_NAKMY          VYTAYSVYARTDELDA---------PVDKATTELVELSAELAEQ---GVSIRGYYDVSGM
D2NS34_ROTMD          HYALYTVFARSGARP-----AE--SNTDEARAEFEKVVEQLAAEG---VTLRGIYDVSAM
B2GL22_KOCRD          YWAAYTVLERTGQRP-----RD--AGSTENRAAFDALVAELAQRD---VTVRGMYDVSGM
C5CB90_MICLC          WFTTYTVFARPQGEPGWLGLEG--RDAKKAAKEFDEAVARVAETG---VTVRGVYDVSGM
A0JYM8_ARTS2          FFTLWTVFKRSSDVT----------RSGDAAADFEALLGRLADGG---VVHRGSYDVSAM
F0M889_PSEPM          FFTLWTVFKRSETLI----------RSADAASDFERLLERLAQSG---VTHRGSYDVSAM
A9WPH4_RENSM          PFTLWTVVKRTGQPT----------VGNGKVGAFDEVIDRLSSQG---ITLRGAYDVSAM
E1VXL5_GLUAR          FYTLWTIFKRSQIVE----------RSEAAAAEFDALIEQLAAEG---AIVRGIYDVSAM
A0A0M2H5P3_9MICO      AYTLWAVFRRDPAAP-------------APSGDLTEALATVEAAG---ITVRGFYDVSGM
A4AF07_9ACTN          GYTLWAVLRRDPHRP-------------APAGDLAPAVAAVEARG---VTIRGFYDVSSM
E8NBZ8_MICTS          IYTLWAILRRDPENP----------VTASEATELADLTALIEADG---VTVRGFYDVSGL
U2T284_LEIAQ          GFALWAVLRRDPARPD--DLDG--TDVPKAVAELEGVIADITLQG---VTTRGLYDVSGL
Q83FJ1_TROWT          HYALFVVYKNCESGV-------------NAGSVAGPLGDYFSSSA---VVLRGVYDPSAM
Z9JPP3_9MICO          RYTSYTVFRRLSGLTE---DGE--VAPEQILEALAGTVALIEAED---VEILGFYDVSGF
C7MH02_BRAFD          RYTSYTVFRRLSGLTE---EGE--VTDAQITAALGDVTALIESDSEGGAEILGFYDVSGF
S3ZA86_9MICO          RFTAYSVYRKIGGLND---EGI--VSPEQVLEDLERTVASLAGAD---VEVLGFYDVSGF
                       :  :                                               * *.  . 

F8A0U6_CELGA          RADADLMVWWHA-----ETVEQVQGAYQRLRR-SDLGRHLLPVWSVVGLHRAAEFNRSHV
A6W8D4_KINRD          RADADLMFWWHA-----PTVELVQEAYRRLRR-TRLGRHLVPVWSVVGLHRPAEFNRGHV
D7GH54_PROFC          RADADLMVWWHA-----HDYETLQRAYHVLRA-STLGNVLTPVWSQLALHRAAEFNKAHV
X8F7J4_MYCUL          RADADFMIWTHA-----ERIETLQATYSDFRRTTTLGRACTPVWSSVGLHRPAEFNKSHI
B2HM25_MYCMM          RADADFMIWTHA-----ERIETLQATYSDFRRTTTLGRACTPVWSSVGLHRPAEFNKSHI
CHDC_MYCTU            RADADFMVWTHA-----ERVEALQATYADFRRTTTLGRACTPVWSGVGLHRPAEFNKSHI
I0S1B4_MYCXE          RADADFMIWTHA-----ERVEALQATYEDFRRTTTLGRACTPVWSSVALHRPAEFNKSHI
CHDC_MYCS2            RADADFMIWTHA-----DNVEALQSTYSDFRRTTALGRISDPVWSSVALHRPAEFNKSHI
A1UF50_MYCSK          RADADFMIWTHA-----DTVEALQATYSDFRRATALGRASSPVWSNVALHRPAEFNKSHI
I4BI58_MYCCN          RADADFMIWTHA-----ETVEALQATYADFRRTTTLGRACTPVWSNVALHRPAEFNKSHV
F5YVK1_MYCSD          RADADFMIWSHA-----ERVEDLQATYAGFRR-TALGRACTPVWSNVGLHRPAEFNKSHV
U5E4U5_NOCAS          RADADFMLWTHA-----ERVEDLQAAYADFRRTTELGRASAPVWSNVAVHRPAEFNKSHI
K0F286_9NOCA          RADADFMIWTHA-----ERVEDLQAAYADFRRTTELGRASAPVWSNVALHRPAEFNKSHV
F6ELI1_HOYSD          RADADFMIWTHA-----EQVEDLQAAYQDFRRTTTLGRISAPVWSSVALHRPAEFNKSHV
E9SV53_RHOHA          RADADYMIWTHA-----ERLEDLQKLYADFRRTTDLGQSSDPVWSNVALHRPAEFNKSHV
G7H5I6_9ACTN          RGDSDFMIWWHA-----ETIEELQAAYQRFRRETALGRGSDAFWSAAALHRPAEFNKSHI
D0LCJ2_GORB4          RADADFMIWWHA-----EKIEELQAAYARFRRETVVGRASDAVWSNVALHRPAEFNKSHI
A4FAS5_SACEN          RADADFMIWWHA-----AEVEAVQAAYTGFRRETPLGHSSEPVWSNVALHRPAEFNKSHI
K0JWM2_SACES          RADADFMIWWHA-----EEIEQVQAAYTGFRR-TALGRASVPVWSQVALHRPAEFNRSHI
B1VE13_CORU7          RPEADIMFWIHG-----EKLEDLQAFYRAFRRETLLGKAAVPYRTNAALHRPAEFNKSHV
Q4JVC0_CORJK          RAEADVMIWWHA-----EKMEDLQVAYRRFLKETKLGQACEPVWSNTCLHRPSEFNKAHL
Q6NGV6_CORDI          RAEADFMIWWIA-----EEFEEIQAAFARFRRETVLGQVSEVAWLGNSLHRPAEFNRSHL
L1MGC4_9CORY          RAEADYMIWWHA-----ENIEDIQKAYNDFRRTTVLGQVSEVFWTGTAVHRPAEFNKSHL
Q8FPI6_COREF          RAEADYMIWWHA-----EEFDELQKAFADFRRTTILGQVSEVFWIGNGIHRPSEFNKQHL
S5T2Z6_9CORY          RADADFMIWWHA-----ENFDEIQDAYQRFRRTT-LGQSLETWWIGNGVHRPAEFNKRHL
Q0SJX2_RHOJR          RGDADFMMWTHA-----DTVEELQAAYSGFRR-CRLGRACTTVWSAVALHRPAEFNRSHI
H2K5X7_STRHJ          RADADLMIWWHA-----ETSDQLQEAYNLFRR-TRLGRALTPVWSNMALHRPAEFNRSHI
Q82KZ1_STRAW          RADADLMIWWHA-----ETSDELQEAYNLFRR-TKLGRALEPVWSNMALHRPAEFNRSHI
K4R0B0_STRDJ          RADADVMIWWHA-----ETSDQLQEAYNLFRR-TKLGRALEPVWSNMALHRPAEFNRSHI
S5VBD3_STRC3          RADADLMIWWHA-----ETADQLQEAYNLFRR-TRLGRALEPVWSNMALHRPAEFNRSHI
C9YVV6_STRSW          RADADLMIWWHA-----ETSDQLQEAYNLFRR-TRLGRALAPVWSNMALHRPAEFNRSHI
G2GPA7_9ACTN          RADADLMIWWHA-----ETSDQLQEAYNLFRR-TRLGRALTPVWSNMALHRPAEFNRSHI
CHDC_STRCO            RADADLMIWWHA-----ETADQLQEAYNLFRR-TKLGRALEPVWSNMALHRPAEFNRSHI
F2RAQ0_STRVP          RADADVMIWWHA-----ETSDELQEAYNLFRR-TKLGRALEPVWSNMALHRPAEFNKSHI
E8VZY5_STRFA          RADADLMIWWHA-----ETSDELQEAYNLFRR-TKLGRALDPVWSNMALHRPAEFNKSHV
D6X9U8_STRE2          RADADVMIWWHA-----ETADELQDAYNRFRR-TRLGRALEPVWSNMALHRPAEFNKSHI
M2ZZB7_STRMB          RADADVMIWWHS-----ETSDALQSAYSRFRR-TRLGRALEPVWSNMALHRPAEFNKSHI
D9W893_9ACTN          RADADVMIWWHS-----ETSDALQEAYNLFRR-TRLGRALEPVWSNMALHRPAEFNKSHI
E4NIF9_KITSK          RADADLMVWWHA-----EDSDDLQEAYNRFRR-TGLGRLLEPVWSNMALHRPAEFNKSHI
G8SFH3_ACTS5          RADADLMIWWHA-----ADSDDLQEAYSLFRR-TALGRHLTPVWSQMALHRPAEFNKSHL
I0HGB1_ACTM4          RADADVMIWWHA-----ATPDALQDAYGLFRR-TALGRHLEPVWSQMALHRPAEFNRSHL
R4LT68_9ACTN          RADADVMIWWHS-----SSSDALQDAYGLFRR-TALGRHLTPVWSQMALHRPAEFNKSHL
F4FDY1_VERMA          RADADLMIWWHS-----SSSDALQDAYLRFRR-TTLGRAMTPVWSQMALHRPAEFNKSHI
A1SMY6_NOCSJ          RADAELMIWWHA-----ETSEALQDAYQRLRH-TALGRRLEPVWSQLALHRPAEFNKSHV
C7Q1S6_CATAD          RHDADFMLWLHA-----ETSEALQDAYQRFRR-TAFGRLTEPVWSQMALHRPAEFNKSHV
D6Y396_THEBD          RADADYMFWWHA-----PTPEDVQEVYTRFRR-TALGRASEPVWSVTGLHRPAEFNRSHI
Q47NP0_THEFY          RADADVMFWWIA-----DTPEQLQTIYADFRR-TALGRASTPVWSAIGIHRPAEFNRGHV
A8L0J8_FRASN          RADADVMIWWTS-----PNPDLLQQTYQRFRQ-TGLGRCLEPVWSAVGLHRPAEFNRNHI
F9ECK2_9ACTO          RSDADLMIWWLD-----DDPEKLQDASHRLRA-SALGRYVEPVWSCMGLHTPAEFNRRHI
I6WVW6_PSEPQ          RADADLMLWTLA-----NDPHPLQAAYHALRG-SGLGRDLEPVWSCIGVHRPAEFNRGHT
C5C0U5_BEUC1          RADADLMAWWHA-----PDVESVQAAYHALRA-STLGAVLEPVWSVVAVHRPAEFNRGHV
D3F509_CONWI          RAEADLLLWLVA-----ASADALQDAVVAFRH-TELGRSLDAHWTNIGVHREAEFAKSHI
C8XF55_NAKMY          RADADLMVWWYA-----PTAEQLQSAARSLRR-TSVGRSLAPFWSAMGLHRPAEFNKGHV
D2NS34_ROTMD          RDNADVMIWTHG-----ATPEKLQAAVRKIRR-TALFAGTTIVWSTMGVHREAEFTRNHA
B2GL22_KOCRD          REGADFMLWLTG-----KEPDALQAAIRELRR-QPLLAGTRQSWNAMGVHREAEFTSNHS
C5CB90_MICLC          REAGDVMVWMYG-----QVPEDLQAAIRELRR-TRLLEGTTMVLSAMGADRMAEFNKDHV
A0JYM8_ARTS2          RADADIMVWLHG-----PKPEALQQAVRDIRR-STLFAGTEIAWSAMGVHREAEFAKNHT
F0M889_PSEPM          RADADVMVWLHG-----PKPEALQQAIRDIRR-SSLFAGTEIVWSAMGVHREAEFAKNHT
A9WPH4_RENSM          RNDADVMIWLVG-----PSAEGLQQAVRDIRR-TELFANTEITWSAMGVHREAEFAKNHI
E1VXL5_GLUAR          REDADVMIWVHG-----PAAELLQASMRKIRR-SALLEGTEIVYSTMAVHREAEFAKDHS
A0A0M2H5P3_9MICO      RADADLMVWLHAQPDQADAPEALQAALRTLRR-AAPLSGLIPVWNAMGVHRPAEFTSGHL
A4AF07_9ACTN          RADADLMIWLHG-----ENPEDIQWALRELRR-SEPLASLLPTWNAMGVHRDAEFSKSHM
E8NBZ8_MICTS          RADADLMIWLHG-----PDPQALQRDLRRLRR-TELLKNLLPTWNAMGVHRDAEFNRSHV
U2T284_LEIAQ          RADADLMIWLHG-----PDAEGLQWALRQLRR-TQLLKALLPTWNAMGVHRDAEFNKAHV
Q83FJ1_TROWT          SADANLMLWLHS-----ESAVDLQKAFRYLGK---VFCNMRVLWSAMGVHRDAEFNKSHV
Z9JPP3_9MICO          RAEDDLMLWLAA-----DRPEALQAALREFER-SLPGTWLNREWAAMGVHRQAEFTRSHV
C7MH02_BRAFD          RAEADLMLWLAA-----DDPASLQRGLREFER-SLPGTWLHREWAGVGVHRMAEFAKGHV
S3ZA86_9MICO          RAEADLMVWLAS-----ERPEALQEALRLFEN-SIAGTYLEKEWQAMGVHRGHEFSRSHK
                          : : *             :*     :                   .   **   * 

F8A0U6_CELGA          PAFLAGE-EPGDYMCVYPFVRSYDWYVLPADDRRRMLVEHGHAA-RDYADVRANTVSAFA
A6W8D4_KINRD          PAFLSGE-RARDYVSVYPFVRSYEWYLLPDDERRKMLRDHGLKA-RPYEDVRANTVSAFS
D7GH54_PROFC          PAFLADE-QPRDNICVYPFVRSHEWYLLPDEDRAQLLADHGRAA-SGFADVRANTMASFG
X8F7J4_MYCUL          PAFLAGE-EPGAYICVYPFVRSYEWYLLPDEERRRMLAEHGMAA-RGYKDVRANTVPAFA
B2HM25_MYCMM          PAFLAGE-EPGAYICVYPFVRSYEWYLLPDEERRRMLAEHGMAA-RGYKDVRANTVPAFA
CHDC_MYCTU            PAFLAGE-EPGAYICVYPFVRSYEWYLLPDEERRRMLAEHGMAA-RGYKDVRANTVPAFA
I0S1B4_MYCXE          PAFLAGE-EPGAYVCVYPFVRSYEWYLLPEEERRRMLAEHGMAA-RGYKEVRANTVPAFA
CHDC_MYCS2            PAFLAGE-EPGNYICVYPFVRSYEWYLLPDEERRRMLSEHGMAA-RGYKDVRANTVPAFA
A1UF50_MYCSK          PAFLAGE-DPGNYICVYPFVRSLEWYLLPDDERRRMLSEHGMAA-RGYKDVRANTVPAFA
I4BI58_MYCCN          PAFLAGE-EPGNYICVYPFVRSYEWYLLPDEERRRMLAEHGMAA-REYKDVRANTVSSFA
F5YVK1_MYCSD          PAFIAGE-PAGAYICVYPFVRSHEWYVLPEEDRRRMLAEHGMAA-RPYKDVRANTVPAFA
U5E4U5_NOCAS          PAFLAGE-DAGNYICVYPFVRSYEWYLLPDEERRKMLADHGKAA-RGYPDVRANTVSSMA
K0F286_9NOCA          PAFLAGE-DPGNYICVYPFVRSYEWYLLPDEERRKMLADHGKAA-RGYPDVRANTVSSFA
F6ELI1_HOYSD          PAFLAGE-DPGAYICVYPFVRSYEWYLLPDDERRKMLADHGKAA-RGYPDVRANTVSSFA
E9SV53_RHOHA          PAFIAGE-EPGDYICVYPFVRSYEWYLLPDADRRKMLADHGMAG-RTYPDVRANTIPAFA
G7H5I6_9ACTN          PAFLAGE-DPGAYVCVYPFVRSLDWYLLPDEERRTMLADHGKAA-RGYKDVRANTVPAFA
D0LCJ2_GORB4          PAFLAGE-EPGNYICVYPFVRSYDWYLLPDEERRKMLADHGKAA-REYKDVRANTVASFA
A4FAS5_SACEN          PAFLAGE-EPRKYVCVYPFVRSYEWYLMPDDERRTMLADHGKAA-RDYPDVRANTVASFG
K0JWM2_SACES          PAFLAGE-EPRKYICVYPFVRSYEWYLLPDEDRRKMLADHGKEA-RDYPDVRANTVASFA
B1VE13_CORU7          PDFMVDP-EPKEWICLYPFVRTPEWYLMDDAPRRKMLVDHGVEA-RKYNRVRANTIPSFG
Q4JVC0_CORJK          PSFIMGE-EPGDWICVYPFVRSYDWYTMERAERSRLLREHGKAA-LGFDEVRANTVPAFA
Q6NGV6_CORDI          PSFIMGE-IPGDWITVYPFVRSYDWYIMDPQKRRKILAEHGQAA-RDFPDVRANTVPAFA
L1MGC4_9CORY          PSFIMGE-APGSWITVYPFVRSYDWYLMDDKDRRRILAEHGRSG-RDFPDVRANTVPSFS
Q8FPI6_COREF          PAFIMGE-EPRKWMTVYPFVRSYDWYILEPAKRGRILAEHGQAA-VDFADVRANTVSAFS
S5T2Z6_9CORY          PSFIMGE-EAERWITVYPFNRSYEWYLLEGTERSRILRQHGQAA-KDFADVRANTIPAFA
Q0SJX2_RHOJR          AAYVADE-EPGQFVCVYPFNRSLEWYLLPDAERRRQLAEHGRAA-RAYPDVRANTVSSFG
H2K5X7_STRHJ          PAFLADE-TPRNYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
Q82KZ1_STRAW          PAFLADE-TPRNYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
K4R0B0_STRDJ          PAFLADE-TPRDYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
S5VBD3_STRC3          PAFLADE-TPRNYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
C9YVV6_STRSW          PAFLADE-TPRDYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
G2GPA7_9ACTN          PAFLADE-TPRDYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
CHDC_STRCO            PAFLADE-TPRNYISVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
F2RAQ0_STRVP          PAFLADE-NPRDYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
E8VZY5_STRFA          PAFLADE-TPRDYISVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
D6X9U8_STRE2          PAFLADE-TPRNYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
M2ZZB7_STRMB          PAFLADE-TPREYVSVYPFVRSYDWYLLPDEDRRRMLADHGKMA-RGYPDVRANTVASFS
D9W893_9ACTN          PAFLADE-NARDYVSVYPFVRSYEWYLLPDEERRTMLADHGKMA-RGFPDVRANTVASFS
E4NIF9_KITSK          PAFLADE-QPREYVCVYPFVRSYEWYLLPDEERRGMLAEHGKMA-RGYPDVRANTVASFA
G8SFH3_ACTS5          PAFLAGE-EARPYLCVYPFVRSYEWYLLPDAERRELLAEHGRQA-RGYPDVRANTVASFA
I0HGB1_ACTM4          PAFLAGE-EARAYICVYPFVRSYEWYLLPDAERRQLLAEHGQMA-RPYPDVRANTVASFA
R4LT68_9ACTN          PAFLADE-TPRPYICVYPFVRSYEWYLLPDEERRGMLAEHGRMA-RGYPDVRANTVASFA
F4FDY1_VERMA          PAFLAGE-EARAYLCVYPFVRSYDWYLLPDAERRELLAEHGQMA-RGYPDVRANTVASFA
A1SMY6_NOCSJ          PAFLDDEEPPRKHVCVYPFVRSYEWYLLEDSERRHMLAEHGKMA-RDYPDVRANTVSSFA
C7Q1S6_CATAD          PAFVADE-TPRGYIAVYPFVRGYEWYLLEDAERRRLLAEHGMMS-REYPDVRANTVPAFA
D6Y396_THEBD          PAFLAEE-QPRGYLCVYPFVRSYEWYVLPEAERREMLAEHGAMA-RGFPDVRANTVASFG
Q47NP0_THEFY          PAFLAGE-EPREYLCVYPFVRSYEWYLLPEEERRQMLAEHGRMA-APFPDVRANTVSTFG
A8L0J8_FRASN          PAYVRRE-DPRDYICVYPFNRSFEWYLLPDYERRGLLAEHGMMG-REYEDVRANTVAAFG
F9ECK2_9ACTO          PACFGGV-APRDWCMVYPFVRSYDWYLLPGEERSRIMAAHGRNGFSAYPDVKGSTLSTFG
I6WVW6_PSEPQ          PACFSGV-APRPWACVYPFVRSYEWYYMDEERRSKMLAAHGRMG-REYPDVPGSTTSAFA
C5C0U5_BEUC1          PAFLAGD-DPKGFLCVYPFVRSYEWYLLPDDERRTLLREHGMAA-RDYGDVLANTVATFA
D3F509_CONWI          PAYLAGK-EPGRYVCVYPFVRSLDWYLLEPDARARMLREHGMMG-RDYPDVLANTVSAFA
C8XF55_NAKMY          PAFLAGA-AAKNWATVYPFVRSYEWYLLPDAERRGMLVEHGMMG-REYDQVLSNTVAAFA
D2NS34_ROTMD          PAYAR-GKAPEAWVCVYPFVRSYDWYYMNPERRAEMLKNHGMKA-IDFPQVLANTVAAFG
B2GL22_KOCRD          PAFAR-GAEAQKWVCVYPFVRSYEWYYMNPQRRGEMLKNHGMKA-REYPQVLANTIACFG
C5CB90_MICLC          PAFAM-GRKALKWLCFYPFVRSYDWYLLDPKERARMLREHGQLG-QDFPQVWANTTSAFG
A0JYM8_ARTS2          PAFSR-GVEPAEWLCVYPFVRSYEWYLLPDAERGAMLRDHGLLG-RDFPQVISNTVSSFA
F0M889_PSEPM          PAYSR-GVAPAEWLCVYPFVRSYEWYILPEEERGAMLREHGLLG-REFPQVISNTVSSFA
A9WPH4_RENSM          PTYMRAGIEPKKWVCVYPFVRSYEWYILPNEDRGRMLREHGMLG-RDFPGVLANTVSSFA
E1VXL5_GLUAR          PAFAR-GVDAKEWMTVYPFVRSTEWYTMDPAERGKMLRDHGILG-REFPNVLANTVAAFS
A0A0M2H5P3_9MICO      PAFVR-GKDPETWLTVYPFVRSYDWYLLPETERRQMLGDHGRKG-AEYRQVLANTVASFA
A4AF07_9ACTN          PAFMR-GKEPEAWLTVYPFVRSYDWYLLPDAERSKMLRDHGMKG-SEMPQVLANTVASFA
E8NBZ8_MICTS          PGFLR-GIPAQQWLCLYPFVRSYEWYLLPEAERREMLIEHGKKG-SAYKGVIANTVASFA
U2T284_LEIAQ          PGFLR-GKEPKAWLCVYPFVRSYEWYLLPDEERGRMLSEHGRKG-AAFRSVLANTVASFA
Q83FJ1_TROWT          PAFIS-GEPPKDWLTIYPFVRTPEWYLIPDEERKDMLAEHGDRA-RAFMSVKPNTLAAFS
Z9JPP3_9MICO          PSFMVDSMTRKEWITVYPFVRSYDWYLLEDAERAEMLREHGLLG-RDFPQVNANTVAAFA
C7MH02_BRAFD          PSFMVPSVTRKQWITVYPFVRSYDWYLLPDDERNRMLREHGLLG-RDFPQVNANTVAAFA
S3ZA86_9MICO          PAFMEADKERKDWITVYPFVRSYDWYLLEEDERREMMKEHGMYG-REYPNVWGNTTAAFA
                      .              .*** *  :** :    *   :  **  .      *  .* . :.

F8A0U6_CELGA          LGDYEWILAFEAGELHRIVDLMRDLRATDARLHVREEVPFYTGPRTE-----LGAWADKQ
A6W8D4_KINRD          LGDYEWILAFEADELHRIVDLMRDLRDTEARRHVREEVPFFTGPRVA-----LADLVDAL
D7GH54_PROFC          LGDYEWILCFEADEMARIVDLMRVMRTTGARRHVRVETPFYSGRRRD-----LTEIVNSW
X8F7J4_MYCUL          LGDYEWILAFEAPSWTASSI----------------------------------------
B2HM25_MYCMM          LGDYEWILAFEAPELDRIVDLMRDLRATDARRHTRAETPFYSGPRVP-----VEQLVTSL
CHDC_MYCTU            LGDYEWILAFEAPELDRIVDLMRELRATDARRHTRAETPFFTGPRVP-----VEQLVHSL
I0S1B4_MYCXE          LGDYEWILAFESPELHRIVDLMRELRATEARRHTRAETPFFTGPRVP-----VDQLVASL
CHDC_MYCS2            LGDYEWILAFEAPELHRIVDLMRDLRATDARRHTREETPFFTGPRIS-----VENLIAKL
A1UF50_MYCSK          LGDYEWILAFEAPELHRIVDLMRDLRATDARRHVREETPFFTGPRVG-----VEELVTRL
I4BI58_MYCCN          LGDYEWLLAFEAPELHRIVDLMRDLRATDARRHVREETPFFTGPRVS-----VEKLVLAL
F5YVK1_MYCSD          LGDYEWILAFEAPELDLIVDLMRDLRNTEARLHAREETPFFTGPRVD-----VEQLVAAL
U5E4U5_NOCAS          LGDYEWILAFEAPELHRIVDLMRDLRATEARLHVREEIPFFTGPRVE-----IEQLVTAL
K0F286_9NOCA          LGDYEWILAFEAPELHRIVDLMRDLRATEARLHVREEIPFFTGPRVE-----LEKLITAL
F6ELI1_HOYSD          LGDYEWILAFEAPELHRIVDLMRDLRATEARLHVREEIPFFTGPRVD-----AANLIHAL
E9SV53_RHOHA          LGDYEWILAFEAPKLDRIVDLMRDLRATEARMHVREETPFFTGPRVS-----VEQLVNSL
G7H5I6_9ACTN          LGDYEWILAFEAPELHRIVDLMRDLRATEARRHVRVEIPFFTGPRVE-----PAALVARL
D0LCJ2_GORB4          LGDYEWLLAFEAPELHRIVDLMRDLRATEARRHVREETPFFTGPRVE-----VDALIDAL
A4FAS5_SACEN          LGDYEWVLAFEADELHRIVDLMWKMRYTEARLHVREETPFYTGHRVD-----VADLVTRL
K0JWM2_SACES          LGDYEWILAFEADELHRIVDLMRHLRGTEARLHVREEIPFYTGTRLP-----AAELVTNL
B1VE13_CORU7          LGDYEWMLAFEAPDVAEVVDLMRTMRYTEARKYVSEETPFLTGRMIT---DWLPEFVESL
Q4JVC0_CORJK          LGDYEWILAFESPTLERIVELMHKMRYTEARHHVREEIPFFTGRRVNGDKEKLASFVESL
Q6NGV6_CORDI          LGDYEWMLAFEAPRLDRIVDLMHKMRYTEARLHVREETPFFTGRRVS----EVSELVNVL
L1MGC4_9CORY          LGDYEWILAFEGPDLGRIVDLMHKMRYTEARLHVREETPFFTGRRVA----DVSEIIEVL
Q8FPI6_COREF          LGDYEWMLAFEADEMHRIVDLMHKMRYTEARMHVREELPFVSGYRVE----DIAELIEVL
S5T2Z6_9CORY          LGDYEWMLAFEGPELGRIVDLMHTMRYTEARLHVREETPFVSGRRVD----DVAEAINAL
Q0SJX2_RHOJR          LSDYEWILAFEAPDPSRIVDMMRDLRATDARRHVRLETPFFSGPRTG-----LDALVARF
H2K5X7_STRHJ          LGDYEWILAFEADELYRIVDLMRHLRASEARMHVREEVPFFTGRRKD-----IGELVADL
Q82KZ1_STRAW          LGDYEWMLAFEADELYRIVDLMRHLRASEARMHVREEVPFYTGRRKS-----VAELVAGL
K4R0B0_STRDJ          LGDYEWILAFEADELHRIVDLMRHLRASEARMHVREEVPFYTGRRKS-----VADLVAEL
S5VBD3_STRC3          LGDYEWVLAFEADELYRIVDLMRHLRGSEARRHVREEVPFYTGRRKS-----VADLVAGL
C9YVV6_STRSW          LGDYEWILAFEADELYRIVDLMRHLRASEARMHVREEVPFYTGRRRS-----VAELVAGL
G2GPA7_9ACTN          LGDYEWILAFEADELYRIVDLMRHLRASKARLHVREEVPFYTGRRKS-----VADLVAGL
CHDC_STRCO            LGDYEWILAFEADELHRIVDLMRHLRGSEARRHVREEIPFYTGRRKD-----IGELVAGL
F2RAQ0_STRVP          LGDYEWLLAFEADELHRIVDLMRHLRASEARMHVREEVPFYTGRRKS-----VADLVAGL
E8VZY5_STRFA          LGDYEWVLAFEADELYRIVDLMRHLRASEARLHVREEVPFYTGRRKS-----VADLVAGL
D6X9U8_STRE2          LGDYEWILAFEADELYRIVDLMRHLRASEARMHVREEVPFYTGRRKD-----VADLVAGL
M2ZZB7_STRMB          LGDYEWILAFEADELYRIVDLMRHLRASEARMHVREEVPFFTGRRKA-----VADLVAGL
D9W893_9ACTN          LGDYEWILAFEADELHRIVDLMRHLRASEARRHVREEVPFYTGRRKP-----VSELVAGL
E4NIF9_KITSK          LGDYEWLLAFEADELHRIVDLMRDLRPSRARLHVREEVPFFTGRRKP-----VADLLAGL
G8SFH3_ACTS5          LGDYEWMLAFEADELHRIVDLMRDLRASRARRHVREEVPFYTGRRRS-----ISEIAASL
I0HGB1_ACTM4          LGDYEWMLAFEADEMHRIVDLMRDLRASGARRHVREEVPFFTGRRRS-----VSELVTNL
R4LT68_9ACTN          LGDFEWILAFEADELHRIVDLMRDLRASTARRHVREEVPFYTGRRRS-----LTELVANL
F4FDY1_VERMA          LGDYEWMLAFEADELHRIVDLMRDLRASRARLHVREEVPFYTGRRRS-----IADIVTAL
A1SMY6_NOCSJ          LGDYEWMLAFEADELHRIVDLMRHLRAATARRHVREEVPFYTGARTP-----ITELVHRL
C7Q1S6_CATAD          LGDYEWILAFEADALDRIVDLMRHLRGSETRRHVREEVPFYTGKRRS-----ITEIVTAL
D6Y396_THEBD          LNDYEWILAFEADELHRIVDLIRHLRGSKARLHVRVEVPFYTGVRKP-----VRDLVASL
Q47NP0_THEFY          LSDYEWLLGFEANELHRIVDLVRALRAAQARRHTRLEIPFFTGKRKS-----VAELVEAL
A8L0J8_FRASN          LGDYEWLLAFEADELHRIVDCIRHLRASATRRHTRLETPFYSGARKP-----LPDVVAAL
F9ECK2_9ACTO          MSDYEWVLAFEADALDRLEGVIHHQRYTEARLHVRIDTPFYTGCRVS-----PREWAERQ
I6WVW6_PSEPQ          LNDYEWLLAFEADELHRLTDAMRHQRGAEARLHVRKEIPFFTGPRVT-----LEEWAYRQ
C5C0U5_BEUC1          LSDYEWILAFEADELVRIVDLMRELRATDARRHVREEVPFFTGPRVE-----LPEWAGRQ
D3F509_CONWI          LGDYEWLLAFEAEELTRIVDLMRHLRAAEARRHTREELPFFTGIRKG-----LADVVADL
C8XF55_NAKMY          LGDYEWLLALEADELHDTVDLMRHLRASGARLHVREEVPFFSGRRVD-----EAGVVEVL
D2NS34_ROTMD          MNDYEWVLALEAPELVDLVDMMRHFRNTEARLHVREETPFYTGRRI-----GADEVAEVL
B2GL22_KOCRD          LNDFEWLLALEAPELVDLVDIMRHFRNTEARLHVREETPFYTGRRI-----TTEEIAEVL
C5CB90_MICLC          LNDWEWLLGLEADELTDLVDMMRHLRNNETRLHVRSEVPFYTGRRL-----ETAEIAEVL
A0JYM8_ARTS2          LGDWEWILGLEAPELVDLVDLMRHLRATEARHHVREEIPFYTGRRV-----TAGEIAEVL
F0M889_PSEPM          LGDWEWILGLEAPELVDLVDLMRHLRNTEARNHVREEVPFYTGRRI-----SPAEVAEVL
A9WPH4_RENSM          LGDWEWLLGLEADDVVELVDLMRHLRATDARMHVREEVPFYTGRRI-----NAAEIAEVL
E1VXL5_GLUAR          FSDFEWQICLEADDMIDLVDMMRHLRYTEARHHVREETPFYTGRRI-----SAAQVLEVL
A0A0M2H5P3_9MICO      LGDYEWILALEAPELVDLVDLMRHLRQTEARRHVREEIPFYTGRRI-----EPHEIAEVL
A4AF07_9ACTN          LGDYEWMLALEAPDLVDLVDLMRHLRQTEARRHVREEIPFYTGRRI-----SLEEIAEVL
E8NBZ8_MICTS          LGDYEWLLPMEADVLTDLVDMMRDLRYTEARRHVREEVPFYTGRLV-----TLDEIPEIL
U2T284_LEIAQ          LGDYEWILPLESDELVDLVDLMRDLRQTDARLHVREEVPFFTGRRV-----EPAEVVEVL
Q83FJ1_TROWT          LGNYEWLLPMESDSLIDLVDLMRALRYTRARRYVLLETPFYTGRRI-----GIADVQEVL
Z9JPP3_9MICO          LGDYEWLLSFEADDLHDLVDMMRHLRYSKARLHVRDELPFHTGRRLA----SLEDVAALL
C7MH02_BRAFD          LGDYEWMLSFEADDLHDLVDMMRHLRYSDARLHVRDELPFHTGRRLE----TLEDVAALL
S3ZA86_9MICO          LGDYEWLLSFEADTLPELVDMMRHLRYTKARLHVREELPFHTGHRIA----ELDEVVEVL
                      :.::** : :*.                                                

F8A0U6_CELGA          PRG-
A6W8D4_KINRD          P---
D7GH54_PROFC          G---
X8F7J4_MYCUL          ----
B2HM25_MYCMM          P---
CHDC_MYCTU            P---
I0S1B4_MYCXE          P---
CHDC_MYCS2            P---
A1UF50_MYCSK          P---
I4BI58_MYCCN          P---
F5YVK1_MYCSD          P---
U5E4U5_NOCAS          P---
K0F286_9NOCA          P---
F6ELI1_HOYSD          P---
E9SV53_RHOHA          P---
G7H5I6_9ACTN          P---
D0LCJ2_GORB4          P---
A4FAS5_SACEN          P---
K0JWM2_SACES          P---
B1VE13_CORU7          P---
Q4JVC0_CORJK          A---
Q6NGV6_CORDI          P---
L1MGC4_9CORY          P---
Q8FPI6_COREF          P---
S5T2Z6_9CORY          P---
Q0SJX2_RHOJR          P---
H2K5X7_STRHJ          A---
Q82KZ1_STRAW          A---
K4R0B0_STRDJ          A---
S5VBD3_STRC3          A---
C9YVV6_STRSW          A---
G2GPA7_9ACTN          A---
CHDC_STRCO            A---
F2RAQ0_STRVP          A---
E8VZY5_STRFA          A---
D6X9U8_STRE2          A---
M2ZZB7_STRMB          A---
D9W893_9ACTN          A---
E4NIF9_KITSK          Y---
G8SFH3_ACTS5          P---
I0HGB1_ACTM4          P---
R4LT68_9ACTN          P---
F4FDY1_VERMA          A---
A1SMY6_NOCSJ          P---
C7Q1S6_CATAD          P---
D6Y396_THEBD          V---
Q47NP0_THEFY          P---
A8L0J8_FRASN          P---
F9ECK2_9ACTO          PRD-
I6WVW6_PSEPQ          PRS-
C5C0U5_BEUC1          PFMG
D3F509_CONWI          P---
C8XF55_NAKMY          R---
D2NS34_ROTMD          A---
B2GL22_KOCRD          D---
C5CB90_MICLC          A---
A0JYM8_ARTS2          A---
F0M889_PSEPM          A---
A9WPH4_RENSM          Q---
E1VXL5_GLUAR          K---
A0A0M2H5P3_9MICO      A---
A4AF07_9ACTN          A---
E8NBZ8_MICTS          Q---
U2T284_LEIAQ          Q---
Q83FJ1_TROWT          ST--
Z9JPP3_9MICO          A---
C7MH02_BRAFD          A---
S3ZA86_9MICO          L---