CLUSTAL format seed alignment for MF_02247

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CAR_MYCMM             --------------------------MSPITREERLERRIQDLYANDPQFAAAKPAT---
CAR_MYCTU             ---------------------------MSIN-DQRLTRRVEDLYASDAQFAAASPNE---
B2HE95_MYCMM          -----------------------MSITCVDTRAQRSARRIEQLYSTDAQFAAARPST---
F5YUX6_MYCSD          -----------------------MMLTDLSVDEDRQARLAAELAAVDPQFAAARPDP---
Q9CCT4_MYCLE          -----------MWRQQSISHRKESVMSTITKQEKQLARRVDDLTANDPQFAAAKPDP---
A0QWI7_MYCS2          --------------------------MTIETREDRFNRRIDHLFETDPQFAAARPDE---
W9B0J1_9MYCO          --------------------------MTNDVSVERFQRRLTHLYDTDPQFAAAAPSD---
A1UFA8_MYCSK          --------------------------MSTETREARLQQRIAHLFTTDPQFAAARPDP---
A1T887_MYCVP          --------------------------MSTDTREDRLARRIADLYATDPQFAAAAPDD---
A0A448GMC3_MYCCH      --------------------------MASESRDVRLQRRIAELYDTDPQFAAARPDE---
K0EPZ9_9NOCA          ------------------------------MTDVEVARRIDDLSATDEVLAGALPDP---
A0A2G5PCS5_9MYCO      ----------------------------MSDQILRLRQRIADLQHNDPEYAAALPDPKVG
A0A5S9NMT1_MYCVN      --------------------------MLTDADTEALARRVGALLADDAEFAATLPDK---
A0A378YSF8_9NOCA      --------------------------MLDDARVERRERRIADALADD-QVRAAVADA---
Q5YY80_NOCFA          ---------------------------MESTRATRLRQRIAALYADDAQVRDARPDE---
U5ELY0_NOCAS          --------------------------MTVEVDADRLADRIRALYAQDAQIRAATPIP---
H6R914_NOCCG          --------------------------MSIESPAARRKQRIDRLYRDDHQARAAAPDE---
CAR_NOCIO             --------------------------MAVDSPDERLQRRIAQLFAEDEQVKAARPLE---
D6ZDT1_SEGRD          -------------------------MGSGADRAKLFFQKIEELTAADPQFAAAVPDQ---
CAR_SEGRC             -----------------MTESQSYETRQARPAGQSLAERVARLVAIDPQAAAAVPDK---
A0A2P7PL49_9ACTN      MHEHEATHRAAQQTEHPTEPPTDHRTETEHAASRAIASRIEALHTHDPEFARAAPSP---
A0A1T3NUL4_9ACTN      --------------------------MPEHQTHHDLAARVTALRAHDPEFARAIPSS---
A0R484_MYCS2          --------------MTSDVHDATDGVTETALDDEQSTRRIAELYATDPEFAAAAPLP---
A0A372PB04_9ACTN      ------------------------------------------MLRAEPELADRMPLR---
A0A3D9TUD1_9NOCA      ---------------------------MTSAMDSPQLQRFNELHRSDEQFRAAEPDS---
D5UWX9_TSUPD          -------------------------------------MSIETVQNGVPAEGSVPPAD---
                                                                            .     

CAR_MYCMM             AITAAIERPGLPLPQIIETVMTGYADRPALAQRSVEFVTDAGTGHTTLRLLPHFETISYG
CAR_MYCTU             AITQAIDQPGVALPQLIRMVMEGYADRPALGQRALRFVTDPDSGRTMVELLPRFETITYR
B2HE95_MYCMM          AVGIAISKSGLGLPQIIQTVMDGYPQRPALGQRATRVVTDPNTGRSSAQLLAEFETITYR
F5YUX6_MYCSD          AVADAIAQPGLALPQLVRDALAGYADRPALGQRAVDFVTDPATGRTIAQLQARYDTISYG
Q9CCT4_MYCLE          AVAAALAQPGLRLPQIIQTALDGYAERPALGQRVAEFTKDPKTGRTSMELLPSFETITYR
A0QWI7_MYCS2          AISAAAADPELRLPAAVKQILAGYADRPALGKRAVEFVTD-EEGRTTAKLLPRFDTITYR
W9B0J1_9MYCO          EVIAAVDDPGLRLPAVVKTVLQGYGDRPALGQRAVEFVTDPATGRTTAALLPRFETISHK
A1UFA8_MYCSK          RISDAVDRDDTRLTAIVSAVMSGYADRPALGQRAAEFVTDPQTGRTTMELLPRFDTITYR
A1T887_MYCVP          AISHAIDQPGTHLPVIVQTVLDGYAERPALGQRAVRFVTDPATGRTTTELLPRFETITYA
A0A448GMC3_MYCCH      AVARAVNAPGLTLSQVIRTVLDNYADRPALGYRAVEFAADPASARTVARLLPRFDTITYR
K0EPZ9_9NOCA          AVNARIQDPAVGLAELIRIVFAAYGDRPAVGARATRLVADPVTGRTTLHVLPEYETMTYA
A0A2G5PCS5_9MYCO      ETVEAVVAAGGGLGEVIATVFDGYRNRIAVGERAVELVTDPDTGRRAGVPAGHFRTLTYG
A0A5S9NMT1_MYCVN      DVCAAILSPDVGWVGIMRLIAEGYADRPALGQRATEIVDV--DGRPAVGVLERYDTVTYG
A0A378YSF8_9NOCA      AVSEAVRRVEVRLARIVDAVMSGYGDRAALAWRRSE-LVDGA-----VRLLPEYSTMTYR
Q5YY80_NOCFA          AISTALREPGLRLRELVATVVDGYRDRPALAARSVQPAVDAATGACVARLLPEYTTMSYG
U5ELY0_NOCAS          EAHARVTTPGTPLARIVSTVMTAYADRPALGVRRTELVVEAGRAT--RRLLPEFELLTYG
H6R914_NOCCG          AVLDAVRTPGIGVAQIVTSVLTGYAERPALGQRAFEIVSDPVTGRPERRWLDHFDTLTYG
CAR_NOCIO             AVSAAVSAPGMRLAQIAATVMAGYADRPAAGQRAFELNTDDATGRTSLRLLPRFETITYR
D6ZDT1_SEGRD          EVVAAVSDPTLSFTRYLDTLMRGYADRPALAHRVGD----------------GYATISYG
CAR_SEGRC             AVAERATQQGLRLAQRIEAFLSGYGDRPALAQRAFEITKDPITGRAVATLLPKFETVSYR
A0A2P7PL49_9ACTN      SVVDAVRRADGSLIGTISAAMSGYADRPALGRRAERIVEDPDTGRRTTELLPHFETVTYA
A0A1T3NUL4_9ACTN      SVADAIAGCDGSLVATIAAAMHGYADRPALARRAERLVRDPDTGRSTLELLPEFEYFGYA
A0R484_MYCS2          AVVDAAHKPGLRLAEILQTLFTGYGDRPALGYRARELATD-EGGRTVTRLLPRFDTLTYA
A0A372PB04_9ACTN      EVFESAAEPGLRLAEIVKRTLTGYGDRPALAERAKQFVS--VAGRTELRRLPRFDTVSYG
A0A3D9TUD1_9NOCA      AVTAAAAAIEPNLTRMVAAIMEGYADRPALGRRAREVVQR--NGRSEISLLPSMESITYG
D5UWX9_TSUPD          -------QQTERLPQVIARIFAQFADRPAFATREAGPGTP-------------YATVSYR
                                             : :* * . *                       . : 

CAR_MYCMM             ELWDRISALADVLSTEQTVK----PGDRVCLLGFNSVDYATIDMTLARLGAVAVPLQTSA
CAR_MYCTU             ELWARAGTLATALSAEPAIR----PGDRVCVLGFNSVDYTTIDIALIRLGAVSVPLQTSA
B2HE95_MYCMM          ELWNRTNALTNAFAAEALAD----RGQRVCVLGFASIDYATIDLALMLLGAVSVPLPTNA
F5YUX6_MYCSD          ELAERIRALSAALVAAAVR-----PGDRVAVLGFTSVDYTVIDMALGQIHAVAVPLQTSA
Q9CCT4_MYCLE          QLGDRVGALARAWRHDLLH-----AGYRVCVLGFNSVDYAIIDMALGVIGAVAVPLQTSA
A0QWI7_MYCS2          QLAGRIQAVTNAWHNHPVN-----AGDRVAILGFTSVDYTTIDIALLELGAVSVPLQTSA
W9B0J1_9MYCO          QLWDRVQAIANAWHDHPVR-----IGDRVAILGFTSVDYTTVDTALTQLGAVSVPLQTSA
A1UFA8_MYCSK          ELLDRVRALTNAWHADGVR-----PGDRVAILGFTGIDYTVVDLALIQLGAVAVPLQTSA
A1T887_MYCVP          ELSRRIHAVTAALTD--VH-----PGDRVAVLGFTSIDYTTVDMALAMLGAVAVPLQTSA
A0A448GMC3_MYCCH      ELGERIDATTAALGHDGLR-----PGERVAILGFSSVDYTTIDIAAFNLGAVSVPLQTSA
K0EPZ9_9NOCA          ELGQQVAAVAAGLRGEAADGGWVRPGEHVAMLGFTSVEYTVLDLAATLAGAVAVPMQSNA
A0A2G5PCS5_9MYCO      ELWDRVRAAAAGLADTVAV------GDRVATLGFTSVDYATVDLAVTQLAAVSVPLQASA
A0A5S9NMT1_MYCVN      ELWERVTAVAAVFAAAGVQ-----PGDRIATLGFCSVDYTTVDMAVPLLAGVSVPLHAGA
A0A378YSF8_9NOCA      ELWRRAGAVAAEWGADAESP--VRAGDFVCTLGFTSPDYTVVDLALVRLAAVAVPLQASA
Q5YY80_NOCFA          ELGLRLRAVAAAWQHDDETR--LRPGEFVATLGFTSPDYAVVDLACVWAGAVAVPLQASA
U5ELY0_NOCAS          EVWERARALAASWYAEG-----LAAGEFVATLGFTGADYTVLDLATIHLGAVAVPLQAGA
H6R914_NOCCG          EVADRIEAVAAAWAQAG-----VEPGAMIGLLGVTGVELTITDLACARLGAVVVPLQAGA
CAR_NOCIO             ELWQRVGEVAAAWHHDPENP--LRAGDFVALLGFTSIDYATLDLADIHLGAVTVPLQASA
D6ZDT1_SEGRD          ELWSRVGAIAAAWSADGLEP-----GDFVATIGFTSPDYTALDLAATRSGLVSVPLQAGA
CAR_SEGRC             ELLERSHAIASELANHAEAP--VKAGEFIATIGFTSTDYTSLDIAGVLLGLTSVPLQTGA
A0A2P7PL49_9ACTN      ELWREAGSLAAAWADPASGG--LNAGDFIGVLGFTSTDYATIDLACMYLGAVSVPLPTGW
A0A1T3NUL4_9ACTN      EVWRRVVALAGAWAESVEGG--LRMGDFVAVVGFTGVDHATIDLACMYLGAVAVPLPTGS
A0R484_MYCS2          QVWSRVQAVAAALRHNFAQP--IYPGDAVATIGFASPDYLTLDLVCAYLGLVSVPLQHNA
A0A372PB04_9ACTN      ELWSRLSAVAADWYHHGEHP--LRAGDFVAILGFAGVDYTTVDLACGQVGAVAVPLHNTA
A0A3D9TUD1_9NOCA      EAWDRAGALAAELSSGDTGV---NAGDVIATLGFAGIDYVVTELATLRLGAVAVPLQAGA
D5UWX9_TSUPD          EIWRRVTALVASWQSEVAP------GDFVAILGFTSSDFVTVDLATTLLGAPNVPLQAGA
                      :   .                    *  :  :*. . :    : .        **:    

CAR_MYCMM             AITQLQPIVAETQPTMIAASVDALADATELALSGQTATRVLVFDHHRQVDAHRAAVESAR
CAR_MYCTU             PVTGLRPIVTETEPTMIATSIDNLGDAVEV-LAGHAPARLVVFDYHGKVDTHREAVEAAR
B2HE95_MYCMM          ARAQLCHIVSETQPSLIASSTENLPDAISLVLSHRAPHRVVVFDYRPELDAHREALEAAR
F5YUX6_MYCSD          AVSTLTPIVAETEPRVIAASIDSLADAVELVRSGPAPTRLMVFDYHEQVDDHRDALADAR
Q9CCT4_MYCLE          AITQLQSIVTETEPSMIATSVNQLPDTVELILSGQAPAKLVVFDYHPEVDEQHDAVATAR
A0QWI7_MYCS2          PVAQLQPIVAETEPKVIASSVDFLADAVALVESGPAPSRLVVFDYSHEVDDQREAFEAAK
W9B0J1_9MYCO          TVAALQPIVAETEPVLIATSIDYLDDAVALAESA-QTAHLVVFDYHPEVDDQREAVAAAQ
A1UFA8_MYCSK          AVEALRPIVAETEPMLIATGVDHVDAAAELALTGHRPSRVVVFDHREQVDDERDAVRAAT
A1T887_MYCVP          PATTVRPIVAETEPVVIASSVDALTDAVGLALDAPTVTRLVVFDHRAGVDDHRDALISAS
A0A448GMC3_MYCCH      PPSQLRPMTAETEPAVIAASVDFLDDALELIRTGHAPRRLVVFDFHPEIDDHRDALAAAT
K0EPZ9_9NOCA          PAAQLRPILAETQPRVLAAGVDQLAEALDLADGEHRPGLIVVLDHRAEVDAHREAYEAAA
A0A2G5PCS5_9MYCO      TAAALAPIIAETEPTVLAAGVDELPHAVELVRSGPAPQRLVVFDLVDGDDVHADALAATR
A0A5S9NMT1_MYCVN      PAGQLLPMVQETRPTVIACSAEYLEVGVVLAEAV-GPALMVVFDHHPELDAHRVALRTAQ
A0A378YSF8_9NOCA      SVAQWRSIMAETEPRMLATSAETLPAAVEAVLGGFAPRRVLVFDYRPELEAHRSAVDSAR
Q5YY80_NOCFA          SVTQLTAILAETAPAILATGLDTLPHAVDCVLAGATPRALHVFDFDPAIDAQRTVYEAAC
U5ELY0_NOCAS          SATQLRSILDETAPRVLAVDTANLAVALDVVLAGAAPRALVVFDHHADDDNDREVLAAAR
H6R914_NOCCG          PSAALVQIAVETEPRILVATPELLDRAVDCALACPATRRLIVIDHVPDLDAHRAALTAAR
CAR_NOCIO             AVSQLIAILTETSPRLLASTPEHLDAAVECLLAGTTPERLVVFDYHPEDDDQRAAFESAR
D6ZDT1_SEGRD          SVAQLSAILEETAPKVFAASAESLEGAVDCVLRTPSVQRLVIFDLRDDSPEHRAALAAAK
CAR_SEGRC             TTDTLKAIAEETAPAVFGASVEHLDNAVTTALATPSVRRLLVFDYRQGVDEDREAVEAAR
A0A2P7PL49_9ACTN      SAARLAPILTETEPRILATDLGSVDAAVDAVLATESIERLVVFDYDPRVDDHREALQTAV
A0A1T3NUL4_9ACTN      PAARLAPIVAETAPRILATDLDAIDVAVETVLRSASIERVVVFDHDARVDAHRGVLRAAA
A0R484_MYCS2          PVSRLAPILAEVEPRILTVSAEYLDLAVESVRDVNSVSQLVVFDHHPEVDDHRDALARAR
A0A372PB04_9ACTN      TVAHIRHLVGEAAPRVFATSAERLGTVLEALAGETSVVRLIVFDHCPQLAEHRESVADAR
A0A3D9TUD1_9NOCA      SARALTDIARETQPTVIAADGDNLAVAVEVAGQCRTVRAILVLDHDGRGDVDVDRITSAR
D5UWX9_TSUPD          PAARIATILDETRPKILAVSADQVDLAQEALAESAATPRVVVFDGERDGYEGIEADILSG
                      .      :  *. * ::      :               : ::*              : 

CAR_MYCMM             ERLAG---------SAVVETLAEAIARGDVPRGASAGSAPGTD--VSDDSLALLIYTSGS
CAR_MYCTU             ARLAG---------SVTIDTLAELIERG-----RALPATPIAD--SADDALALLIYTSGS
B2HE95_MYCMM          ARLAA--------IPVTVETLTAIIARG---RTVRPAEADCGA--QSADAPALLIYTSGS
F5YUX6_MYCSD          AKLAG--------AEVVVEPLADLLTRG---RTLSPAGLPAHDAGQDTDPLALLVYTSGS
Q9CCT4_MYCLE          ARLAD--------SSVVVESLTEVLGRG---KTLPATPIPVAD--DSADPLALLIYTSGS
A0QWI7_MYCS2          GKLA-------GT-GVVVETITDALDRG------RSLADAPLYVPDEADPLTLLIYTSGS
W9B0J1_9MYCO          ARL--------GS-GVSVEPLADVLERG------AALPDIEGVVGPDDDPLALLIYTSGS
A1UFA8_MYCSK          ARL--------GD-AVPVETLAEVLRRG------AHLPAVAPHVFDEADPLRLLIYTSGS
A1T887_MYCVP          DRLRAA-----NS-PIEVETITDIVARG------SKLPVRAQFS-ADGDALSLLIYTSGS
A0A448GMC3_MYCCH      TGLA-------DT-AMTVETLDSLLTRG------RTLPAPTGYRDRDDD-LALLIYTSGS
K0EPZ9_9NOCA          ARLAG--------TGVALKTLAELADSG--------KAGVVVPDAADSERIVLLIYTSGS
A0A2G5PCS5_9MYCO      AALAD--------SGVVVETLAELCERG------ATVAAAIPRRHPEPDPLTTLIYTSGS
A0A5S9NMT1_MYCVN      SRLGA------SAQPVVVETLAQTIERG------RTLPVPPDPE-SDPDRLAAIVYTSGS
A0A378YSF8_9NOCA      ERL--------AEVGCRVATVADAVDRG-----ASLPAPLCIP-S-DRDRLALLIYTSGS
Q5YY80_NOCFA          ARL--------AGTGVRVRTLAEVEDRG-----RALPPAVIDDGP-GDDRLALLIYTSGS
U5ELY0_NOCAS          ARLRA------ANSPIVLSTVAEVIDRGR----LADPAPLVVPAP-QDDPLAMLIYTSGS
H6R914_NOCCG          ERL--------AGAPITVETLAEMIDAGR----DMPRAAPYFADP-DADPLAMLIYTSGS
CAR_NOCIO             RRLAD------AGSLVIVETLDAVRARGR----DLPAAPLFVPDT-DDDPLALLIYTSGS
D6ZDT1_SEGRD          AKLAQPQNPEQARGPVAVETLDELVARGA----ALPEPPVFEPAE-GEDPLALLIYTSGS
CAR_SEGRC             SRLAE------AGSAVLVDTLDEVIARGR----ALPRVALPPATDAGDDSLSLLIYTSGS
A0A2P7PL49_9ACTN      GKLDG---------RAPVVPLQEELSRGR----RLPALEPRDDGD--PDRLVGLIYTSGS
A0A1T3NUL4_9ACTN      DKLAG---------RAAVVSLAEELRRGE----GLPTVPARDDGD--PDRLVGLIYTSGS
A0R484_MYCS2          EQLAG--------KGIAVTTLDAIADEGA----GLPAEPIYTADH--DQRLAMILYTSGS
A0A372PB04_9ACTN      RLLAE------TASPISLELLSRVIERGS----ALPPAPDLPPVDDAGEVLSSLIYTSGS
A0A3D9TUD1_9NOCA      ESAAP--------LSIVVEPVSETISRGR------SRTPYPLVESRDPDRLATLIYTSGS
D5UWX9_TSUPD          SALPA------------PEFFAPE----------P-----------GTDPLVTLIYTSGS
                                          .                           :    ::*****

CAR_MYCMM             TGAPKGAMYPRRNVATFWRKRT-WFEGG------YEPSITLNFMPMSHVMGRQILYGTLC
CAR_MYCTU             TGAPKGAMYRESQVMSFWRKSSGWFEPS------GYPSITLNFMPMSHVGGRQVLYGTLS
B2HE95_MYCMM          TGAPKGVVYTRNRVADFWRTSKAEVEATE---QRTAPSITLNFMPMSHANGRQVLYGTLS
F5YUX6_MYCSD          TGAPKGAMYPQRNVARMWVRSAKNWFGP------TAASITLNFMPMSHIMGRGILYGTLG
Q9CCT4_MYCLE          TGAPKGAMYLQSNVGKMWRRSDGNWFGP------TAASITLNFMPMSHVMGRGILYGTLG
A0QWI7_MYCS2          TGTPKGAMYPESKTATMWQAGSKARWDET---LGVMPSITLNFMPMSHVMGRGILCSTLA
W9B0J1_9MYCO          TGAPKGAMYLESKVTNIWRPAANAHWDDS---QGKVPSIVLSFMPMSHVMGRGILYGALA
A1UFA8_MYCSK          AGAPKGAMYPESKVAGMWRASAKAAWNND---QTAIPSITLNFLPMSHVMGRGLLCGTLS
A1T887_MYCVP          TGAPKGAMYPQHLVANSWRRLARSFWGD----LGVFPAITLNFMPMSHVMGRGLLYGTLD
A0A448GMC3_MYCCH      TGAPKGAMYQRRMVTNMWRRATTAIWGG----KEAAPWLTLNFMPMSHVMGRGILSTTLC
K0EPZ9_9NOCA          TGTPKGAMYSERLVANLWQGKFGLGEGP----YAAGPWITLNFMPMSHLMGRYTLYGTLA
A0A2G5PCS5_9MYCO      TGAPKGAMYPQSKTLGSWRAHNPWGGPPS---RQPLPAIVLSFLPMSHLMGRSVPYTTLG
A0A5S9NMT1_MYCVN      SGSPKGAMQPESLTQAIWTLTAGILAER----GFALPAITLNYLPMSHTAGRAMLYSTLG
A0A378YSF8_9NOCA      TGAPKGAMYTDRLAAGLWLSAND----------IRVPALTMNYMPLSHVAGRMSLYGTLM
Q5YY80_NOCFA          TGTPKGAMYTERLVALMWLGQP------------QVAALTVNYLPLSHVAGRLALFGLLA
U5ELY0_NOCAS          TGTPKGAMYTDRLVAAGWQPAR------------PVAVLNVNFLPMSHIAARLTLNGVLA
H6R914_NOCCG          TGTPKGAMYTDRLAAGIWVQGLAR------KPGSNPPAISVNYMPLSHLAGRLALAGVLV
CAR_NOCIO             TGTPKGAMYTNRLAATMWQGNSML------QGNSQRVGINLNYMPMSHIAGRISLFGVLA
D6ZDT1_SEGRD          TGTPKGAMYSQRLVSRFWPRT---------PVVAQLPSISLHYMPLSHSYGRAVLCGTLA
CAR_SEGRC             TGTPKGAMYPERNVAQFWGGIWHNAFDDG-DSAPDVPDIMVNFMPLSHVAGRIGLMGTLS
A0A2P7PL49_9ACTN      TGAPKGAMYTASMITRMWQNSRTGTPNAAPGSDRPVPTIVLHYMPMSHVNGRARLISGLA
A0A1T3NUL4_9ACTN      TGTPKGAIYTASMITRMWQNGRGGMTNAGASPDTPLPTIVLHYMPMSHVNGRAWLISGLS
A0R484_MYCS2          TGAPKGAMYTEAMVARLWTMSF--------ITGDPTPVINVNFMPLNHLGGRIPISTAVQ
A0A372PB04_9ACTN      TGTPKGVIFPESTVSLMWRPPEQ-----------RHPMITANFLPQSHLVARRLVIKTLA
A0A3D9TUD1_9NOCA      TGTPKGAIHTERIVAGSWTGTWNPTESTD--STPGFPVITLDYLPMSHLAGRGLVFMTLA
D5UWX9_TSUPD          TGTPKGAMYTEQLVRDAWLKVDSIVDID------MPAESLLHFLPMSHMYGRNWLIAGLA
                      :*:***.:         *                        ::* .*  .*      : 

CAR_MYCMM             NGGTAYFVAKSDLSTLFEDLALVRPTELTFVPRVWDMVFDEFQSEVDRRLVDG----ADR
CAR_MYCTU             NGGTAYFVAKSDLSTLFEDLALVRPTELCFVPRIWDMVFAEFHSEVDRRLVDG----ADR
B2HE95_MYCMM          NGGTAYFTARSDLSTLFDDLALVRPTELGFPPRIWDMLLERFGREVDRRLRDGTAEGADP
F5YUX6_MYCSD          NGGTAYFSARSDLSTFLEDLALVRPTELNFVPRIWEMLYQHFQSEVNGITG------ADR
Q9CCT4_MYCLE          NGGTAYFAARSDLSTLLEDLKLVRPTELNFVPRIWETLYDESKRAVDRRLANSGS--ADR
A0QWI7_MYCS2          SGGTAYFAARSDLSTFLEDLALVRPTQLNFVPRIWDMLFQEYQSRLDNRRAEG-----SE
W9B0J1_9MYCO          SGGTVNFAARADLSTFLDDLALTRPTQLNFVPRIWDMLFQEFQSRT------------SH
A1UFA8_MYCSK          TGGTAYFAARSDLSTLLEDLRLVRPTQLSFVPRIWDMLFQEFVGEVDRRVNDGA----DR
A1T887_MYCVP          AGGTAYFAARSDLSTFLEDLALVRPTQLSFVPRIWDTIHAEVSQELE-----------RR
A0A448GMC3_MYCCH      SGGTAYFAARSDLSTLLEDLALVRPTQLTFVPRIWEMIFQEYQRDVAR------------
K0EPZ9_9NOCA          RGGIAYFAASSDLSTFLEDLALVRPTQLQFVPRVWDLLYQEYQRALDGIGTD------ER
A0A2G5PCS5_9MYCO      AGGAAYFTARADLSTLVEDLSLTRPTQLNLVPRIWDMLHQEYCAQRDQAGELS-------
A0A5S9NMT1_MYCVN      AGGVASFASKSDMSTILDDLALVRPTQLNFVPRVWEMLYRQFLGECRRS---------GS
A0A378YSF8_9NOCA      RGGTAYFAAASDMSTLLDDFGLARPTELFLVPRVCELLHQRYQSELDRRVLAGDDAETAA
Q5YY80_NOCFA          RGGTAYFTARADMSTLFEDLALARPTELFVVPRVCEMVLQRFQTERLRRQADDDR-----
U5ELY0_NOCAS          RGGTAYFTAAADMSTLFEDIALVRPTEIFLVPRVCDMLLHRFRREVDRRADAGVDPEVLA
H6R914_NOCCG          RGGIAYFTAAADMSTLFEDIALVRPTEMVFVPRVSDMIYQRYQSELAGGRS--------E
CAR_NOCIO             RGGTAYFAAKSDMSTLFEDIGLVRPTEIFFVPRVCDMVFQRYQSELDRRSVAGADLDTLD
D6ZDT1_SEGRD          AGGTAHFTAHSDLSTLFEDIALARPTFLALVPRVCEMLLHESRRARDL------------
CAR_SEGRC             SGGTTYFIAKSDLSTFFEDYSLARPTKLFFVPRICEMIYQHYQSELDRIGAADGSPQAEA
A0A2P7PL49_9ACTN      SGGTGFFTARSDMSTLFDDIGLARPTVLSLVPRICDMVHQQYLLEADRLSRTGTPRPARA
A0A1T3NUL4_9ACTN      SGGIGFFAARGDMSTLFDDIRLSRPTVLSLVPRICDMVHQRYLLEVDRVTRAATEAGADI
A0R484_MYCS2          NGGTSYFVPESDMSTLFEDLALVRPTELGLVPRVADMLYQHHLATVDRLVTQGADELTAE
A0A372PB04_9ACTN      LGGTAYFVADSNLSTLLEDLALIRPTEFAMVPRVCELLHQSYLSLLDQWNAE--------
A0A3D9TUD1_9NOCA      AGGTVNFAGKSDLSTLFEDFSLARPTLALLVPRVCEMIRHTAIAEIDQRLSAETDPDSVR
D5UWX9_TSUPD          SGGTGYFAGASDMSTLFDDLAAARPTAIGLVPRVCELIHQRYLAVEADTDAE--------
                       **   *   .::**:.:*    ***   . **: : :                      

CAR_MYCMM             V--ALEAQVKAEIRNDVLGGRYTSALTGSAPISDEMKAWVEELL-DMHLVEGYGSTEAG-
CAR_MYCTU             A--ALEAQVKAELRENVLGGRFVMALTGSAPISAEMTAWVESLLADVHLVEGYGSTEAG-
B2HE95_MYCMM          G--ALKARVAADLRQVLLGGRYALAMMGSAPISEQMKASVESLL-DLDVMEGYGSTEAG-
F5YUX6_MYCSD          A--AAEAQVLAEMRRDLLGGRCIFAMTGSAPISDELRSWVSELT-GLHLLNGYGSTEAG-
Q9CCT4_MYCLE          A--AIKAEVMDEQRQSLLGGRYIAAMTGSAPTSPELKHGVESLL-EMHLLEGYGSTEAG-
A0QWI7_MYCS2          D--RAEAAVLEEVRTQLLGGRFVSALTGSAPISAEMKSWVEDLL-DMHLLEGYGSTEAG-
W9B0J1_9MYCO          G--ADEDTVLADMRENLLGGRYVSALTGSAPISPELKAWVERLL-EQHLLEGYGSTEAG-
A1UFA8_MYCSK          P--TAEADVLAVQRHELLGGRFVTAMTGSAPISLEMKTWVETLL-DMHLVEGYGSTEAG-
A1T887_MYCVP          P--SDATEVIADLRRSLLGGRYVTAMTGSAPLSPEMRAFVENLL-DVHLIDGYGSTEAG-
A0A448GMC3_MYCCH      ---RPEAEVLADLREHRLGGRFLAAMTGSAPMSPEMTAFAESVL-DLHLVDGYGSTEAG-
K0EPZ9_9NOCA          S--ERAPELLAELRRDLLGGRALGAVTGSAPISVEVREFVDALL-GFHLPDGYGSTEAG-
A0A2G5PCS5_9MYCO      E--QAEAELMAAERTRMVGDRVVLAMTGSAPISPELRGWAEQFL-DLPLLEGYGSTEAG-
A0A5S9NMT1_MYCVN      E--VAEEDVLADLRTRVLGGRYVTALTGSAPIAADLAAWVETLL-GSHLMNAFGATETG-
A0A378YSF8_9NOCA      T------DVKAELRERVLGGRYLTALSGSAPLAAEMKTFMESLL-DDELHDGYGSTEAGG
Q5YY80_NOCFA          --------VKADLRLELFGDRLLSVVCGSAPLAPELKAFMESVL-DLTLHDGYGSTEAGG
U5ELY0_NOCAS          E------EVRGELRERVLGGRLLTVLCGSAPIAPELRRFVESVL-RLRLHDGYGSTETGG
H6R914_NOCCG          E------QVREQLRGEVLGGRLISASTGSAPLAPELKAFMESLL-GIEVHDAYGSTEAGG
CAR_NOCIO             R------EVKADLRQNYLGGRFLVAVVGSAPLAAEMKTFMESVL-DLPLHDGYGSTEAGA
D6ZDT1_SEGRD          ----------AELRERVLGERLLVAVCGSAPLAPETRAFMEELL-GFPLLDGYGSTEAL-
CAR_SEGRC             I--------KTELREKLLGGRVLTAGSGSAPMSPELTAFIESVL-QVHLVDGYGSTEAG-
A0A2P7PL49_9ACTN      E---AEAAALTRVRDDMLGGRIVSALCGSAPLSSQMHTFMAEVL-GTKVIDCYGSTETTR
A0A1T3NUL4_9ACTN      DVSTAEETARDRIRDGMLGGRIVSALCGSAPLSAAMHTFMARVL-GTRIVDCYGSTETTR
A0R484_MYCS2          K------QAGAELREQVLGGRVITGFVSTAPLAAEMRAFLDITL-GAHIVDGYGLTETG-
A0A372PB04_9ACTN      -------ELRRHFRDVVLGGRVIHTPCGSAPLAPELAAFVESCL-DVPFFDSYGTTETG-
A0A3D9TUD1_9NOCA      D------EVLTHFRNHTFGGRILAAVVGTAPIADEVKNFVSELL-DVGVQDNYGSTEAG-
D5UWX9_TSUPD          -------TARVELRDRVLGGRLQAAMCGSAALSSELQTFMEWLL-GIDIQIGYGSTEAG-
                                   *   .* *      .:*. :               .   :* **:  

CAR_MYCMM             MILIDGAIRRPAVLDYKLVDVPDLGYFLTDRPHPRGELLVKTDSLFPGYYQRAEVTADVF
CAR_MYCTU             MVLNDGMVRRPAVIDYKLVDVPELGYFGTDQPYPRGELLVKTQTMFPGYYQRPDVTAEVF
B2HE95_MYCMM          TVIINNEVQRPQVIDYKLVDVAELGYFLTDRPYPRGELLVKTRTLFSGYYRDPEDGAQVF
F5YUX6_MYCSD          MVLFDGVVQRPPVLDYKLVDVPELGYFGTDKPHPRGELLLKTENLFPGYYQRPEITAEVF
Q9CCT4_MYCLE          MVLFDGEVQRPPVIDYKLVDVPDLGYFSTDQPYPRGELLLKTQNMFPGYYKRPEVTATVF
A0QWI7_MYCS2          AVFIDGQIQRPPVIDYKLVDVPDLGYFATDRPYPRGELLVKSEQMFPGYYKRPEITAEMF
W9B0J1_9MYCO          SVFVDGRITRPPVLEYKLVDVPELGYRLTDVPHPRGELLVKSTQLFPGYYKRPEITAQMF
A1UFA8_MYCSK          AVFVDGHIQRPPVLDYKLVDVPDLGYFSTDRPHPRGELLVRSTQLFPGYYKRPDVTAEVF
A1T887_MYCVP          AVFVDGRVQRPPVIDYKLVDVADLGYFSTDRPHPRGELLVKSETLFPGYYKRPDVTAEMF
A0A448GMC3_MYCCH      SIVLDGQVLRPPVLDYKLVDVPELGYFSTDRPYPRGELLVKTELMFPGYYKRPDITAEVF
K0EPZ9_9NOCA          GITVDGKVARPPVLDYKLADVPELGYYSTDRPHPRGELLVKTQNIFPGYYRRPEVTAEVF
A0A2G5PCS5_9MYCO      AVLINGVPCNPPVTDYKLVDVPELGYLLSDRPHPRGELLIKSDTMFPGYYKRPDVTASMF
A0A5S9NMT1_MYCVN      SLIIDGRIQRPPVSDYKLVDVPELGYFKTDKPYPRGELLVKSHTLFRGYYKREALTAEVF
A0A378YSF8_9NOCA      SVLLDNRIKRPPVLDYRLVDVPELGYFRTDKPHPRGELLLKTESMFPGYYKRPEITAEMF
Q5YY80_NOCFA          SVVIDTTVRRPPVLDYRLADVPELGYFRTDKPHPRGELLLKTTTMIPGYYRRPELNAQIF
U5ELY0_NOCAS          GVIFDTKVMRPPVLDYKLVDVPELGYFSTDKPYPRGELLLKTTTMISGYYRRPEVTAQVF
H6R914_NOCCG          GLVVDNRVRRPVVIDYKLVDVPELGYQTTDEPHPRGELLLKTATMIPGYYRRPDITAQVF
CAR_NOCIO             SVLLDNQIQRPPVLDYKLVDVPELGYFRTDRPHPRGELLLKAETTIPGYYKRPEVTAEIF
D6ZDT1_SEGRD          SLMRDGVIQRPPVIDYKLVDVPELGYFTTDKPHPRGELLIRSESLVSGYYKRPELTAEMF
CAR_SEGRC             PVWRDRKLVKPPVTEHKLIDVPELGYFSTDSPYPRGELAIKTQTILPGYYKRPETTAEVF
A0A2P7PL49_9ACTN      PVVVDQQVRRPPVIDYRLVDVPELGYFATDKPHPRGELRLKSVGLVQGYYKQPEVTARAF
A0A1T3NUL4_9ACTN      AVVVDGRVRRPPVLDYRLVDVPELGYFGTDKPHPRGELRLKSVGLVPGYYRQPEVDARTF
A0R484_MYCS2          AVTRDGVIVRPPVIDYKLIDVPELGYFSTDKPYPRGELLVRSQTLTPGYYKRPEVTASVF
A0A372PB04_9ACTN      LVMLDHRVQRAFVLDYKLVDVPELGYYTTDTPYPRGELLVRTKLITPGYYRRPDVTAEAF
A0A3D9TUD1_9NOCA      MVLRDGIVKRPPVIDYRLDDVPELGYFTTDKPHPRGELLLKTSSIIPGYYKRPDVTADMF
D5UWX9_TSUPD          GVIRDGVVVRPPVTEYKLIDVPELGYFVTDSPHPRGELLVKSTQLIPGYYNSDK---RIR
                       :  :    .. * :::* **.:***  :* *:***** :::     ***.         

CAR_MYCMM             DADGFYRTGDIMAEVGPEQFVYLDRRNNVLKLSQGEFVTVSKLEAVFGDSPLVRQIYIYG
CAR_MYCTU             DPDGFYRTGDIMAKVGPDQFVYLDRRNNVLKLSQGEFIAVSKLEAVFGDSPLVRQIFIYG
B2HE95_MYCMM          DPDGFYRTGDIMAQVGPDRLAYLDRRNNVLKLSQGEFVAVSRLEAIFANSPLVRQIFVYA
F5YUX6_MYCSD          DADGYYRTGDVVAEIGPDQLVYVDRRNNVLKLAQGEFVTLAKLEAEFGNSPLVRQIYVYG
Q9CCT4_MYCLE          DSDGYYQTGDIVAEVGPDRLVYVDRRNNVLKLAQGQFVTVAKLEAAFSNSPLVRQIYIYG
A0QWI7_MYCS2          DEDGYYRTGDIVAELGPDHLEYLDRRNNVLKLSQGEFVTVSKLEAVFGDSPLVRQIYVYG
W9B0J1_9MYCO          DEDGFYRTGDIVAELGPDEVRYVDRRNNVLKLAQGEFVTVSKLEAAFTNSPLIRQIYIYG
A1UFA8_MYCSK          DDDGFYRTGDIVAEVGPDQVQYLDRRNNVLKLAQGEFVTISKLEAVFAGSALVRQIYVYG
A1T887_MYCVP          DEDGYYRTGDIVAETGADQLTYLDRRNNVLKLSQGEFVTVSRLEAVFGNSPLVRQIYVYG
A0A448GMC3_MYCCH      DEDGYYRTGDIVAELGPDRLAYVDRRNNVLKLSQGEFVTVSKLEAAFAASPLVRQIYIYG
K0EPZ9_9NOCA          DPDGYYRTGDIVAEVQPDELRYLDRRNNVLKLSQGEFVTVSKLEAAFGASPLIQQIYIYG
A0A2G5PCS5_9MYCO      DADGFYRTGDIFAEVD-GRLRYLDRRNNVLKLSQGEFVTVSKLEAAYLTSPLIHQIYLYG
A0A5S9NMT1_MYCVN      DEDGFYRTGDIVTELGPDDVHYVDRRNNVLKLSQGEFVAVSKLESLYVNCPPVEQIYVYG
A0A378YSF8_9NOCA      DADGFYRTGDVVAELGPDQLVYVDRRNNVLKLSQGEFVTVAALEAVYATSPLIRQIFVYG
Q5YY80_NOCFA          DEDGFYRTGDVVAELAPDRLVYVDRRNNVLKLAQGEFVTIARLEAIFANSPLVRQIFVYG
U5ELY0_NOCAS          DEDGFCRTGDVVAELGPDRVAYVDRRNNVLKLSQGEFVTVSRLEAVFAGADLVRQIYVYG
H6R914_NOCCG          DGEGFYRTGDIVAEIGPDQLRYLDRRNNVLKLSQGEFVAVAQLEAVYAASPLIRQIFVYG
CAR_NOCIO             DEDGFYKTGDIVAELEHDRLVYVDRRNNVLKLSQGEFVTVAHLEAVFASSPLIRQIFIYG
D6ZDT1_SEGRD          DEQGYYKTGDVMAEIAPDRLVYVDRSKNVLKLSQGEFVAVAKLEAAFGASPYVKQIFVYG
CAR_SEGRC             DEDGFYLTGDVVAEVAPEEFVYVDRRKNVLKLSQGEFVALSKLEAAYGTSPLVRQISVYG
A0A2P7PL49_9ACTN      DEDGYYKTGDVVAEIAPDRLVYVDRINNVVKLSQGEFVAVSRLEALYSTSPYISQIYVYG
A0A1T3NUL4_9ACTN      DADGYYRTGDVFAELAPDHLVYVDRTNNVVKLSQGEFVAISRLEALYATSPHIAQIHIYG
A0R484_MYCS2          DRDGYYHTGDVMAETAPDHLVYVDRRNNVLKLAQGEFVAVANLEAVFSGAALVRQIFVYG
A0A372PB04_9ACTN      DDDGYYRTGDIMAEVEPDRLYYLDRRKNVLKLSQGEFVALAKLEAVYVASPLLQQIFLYG
A0A3D9TUD1_9NOCA      DADGFYRTGDVVAEIAQDHLTYVDRRKNVLKLAQGEFVALARLEALFGTSELVDQIFVYG
D5UWX9_TSUPD          DDEGFYRTGDVMAELGPDRLEYVDRRSNVIKLAQGEFVPIAQLEAIYAAGPDVHQIFLYG
                      * :*:  ***:.::     . *:** .**:**:**:*:.:: **: :     : ** :*.

CAR_MYCMM             NSARAYLLAVIVPTQE--ALDA--VPVEELKARLGDSLQEVAKAAGLQSYEIPRDFIIET
CAR_MYCTU             NSARAYPLAVVVPSGD--ALSR--HGIENLKPVISESLQEVARAAGLQSYEIPRDFIIET
B2HE95_MYCMM          NGARAYPLAVVVPTQD--AQSR--HGRAELKAELHTSLHRVAMSAGLAPYEIPRDFIVET
F5YUX6_MYCSD          NSAQPYLLAVVVPTPE--ALAAL-GDTTELKKAIAESLQQVARDADLQSYEVPRDFIVET
Q9CCT4_MYCLE          NSAHPYLLAVVVPTED--ALAT--NDIEVLKPLIIDSLQKVAKEADLQSYEVPRDLIVET
A0QWI7_MYCS2          NSARSYLLAVVVPTEE--ALSRW-DGDE-LKSRISDSLQDAARAAGLQSYEIPRDFLVET
W9B0J1_9MYCO          NSARPYLLAVVVPTDP--TVSKA-D--------IAQSLKDTARAADLQSYEIPRDFLIET
A1UFA8_MYCSK          NSARSYLLAVVVPTDD--AVARH-DPAS-LKTAISASLQQAAKTAGLQSYELPRDFLVET
A1T887_MYCVP          NSARPYLLAVVVPTEA--ALAGA-DA----KAAVAESLQDVAKATGLQSYEIPRDFLLET
A0A448GMC3_MYCCH      NSAHPYLLAVVVPTED--ALTRY-DAAT-LKTAISESLQDVGRAAGLQSYEIPRDFLVET
K0EPZ9_9NOCA          NSSRPYLLAVIVPDEA--VLERVSGDIEAAGPLLTEALRAVAAEAGLQSYEIPRDFLVET
A0A2G5PCS5_9MYCO      NSARPYLLAVIVPAAE--ALAG--DDADALKRRLAESLQDVAARSELASYEIPRDFLVET
A0A5S9NMT1_MYCVN      NSERSFLLAVVVPTEE--LRNHHQDPD--VKRQILDSLRNAARDAELETYEIPRDIVVEP
A0A378YSF8_9NOCA      SSERAYLLAVVVPTDA---VLALPP--ARARAEVSESLQRIAKESGLRPYEIPRDVIIES
Q5YY80_NOCFA          NSERAYLLAVIVPSRQ---AMAGDP--ATLKTRIAESLQLIGRDAELEAYEIPRDFLIET
U5ELY0_NOCAS          SSERAYLLAVIVPTEA---ALAGPA--ASLRAELGASLQRAAVAAELEPYEIPRDFLIES
H6R914_NOCCG          SSVRAYLLAVVVPTEA---ALADAADIEALTASIAASVRTIAADAGLEPYEIPREFLIET
CAR_NOCIO             SSERSYLLAVIVPTDD---ALRGRD-TATLKSALAESIQRIAKDANLQPYEIPRDFLIET
D6ZDT1_SEGRD          NSERSFLLAVVVPNAELVGRLDTVQALAEVKPLIADSLAAIAKESGLQSYEVPRDFIVET
CAR_SEGRC             SSQRSYLLAVVVPTPEALAKYGDGE---AVKSALGDSLQKIAREEGLQSYEVPRDFIIET
A0A2P7PL49_9ACTN      SSEQAFLLAVVVADREQLALEQVDDD-AAIRAKILDSMRELARDAGLNPYEVPYDVILEP
A0A1T3NUL4_9ACTN      SPEQAFLLAVVVPAR---SGSTPADD-DTTRAGILDAMRELARDAGLAAYEIPHDVILEP
A0R484_MYCS2          NSERSFLLAVVVPTPEALEQYDPAAL----KAALADSLQRTARDAELQSYEVPADFIVET
A0A372PB04_9ACTN      NSSRPYLLAVVVPTAE---ALDQASDEAALKAAIHESLQHIAKRADLKPYEIPRDLLVET
A0A3D9TUD1_9NOCA      NSQRSYLLAVVVPPQG-----------VSEPGAVIESLQALARDEGLNSYEIPREIVLEE
D5UWX9_TSUPD          TSERSYLIGVVVPAPG-----PDGETDAQTRTRVLDGLAAIARENDLAAYEVPRDVLIER
                      .  :.: :.*:*.                    :  .:   .    * .**:* :.::* 

CAR_MYCMM             TPWTLENGLLTGIRKLARPQLKKHYGELLEQIYTDLAHGQADELRSLRQSGADAPVLVTV
CAR_MYCTU             TPFTLENGLLTGIRKLARPQLKKFYGERLERLYTELADSQSNELRELRQSGPDAPVLPTL
B2HE95_MYCMM          TPFTPQNGLLTAIHKLARPHLTQRYGARLELLYTELADSQTRRLHRLRQTGGRLPALETI
F5YUX6_MYCSD          EPFSLENGLLTGIRKLAWPKLKAHYGDRLEQRYAELAEGQANELSELLRHGAQRPALETV
Q9CCT4_MYCLE          TPFSLENGLLTGIRKLAWPKLKQHYGARLEQLYADLVEGQANALHVLKQSVANAPVLQTV
A0QWI7_MYCS2          TPFTLENGLLTGIRKLARPKLKAHYGERLEQLYTDLAEGQANELRELRRNGADRPVVETV
W9B0J1_9MYCO          TPFTVENGLLTGIRKLAWPKLKERYGAELEGLYAELADGQANELQALRQHGADAPVLQTV
A1UFA8_MYCSK          QPFTLENGLLTGIRKLARPKLKARYGDRLEALYVELVEGQAGELRTLRRDGAKRPVAETV
A1T887_MYCVP          TPFTLENGLLTGIRKLARPRLRERYGEQLEALYTMLSEEQADELRELRRSGGERPALETV
A0A448GMC3_MYCCH      TPFTLENGLLTGLRKLARPKLKEHYGERLEQLYTELADGQAEELKELRTHGAQQPTLTTV
K0EPZ9_9NOCA          TPFTVENGLLTGIRKLARPKLRQRYGELLEQLYQRLSDGQAEELRALRTGAADRPVLETV
A0A2G5PCS5_9MYCO      EPFSTDNGLLTGIRKLAWPKLKERYGDRLEQLYADLAESQAAELSRLRTTGADAPVAETV
A0A5S9NMT1_MYCVN      DPFTLDNGLLSGIRKPSRPALKAKYAPRLEQLYVELSDAHDQRLRTLSERSADSPIIDIV
A0A378YSF8_9NOCA      EPFTIDNGLLSGIGKLLRPKLKEHYGERLEQLYAELAEQREDELTALRRGAHDRPILDTV
Q5YY80_NOCFA          EPFTTESGLLSGIGKILRPAVEARYRDRLEQLYADLAAAQQDELAALRREAGQRPVLETV
U5ELY0_NOCAS          VPFSVDNGLLSGVSKLLRPALKQRYGARLDALYDEVVREQEAELERLRREAPMLPVDEVV
H6R914_NOCCG          EPFTIDNGLLSGIGKLLRPALEQRYGPRLEQLYRERADGRSAELRALHTSAGEVPVVETV
CAR_NOCIO             EPFTIANGLLSGIAKLLRPNLKERYGAQLEQMYTDLATGQADELLALRREAADLPVLETV
D6ZDT1_SEGRD          EPFTTGNGLLSEVGKLLRPKLKERYGERLEALYDQIAQGQADELRALREQAGERPVIDTV
CAR_SEGRC             DPFTIENGILSDAGKTLRPKVKARYGERLEALYAQLAETQAGELRSIRVGAGERPVIETV
A0A2P7PL49_9ACTN      QPFTIENGLLSGVGKLLRPSLKDRYGARLEQLYADIAGGRAGRIAALRAAGRAAEPLEAV
A0A1T3NUL4_9ACTN      EPFTVANGLLSGIGKPLRPALLARYGARLERLYADIAAGRAGRFAALRDAGPHAAPLDAV
A0R484_MYCS2          EPFSAANGLLSGVGKLLRPNLKDRYGQRLEQMYADIAATQANQLRELRRAAATQPVIDTL
A0A372PB04_9ACTN      VPFSQENGLLSDSTKQLRPRLKEHYGERLERRYAELAEEQIDGLRGLRHD-ENRPVVETV
A0A3D9TUD1_9NOCA      APFTQENGLLSGAGKQLRPKLVEKYGAILESRYTDLEESQTDRLRELRRRGPDAPILDTV
D5UWX9_TSUPD          DPFSQENGLRSGIGKLVRPALIARYGDRLHDLYAQADTRQRE---GLRALDASGPIIDTV
                       *::  .*: :   *   * :   *   *.  *      :      :            :

CAR_MYCMM             CRAAAALLGGSASDVQPDAHFTDLGGDSLSALSFTNLLHEIFDIEVPVGVIVSPANDLQA
CAR_MYCTU             CRAAAALLGSTAADVRPDAHFADLGGDSLSALSLANLLHEIFGVDVPVGVIVSPASDLRA
B2HE95_MYCMM          RRAAGALLGTETTEPRPEAHFKDLGGDSVSAVTFSNLLHDIYGFDVPVGVILGPATDLRA
F5YUX6_MYCSD          SRAAAALLGAAAADLHPDAHFTDLGGDSLSALTFGNLLRDIFDVDVPVGVIVSPATDLAA
Q9CCT4_MYCLE          SRAVGTILGVATTDLPSNAHFTDLGGDSLSALTFGSLLRELFDIDVPVGVIVSPVNNLVA
A0QWI7_MYCS2          SRAAVALLGASVTDLRSDAHFTDLGGDSLSALSFSNLLHEIFDVDVPVGVIVSPATDLAG
W9B0J1_9MYCO          SRAAVALLGAASSDVAPDAHFTDLGGDSLSALTFGNLLQEIFGVEVPVSVIVSPTSDLAT
A1UFA8_MYCSK          GRAAAALLGAAAADVRPDAHFTDLGGDSLSALTFGNLLQEIFGVDVPVGVIVSPAADLAS
A1T887_MYCVP          GRAAGALLGTTAGELEPSAHFTDLGGDSLSALTFANLLRDIFDVDVPVGVIVSPATDLQA
A0A448GMC3_MYCCH      SRAATALLGTASAEVRPDAHFTDLGGDSLSALTFGNLLGEIYAVEVPVGVIVSPANDLAA
K0EPZ9_9NOCA          SRVAAALLGIAAADVHPAAHFTELGGDSLSALTFGNALHDILGVEVPVGVIVSPATDLRA
A0A2G5PCS5_9MYCO      GRAAAALLGAADADIAPDAHFTDLGGDSLSALTFANLLHDIFGVDVPVGVIVSPATDLAG
A0A5S9NMT1_MYCVN      RGVAGSLLGTATDDPPASARFNDLGGDSLSALTFANALEDIFDVAVPVGVIVSPASDLHA
A0A378YSF8_9NOCA      TRAAGAVLDLAAGEVSPDAHFADLGGDSLSALSFSTLLRDIFGVEVPVGFIVGPATDLAR
Q5YY80_NOCFA          TRAAAAILGGTASDLSPAAHFTDLGGDSLAALALSNLLREIFAVEVPVGVITGPATDLRG
U5ELY0_NOCAS          ARAALAVLGCAAADLRPSARFGELGGDSLAALTYSTLLRDLLGVEVPVNVLLGPDSDLAG
H6R914_NOCCG          LRAARALLDCTAEQSTPQAHFADLGGDSLSALSLATVLTEIFGVDVPVSVVTSPATTLGD
CAR_NOCIO             SRAAKAMLGVASADMRPDAHFTDLGGDSLSALSFSNLLHEIFGVEVPVGVVVSPANELRD
D6ZDT1_SEGRD          RKAAAAVVGSSGADFRPDANFADLGGDSLSALGFANLLQDVFGVETPVRIIIGPTASLAG
CAR_SEGRC             QRAAAALLGASAAEVDPEAHFSDLGGDSLSALTYSNFLHEIFQVEVPVSVIVSAANNLRS
A0A2P7PL49_9ACTN      LAAVQITLGYPASMVVPQAAFTDLGGDSLSALTFSTVLEQIFDTEVPVQAVLSPTSTLAG
A0A1T3NUL4_9ACTN      LAAVQVTLGHPASALRPDAGFAELGGDSLSAHTFATVLEQIFDVEVPVQLVLGPTATLTR
A0R484_MYCS2          TQAAATILG-TGSEVASDAHFTDLGGDSLSALTLSNLLSDFFGFEVPVGTIVNPATNLAQ
A0A372PB04_9ACTN      GRAVRALLGASAGEPGPRTRFTDMGGDSLTALSLSNLLKEIFGTEVPVGTLLGPANSLGE
A0A3D9TUD1_9NOCA      GDSAQALLGCAGTDVSPDARFADLGGDSLSALTFSNLLRDIFDVEVPVGVVTGPSSDLRT
D5UWX9_TSUPD          LGAAALTLGADIADFDADTRFGDLGGDSLSALSLATTLEGLYDVPVPVQTIVGPTATLGG
                         .   :.       . : * ::****::*    . *  .    .**  : ..   *  

CAR_MYCMM             LADYVEAARKP---GSSRPTFASVHGASNGQVTEVHAGDLSLDKFIDAATLAEAPRLP--
CAR_MYCTU             LADHIEAART----GVRRPSFASIHGRS---ATEVHASDLTLDKFIDAATLAAAPNLP--
B2HE95_MYCMM          LASHVESRRGA---GWSGPSFASVHVPR---ATSVHAGDLKLAKFLDTKTLAAATSLP--
F5YUX6_MYCSD          IADYVETERRAAQTGSRRPSFASVHGRD---AVEVAAADLTLDKFLDEATLAAAPTLP--
Q9CCT4_MYCLE          IADYIERERQ----GTKRPTFIAIHGRD---AGKVHASDLTLDKFIDVSTLTAAPVLA--
A0QWI7_MYCS2          VAAYIEGELRG----SKRPTYASVHGRDA---TEVRARDLALGKFIDAKTLSAAPGLP--
W9B0J1_9MYCO          IAAHIETQRAGG---DKRPTFSSVHGAGA---TEVHAADLTLDKFIDAATLAAAPALP--
A1UFA8_MYCSK          IAAYIEAEQAST---GKRPTYASVHGRDA---EQVHARDLTLDKFIDAETLSAATELP--
A1T887_MYCVP          LADYVESARRHG---SVRPTFESVHGHSGRPGTEVHARDLTLDEFVDAATLAHAPTLP--
A0A448GMC3_MYCCH      IADYIDTARRPG---DGRPTFAGVHGDDA---AEVHARDLTLDRFLDDATLAAATALP--
K0EPZ9_9NOCA          LAAFLESGAQA-----TRPTFASVHGPEA---TEVRAADLTLEKFLDTATLDGAATLP--
A0A2G5PCS5_9MYCO      IAAHIEAARAGA----VRPSYDSVHGRDA---TQVRAADLTLDKFLPAELLTAAPTLP--
A0A5S9NMT1_MYCVN      IADLIRDERTSQ---SSRPTFGSVHGTDA---TEIAASDLTLDKFVETSILDGVRSLA--
A0A378YSF8_9NOCA      IAEYLVSERD---S-GSRPTAATVHG-DD---GLLRADDLALEAFLDPATLDAAAHLP--
Q5YY80_NOCFA          LAAHIAAERE---NRTETPLFDRVHP-DQ---ILIRATDLALEKFFDAEELAAAATAA--
U5ELY0_NOCAS          IAGYVRRERE---PGARRVDVETVHGVGA---TEIRASELTLAKFLDPALLDAAVGLE--
H6R914_NOCCG          LAEYIETAQQ---SGTGRVSFDSVHGAGA---DQVAAADLALEKFIDAETLAAAAGLP--
CAR_NOCIO             LANYIEAERN---SGAKRPTFTSVHG-GG---SEIRAADLTLDKFIDARTLAAADSIP--
D6ZDT1_SEGRD          IAEHIERALGGR-PGEAAPNSASVHGAGA---EVIRASDLTLDKFLDAQALEAAQSLP--
CAR_SEGRC             VAAHIEKERS---SGSDRPTFASVHGAGA---TTIRASDLKLEKFLDAQTLAAAPSLP--
A0A2P7PL49_9ACTN      IAEHLAAAPA-T-ASVPRPTFASVHGRGA---TEVKAGDLTLDRFVDEEVLARAPKTPDW
A0A1T3NUL4_9ACTN      IADHLGAARE-P-HPA-RPTFASIHGRDA---VEVRADELSPERFMDAGLLRRPASRP--
A0R484_MYCS2          LAQHIEAQRT---AGDRRPSFTTVHGADA---TEIRASELTLDKFIDAETLRAAPGLP--
A0A372PB04_9ACTN      IAGQIERLRDPS---AQRATFAGVHGDQA---TAARAGDLVLARFIDEATLTAATALP--
A0A3D9TUD1_9NOCA      LAEYIEARLGSN---ADAVTFDSVHGKNS---SAVRAEDLTLDAFLDSDTLKAAQDAD--
D5UWX9_TSUPD          VARHIEKARSGG---VAAPTADSVHGVGA---SVARATDLTLEKFIDPELLALAPTLP--
                      :*  :                  :*           * :*    *.    *         

CAR_MYCMM             ----------------------------AANTQVRTVLLTGATGFLGRYLALEWLERMDL
CAR_MYCTU             ----------------------------APSAQVRTVLLTGATGFLGRYLALEWLDRMDL
B2HE95_MYCMM          ----------------------------AADARARTVLLTGATGFLGRYLVLEWLRRLRA
F5YUX6_MYCSD          ----------------------------APSGQVRTVLLTGATGFLGRYLALEWLERLAP
Q9CCT4_MYCLE          ----------------------------QPGTEVRTVLLTGATGFLGRYLALKWLERMDL
A0QWI7_MYCS2          ----------------------------RSGTEIRTVLLTGATGFLGRYLALEWLERMDL
W9B0J1_9MYCO          ----------------------------GPDAEIRTVLLTGATGFLGRYLALEWLERMDL
A1UFA8_MYCSK          ----------------------------GPSGEVRTVLLTGATGFLGRYLALDWLERMAL
A1T887_MYCVP          ----------------------------GPRAEVRTVLLTGATGFLGRYLALEWLERMAL
A0A448GMC3_MYCCH      ----------------------------GPAPEIRTVLLTGATGFLGRYLALEWLERMAM
K0EPZ9_9NOCA          ----------------------------APNYAVRTVLLTGATGFLGRFLALALLERLGP
A0A2G5PCS5_9MYCO      ----------------------------GPRDVVRTVLLTGATGFLGRYLALDWLERMSL
A0A5S9NMT1_MYCVN      ----------------------------PPARDVTTVLLTGATGYLGRFLLIDWLDRVSA
A0A378YSF8_9NOCA      ----------------------------SALEPPRTVLLTGANGYLGRFLALEWLQRLDA
Q5YY80_NOCFA          ----------------------------PPVAEPRVVLLTGANGYLGRFLCLEWLERLDR
U5ELY0_NOCAS          ----------------------------PAADPARTVLITGANGYLGRFLLLAWLERLAP
H6R914_NOCCG          ----------------------------VAAT-TGTVLITGANGYLGRWLCLLWLQRMQA
CAR_NOCIO             ----------------------------HAPVPAQTVLLTGANGYLGRFLCLEWLERLDK
D6ZDT1_SEGRD          ----------------------------RPTGSHRTVLLTGANGWLGRFLALEQLQRLEA
CAR_SEGRC             ----------------------------RPASEVRTVLLTGSNGWLGRFLALAWLERLVP
A0A2P7PL49_9ACTN      TDPSVNWADPSVGRTDLPGERTDPSADGTSPTATGNVLLTGATGYLGRFLAVEWLERVAA
A0A1T3NUL4_9ACTN      -----------------------------AAAPAGTVLLTGATGYLGAFLAVEWLRRMAD
A0R484_MYCS2          ----------------------------KVTTEPRTVLLSGANGWLGRFLTLQWLERLAP
A0A372PB04_9ACTN      ----------------------------QPTGAPTTVLLTGANGYLGRFLCLELLQSLAR
A0A3D9TUD1_9NOCA      ----------------------------APRPRTRTVLLTGANGYLGRFLCLEWLQRMAD
D5UWX9_TSUPD          ----------------------------AATGEPNTVLLTGSTGYLGRFLLLDWLRRVAP
                                                          **::*:.*:** :* :  *  :  

CAR_MYCMM             VDGKLICLVRAKSDTEARARLDKTFDSGDPELLAHYRALAGD-HLEVLAGDKGEADLGLD
CAR_MYCTU             VNGKLICLVRARSDEEAQARLDATFDSGDPYLVRHYRELGAG-RLEVLAGDKGEADLGLD
B2HE95_MYCMM          VGGKLICLVRAASDEQARVRLDTAFDSGDPQLPEHFRQLAVD-RLEVLAGDKSEPGLGLD
F5YUX6_MYCSD          VGGKLICLVRARSDADARARLDATFDSGDAKLLARYTELAAE-HLEVIAGDKGEANLGLD
Q9CCT4_MYCLE          VEGKVIALVRAKSNEDARARLDKTFDSGDPKLLAHYQELATD-HLEVIAGDKGEVDLELD
A0QWI7_MYCS2          VDGKVICLVRARSDDEARARLDATFDTGDATLLEHYRALAAD-HLEVIAGDKGEADLGLD
W9B0J1_9MYCO          VDGKLICLVRARSNEEARARLDKTFDSGDPKLLAHYRELAAD-HLEVIAGDKGEADLGLD
A1UFA8_MYCSK          VDGKVICLVRAKDDAAARKRLDDTFDSGDPKLLAHYRKLAAD-HLEVLAGDKGEADLGLP
A1T887_MYCVP          VGGKLICLVRAKDDAAARVRLDSTFDSGDPELLRHYRRLAAD-HLEVIAGDKADADLGLD
A0A448GMC3_MYCCH      VGGTLICLVRGRDDAAARARLDQIFDSGDPELLRHYRELADR-HLEVIAGDKSDAVLGLD
K0EPZ9_9NOCA          VDGTLICLVRATDDAAARKRLDEVFDSGDPQLRTHYQRLAER-HLEVVAGDKGDLDLGLD
A0A2G5PCS5_9MYCO      VDGKVVCLVRGRSDADARARLDAVFDSGDPKLLAHYRALSP--HLEVIAGDKGEENLGLD
A0A5S9NMT1_MYCVN      VNGKVVCLVRAKDDEAARRRLDSVFDSGDADLLSRYSGMAAP-HLEVIAGDKGAADLGLD
A0A378YSF8_9NOCA      SGGTLICLIRGSDADSARRRLDAVFATGDPELEAHYRELAER-RLRVLPGDIGEPNLGLS
Q5YY80_NOCFA          VDGRLICLVRGADEAAALARLEAAFDSGDPELVRRFKELAQR-RLTVVAGDIGEPGLGLA
U5ELY0_NOCAS          VGGRVICVVRGADVTAARARLDAVFDT-DPSLRAHVEALS-G-ALEVVAGDIGEPRFGVD
H6R914_NOCCG          VGGRVLCVVRAKDADTARRRLDAAFDSGDVDLLRRYRELADN-HLEVIVGDISAPRLGLD
CAR_NOCIO             TGGTLICVVRGSDAAAARKRLDSAFDSGDPGLLEHYQQLAAR-TLEVLAGDIGDPNLGLD
D6ZDT1_SEGRD          TGGKLICLVRGKDAASARARVEEALGT-DPALAARFAELAAD-RLEVVPGDVGEPKFGLD
CAR_SEGRC             QGGKVVVIVRGKDDKAAKARLDSVFESGDPALLAHYEDLADK-GLEVLAGDFSDADLGLR
A0A2P7PL49_9ACTN      SGGRLTVLARGADDAAAGHRVLACLRGASGDRTDWFDAVAAQ-HLEVLAADVSAPQLGLD
A0A1T3NUL4_9ACTN      TGGRLICPTRAEDDAAARERVVRCLRAASADRPGWFDAVAAR-HLEVPAADVSAPRLGLD
A0R484_MYCS2          VGGTLITIVRGRDDAAARARLTQAYDT-DPELSRRFAELADR-HLRVVAGDIGDPNLGLT
A0A372PB04_9ACTN      NGGTLICLVRGADDAAARARLEDSLDSGDVELKRRFAELAGDGALQVLAGDVGAPNLGLS
A0A3D9TUD1_9NOCA      LGGTVVCLVRGRDTADARARLDAAFDSGDTELSSRYRALADA-ALEVVAGDIGEDRLGLD
D5UWX9_TSUPD          HGGTVIALVRGADADDARRRVTAAIGDSDPDLTQEFTSLAEH-HLHVIAGDFGSPALGLD
                        * :    *. .   *  *:       .         :.    * *  .* .   : : 

CAR_MYCMM             RQTWQRLADTVDLIVDPAALVNHVLPYSQLFGPNALGTAELLRLALTSKIKPYSYTSTIG
CAR_MYCTU             RVTWQRLADTVDLIVDPAALVNHVLPYSQLFGPNAAGTAELLRLALTGKRKPYIYTSTIA
B2HE95_MYCMM          GPTWQRLADTVDLIVDPATLVNHVLSYRQLFAPNVAGTAELLRLALTTKRKPYAYVSTVS
F5YUX6_MYCSD          QQVWQRLADTVDVIADPAALVNHVLPYSELFGPNVVGTAELIRVALTGKIKPFTYFSTIG
Q9CCT4_MYCLE          RQTWRRLADTVDLIVDPAALVNHVLPYSELFGPNTLGTAELIRIALTSKQKPYIYVSTIG
A0QWI7_MYCS2          HDTWQRLADTVDLIVDPAALVNHVLPYSQMFGPNALGTAELIRIALTTTIKPYVYVSTIG
W9B0J1_9MYCO          KATWQRLADTVDFIVDPAALVNHVLPYSELFGPNALGTAELIRIALTTKIKRFAYVSTIG
A1UFA8_MYCSK          HPVWQRLADTVDLIVDPAALVNHVLPYSQLFGPNALGTAELIRLALTTRIKPFTYVSTIG
A1T887_MYCVP          ARTWQRLADTVDLIVDPAALVNHVLPYRQLFAPNVLGTAELLRIALTTRMKPFVYVSTIG
A0A448GMC3_MYCCH      RRTWQRLADTVDLIVDPAALVNHVLPYRELFGPNVVGTAELIRLALTGRLKPYLYTSTIA
K0EPZ9_9NOCA          RATWQRLAERVDLIVDCAALVNHVLPYSQLFGPNVVGTAELIRLALTGKQKIFDYISTVG
A0A2G5PCS5_9MYCO      PALWQRLADDVDLIVDPAALVNHVLPYRQLFGPNALGTAELLRVALTSRIKPYLYVSTIG
A0A5S9NMT1_MYCVN      HTTWQRLAGEVDLIVDPAAMVNHMLPYQQLFAPNVVGTAELIRLALTVRQKPLAFVSSIG
A0A378YSF8_9NOCA      EQEWRDLAETVDLIVHPAALVNHVLPYAQLFGPNVVGTAEVIRLALTSRLKPVTYLSTVA
Q5YY80_NOCFA          TATWRRLAAEVEHIVHPAALVNHVLPYRQLFGPNVAGTAEILRLALTERRKPIDFLSTVA
U5ELY0_NOCAS          DATWRRLAGEVDLIVHSAALVNHVLPYAQLFGPNVVGTAEVIRLALTGRRTPVSYLSTVA
H6R914_NOCCG          EQAWAALARRVDRIVHCAALVNHVLPYEQLFGPNVVGTAELIRLAITDRLKPFTYLSTVA
CAR_NOCIO             DATWQRLAETVDLIVHPAALVNHVLPYTQLFGPNVVGTAEIVRLAITARRKPVTYLSTVG
D6ZDT1_SEGRD          DRTWDRLAGEVDAVVHSGALVNHVLPYHQLFGSNVVGVAEIIRFAVASKLKPVAYLSTVA
CAR_SEGRC             KADWDRLADEVDLIVHSGALVNHVLPYSQLFGPNVVGTAEVAKLALTKRLKPVTYLSTVA
A0A2P7PL49_9ACTN      RTTWERLAAETDRIVHSAALVNHVLPYSRLFEPNVAATARLIELALTHRMKRFAYVSTIA
A0A1T3NUL4_9ACTN      ASTWRRLAAETDRIVHAAALVNHVLPYGRLFGPNVVGTAELIELALTGPAKPFTFVSTIA
A0R484_MYCS2          PEIWHRLAAEVDLVVHPAALVNHVLPYRQLFGPNVVGTAEVIKLALTERIKPVTYLSTVS
A0A372PB04_9ACTN      ERTWQRLAATVDAVVHAAALVNHVLPYRQLFGPNVAGTAEVVRLAVTTRLKPVGFLSSVA
A0A3D9TUD1_9NOCA      PDTWDTLATRVDRIVHPAALVNHALPYQHMFGPNVVGTAEVVRLAVADHLKPVTYLSTVA
D5UWX9_TSUPD          DATWSDLAGRVDHVVHCGALVNHVLPYDQLFGPNVVATGEVVRLALTTRRKSVDYVSTVA
                         *  **  .: :.. .::*** *.* .:* .*. ....: ..*::   .   : *::.

CAR_MYCMM             VADQIPPSAFTEDADIRVISATRAVD-DSYANGYSNSKWAGEVLLREAHDLCGLPVAVFR
CAR_MYCTU             VGEQIPPEAFTEDADIRAISPTRRID-DSYANGYANSKWAGEVLLREAHEQCGLPVTVFR
B2HE95_MYCMM          VANQIEPSAFTEDADIREISRTRTID-DSFANGYTTSKWASEVLLREAHDLCGLPVTVFR
F5YUX6_MYCSD          VGDQIPLGRFTEDADVREMSPLRAIN-DGYANGYGNSKWAGEVLLREAHDRCGLPVAVFR
Q9CCT4_MYCLE          VGNQIEPAKFTEDSDIRVISPTRNIN-NNYANGYGNSKWAGEVLLREAHDLCGLPVTVFR
A0QWI7_MYCS2          VGQGISPEAFVEDADIREISATRRVD-DSYANGYGNSKWAGEVLLREAHDWCGLPVSVFR
W9B0J1_9MYCO          VGWGIEPGKFVEDADIRTISATRVVD-ESYANGYGTSKWAGEVLLREAHDLAGLPVSVFR
A1UFA8_MYCSK          VGAGIEPGRFTEDDDIRVISPTRAVD-TGYANGYGNSKWAGEVLLREAHDLCGLPVAVFR
A1T887_MYCVP          VGAGIEPARFTEDADIRQISATRRID-DSYANGYGNSKWAGEVLLREAHDLCGLPVSVFR
A0A448GMC3_MYCCH      VGAGIAPGQFTEDADIRQISATRTLD-DSYANGYATSKWAGEVLLREAHDLCGLPVAVFR
K0EPZ9_9NOCA          VGDQIAAGQFVEDADVRTMSATRSVD-ERYANGYGNSKWAGEVLLREANERYGLPVSVFR
A0A2G5PCS5_9MYCO      VGFGMAAGSFVEDADIRAASPIRTVD-DSYANGYGNSKWAGEVLLREAHALCGLPAAVFR
A0A5S9NMT1_MYCVN      VGAVIPFGEFTEDADVRRVGARRSLG-DDYASGYASSKWAGEVLLHEAHDLCGLPVTVFR
A0A378YSF8_9NOCA      VSAGIDPETFTEDGDIREISPVRRLD-DGYANGYGNSKWAGEVLLRNAHDRFGLPVAVFR
Q5YY80_NOCFA          VAAQIPADRFAEDGDIRVISPTRTVD-RGYANGYGNSKWAAEVLLRAAHDRFDLPVAVFR
U5ELY0_NOCAS          VAAQ--GESFAEDGDVRTMSPVRRLD-GSYANGYGNSKWAGEVLLREASDRFGLPVAVFR
H6R914_NOCCG          VAADVDRAVFTEGGDIRAGSPVRRNG-AGYATGYGNSKWAGEVLLRSVHEMCGLPVAVFR
CAR_NOCIO             VADQVDPAEYQEDSDVREMSAVRVVR-ESYANGYGNSKWAGEVLLREAHDLCGLPVAVFR
D6ZDT1_SEGRD          VAAGADPAAFDEDGDIREVVPQRPVD-DSYANGYGNSKWAGEVLLREAHERTGLPVRVFR
CAR_SEGRC             VAVGVEPSAFEEDGDIRDVSAVRSID-EGYANGYGNSKWAGEVLLREAYEHAGLPVRVFR
A0A2P7PL49_9ACTN      AAMMPDGTFLDETADVRTASPVRQLN-DSDANGYATSKWAGEVLLRDAHDRTGLPVVVFR
A0A1T3NUL4_9ACTN      AALEPDGSVLDETVDVRTAAPVRRLD-GSDANGYATGKWAGEVLLRAAHERTGLPVTVFR
A0R484_MYCS2          VAMGIPD--FEEDGDIRTVSPVRPLD-GGYANGYGNSKWAGEVLLREAHDLCGLPVATFR
A0A372PB04_9ACTN      VASH--GTGMDEGADIRVASPVRPID-ESHANGYATSKWAGEVLLREAHDLCGLPVTVFR
A0A3D9TUD1_9NOCA      VAAGVEN--FVENGDIRKESPARSVD-ESYANGYGTSKWAGEVILRNAFDLFGLPVTVFR
D5UWX9_TSUPD          VVPQDDGRVLVEDDDVRELGAERRIGADAYANGYAVSKWAGEVLLHEAADLADLPVRVFR
                      .          *  *:*     *       *.**  .***.**:*: .    .**. .**

CAR_MYCMM             CDMILADTTWAGQLNVPDMFTRMILSLAATGIAPGSFYELAADG-----ARQRAHYDGLP
CAR_MYCTU             CDMILADTSYTGQLNLPDMFTRLMLSLAATGIAPGSFYELDAHG-----NRQRAHYDGLP
B2HE95_MYCMM          CDMILADTSYAGQLNLADTFTRLMLSVAATGIAPASFYRLGPDG-----KRQPAHFDGLP
F5YUX6_MYCSD          CDMILADTSYAGQLNLPDMFTRMMFSLVAAGVAPASFYELDAAG-----NRQRAHYDGLP
Q9CCT4_MYCLE          CDMILADTSYAGQLNVPDMFTRMMLSLAATGIAPGSFYELDAES-----NRQRAHYDGLP
A0QWI7_MYCS2          CDMILADTTYSGQLNLPDMFTRLMLSLVATGIAPGSFYELDADG-----NRQRAHYDGLP
W9B0J1_9MYCO          CDMILADTSYAGQLNLPDMFTRMMFSLVATGVAPKSFNQLDAQG-----NRQRAHYDGLP
A1UFA8_MYCSK          CDMILADTTYAGQLNLPDMFTRMMLSLVTTGIAPKSFHPLDAKG-----HRQSAHYDGLP
A1T887_MYCVP          CDMILADTTYAGQLNLPDMFTRLIFSLVATGVAPESFYHLATDG-----TRQRAHYDGLP
A0A448GMC3_MYCCH      CDMILADTSYAGQLNVPDMFTRLILSLVATGIAPLSFYELDAAG-----HRQRAHYDGLP
K0EPZ9_9NOCA          CDMIMVDGSYVGQLNVPDMFTRLMLSLVATGVAPGSFYQTDAAG-----QRQRAHYDGLP
A0A2G5PCS5_9MYCO      CDMILADVSWAGQLNTPDMFTRMMLSLLATGIAPASFTELGPDG-----ARQPSHYDGLP
A0A5S9NMT1_MYCVN      CDMIMAGGNYRGQLNVPDMVTRLILSVTATGLAPYSFYQLDEHG-----NRPRAHFDGLP
A0A378YSF8_9NOCA      SDMILAHSRYAGQLNVPDMFTRLLLSVLATGLAPGSFHDAH--G-----ERHRAHYDGLP
Q5YY80_NOCFA          SDMILAHGSFAGQLNIPDVFTRLLLSLLVTGIAPASFHAATVTG-----ERPRAHYDGLP
U5ELY0_NOCAS          SDMILAHSEYPGQVNVPDVFTRLLLSLLVTGIAPKSFYRTDSQG-----RRQRAHYDGLP
H6R914_NOCCG          SDMVLAHPGYAGQLNVPDMFTRLLIGLAATGLAPASFYRRGADG-----GRARAHYDGLP
CAR_NOCIO             SDMILAHSRYAGQLNVQDVFTRLILSLVATGIAPYSFYRTDADG-----NRQRAHYDGLP
D6ZDT1_SEGRD          SDMILAHRQHTGQLNATDQFTRLILSLLATGLAPKSFYQLDPQG-----RRQRAHYDGIP
CAR_SEGRC             SDMILAHRKYTGQLNVPDQFTRLILSLLATGIAPKSFYQLDATG-----GRQRAHYDGIP
A0A2P7PL49_9ACTN      PDMILAHSRLTGQLNLPDRFTRLLLSVVATGMAPRSFHRLDADG-----NRRRAHYSGLP
A0A1T3NUL4_9ACTN      PDMILAHRRLPGVVNLPDRFTRLILSVVATGMAPLSFHHLDADG-----RRRRAHYSGLP
A0R484_MYCS2          SDMILAHPRYRGQVNVPDMFTRLLLSLLITGVAPRSFYIGD--G-----ERPRAHYPGLT
A0A372PB04_9ACTN      SGMILAHGRHTGQLNVPDAFTRLVLSLIATGIAPGSFYRGG--------DASRAHYDGLP
A0A3D9TUD1_9NOCA      SDMILAHSTWTGQLNVPDVFTRLVLSVAATGIAPKSFYRTDTDAPNDDAGRPRAHYDGLP
D5UWX9_TSUPD          SDMILAHSRFHGQFNEVDQFTRLLLSIAETGLAPASFYTPDPSG-------HRPHYDGLP
                       .*::.     * .*  * .**:::.:  :*:** **                .*: *:.

CAR_MYCMM             VEFIAEAISTLGAQ----SQDGFHTYHVMNPYDDGIGLDEFVDWLNE----SGCPIQRIA
CAR_MYCTU             VEFVAEAICTLGTH----SPDRFVTYHVMNPYDDGIGLDEFVDWLNSPTSGSGCTIQRIA
B2HE95_MYCMM          VEFIAEAVATLGAR----RHDGFQVHHVANPHHDGVGLDEYVDWLVD----AGCPIRRIP
F5YUX6_MYCSD          VEFIAEASTTLGAGSAGMADAGFATYHLMNPYDDGLGMDEFVDWLIE----AGHPIERID
Q9CCT4_MYCLE          VEFIAEAISTLGDQSLHDRD-GFTTYHVMNPHDDGIGMDEFVDWLID----AGCPIQRIN
A0QWI7_MYCS2          VEFIAEAISTIGSQVTD----GFETFHVMNPYDDGIGLDEYVDWLIE----AGYPVHRVD
W9B0J1_9MYCO          VEFIAEAIATLGAHVDD----GFETYHVMNPYDDGIGMDTFVDWLVE----AGYKIERVD
A1UFA8_MYCSK          VEFVAESISALGAQAVDEAGTGFATYHVMNPHDDGIGLDEFVDWLVE----AGYRIDRID
A1T887_MYCVP          VEFIAEAISTLGSDVAS----GFRTYHVMNPHDDGIGLDEYVDWLID----AGHPIRRVG
A0A448GMC3_MYCCH      VEFVAEAVSALGLDVAEDG--GFATYHVMNPYDDGIGLDEFVDWLTG----AGYPIERVN
K0EPZ9_9NOCA          VDFIAEAVTELGVRE------GFSTYHVMNPHHDGIGLDEFVDWLVA----AGYPIARVA
A0A2G5PCS5_9MYCO      VEFVADAIDTLGSALSP---GEFRTFHVMNPHDDGVGMDEFVDWLID----AGHPIQRIE
A0A5S9NMT1_MYCVN      VDFVADAISTLTAAHHR---VGFRTFHVVNPHDDGIGLDQYVDWMIR----AGRQVERIR
A0A378YSF8_9NOCA      ADFTAAAVTTLGSRVTS----GYETYDVLNPHDDGISLDTFVDWLIE----AGHPIDRID
Q5YY80_NOCFA          ADFTAAAITALGAR-TA----GFHTYDVLNPHDDGISLDTFVDWLIE----AGHPIERIP
U5ELY0_NOCAS          ADFVAAAVTALGAAATT----GYRTFDVVNPHDDGISLDVFVDWLIE----AGHRIDRID
H6R914_NOCCG          ADFTAEAITELGAAIDD----GHHSFHVVNPHDDGISLDVIVDWLIE----AGVAIERVD
CAR_NOCIO             ADFTAAAITALGIQATE----GFRTYDVLNPYDDGISLDEFVDWLVE----SGHPIQRIT
D6ZDT1_SEGRD          VDFTAEAIVALAAEGNN----GHRSYNVFNPHHDGVGLDEFVDWLIE----AGHPITRIE
CAR_SEGRC             VDFTAEAITTLGLAGSD----GYHSFDVFNPHHDGVGLDEFVDWLVE----AGHPISRVD
A0A2P7PL49_9ACTN      VDFTADAIASLSARSRD----GYVTYNSVNANDDDVSLDEIVDWLIR----AGHPITRID
A0A1T3NUL4_9ACTN      VDFTAAAITALGADASD----GYRTYHAVNANDDGVSLDEMVDWLIA----AGHPIRRFA
A0R484_MYCS2          VDFVAEAVTTLGAQQRE----GYVSYDVMNPHDDGISLDVFVDWLIR----AGHPIDRVD
A0A372PB04_9ACTN      GDFVAACVAALGTGAA-----GYRTFNVVNPHDDGISLDTVVDWLAD----SGIAIRRVG
A0A3D9TUD1_9NOCA      ADFSAAAITALGGESTS----GYTTYDVLNPHDDGISLDTFVDWMVE----AGRKIERID
D5UWX9_TSUPD          VDFTAEAITTLSAAGRS----GYRTFHVLNANDDGVSLDSFVDWIAA----SGRSIERID
                       :* * .   :           .  ..  *. .*.:.:*  ***:      :*  : *. 

CAR_MYCMM             DYGDWLQRFETALRALPDRQRHSSLLPLLHNYRQPERPVRGSIAPTDRFRAAVQEAKIGP
CAR_MYCTU             DYGEWLQRFETSLRALPDRQRHASLLPLLHNYREPAKPICGSIAPTDQFRAAVQEAKIGP
B2HE95_MYCMM          DYDEWLSRFETALHALPDRKRRHSLLPLLQNYREPAEPIRGGIAPAPRFRGAVRQAKIGR
F5YUX6_MYCSD          DYGDWLQRFETTLRALPERQRQASLLPLLHNYQKPQPAICGSIAPTDKFRAAVQEAKIGA
Q9CCT4_MYCLE          DYDEWLRRFEISLRALPERQRHSSLLPLLHNYQKPEKPLHGSLAPTIRFRTAVQNANIGQ
A0QWI7_MYCS2          DYATWLSRFETALRALPERQRQASLLPLLHNYQQPSPPVCGAMAPTDRFRAAVQDAKIGP
W9B0J1_9MYCO          DYAEWLDRFETTLRALPDKQRQASLLPLLHNYQQPGVPVNGAMAPTDVFRAAVQEAKIGP
A1UFA8_MYCSK          YYAAWLQRFETALRALPERTRQYSLLPLLHNYQRPAHPINGAMAPTDRFRAAVQEAKLGP
A1T887_MYCVP          DYPTWLQRFTVAITALPERQRQASLLPLLHNYQHPETPIRGSIAPTDRFREAVQDAKIGP
A0A448GMC3_MYCCH      DYGTWFQRFETAIRGLPERQRQASLLPLLHNYQRPQPPIRGSAAPTDRFRSAVQDAKIGP
K0EPZ9_9NOCA          DYQTWLEQFGTKLRALPEQQRKHSLLPLLHSYAHPQPPVEGSVAPADRFRAAVQDANIGP
A0A2G5PCS5_9MYCO      DYPQWLARFETALRGLPERQRQNSLLPLLHNYQRPGRPLRGSAAPTAVFRNAVREAKIGP
A0A5S9NMT1_MYCVN      DYKEWHSRFETALRNLPERQRQASLLPLLTSFRYPQPALAGAFAPTDRFRAAVAQFGLGA
A0A378YSF8_9NOCA      DYAEWFARFDTALRALPEPQRQHSLLPLLHAYRRPTPPLRGAALPAKHFRAAVQQAKLGP
Q5YY80_NOCFA          EHSEWVTRFETALHALPERQRKHSLLPLLHAYRRPVPALRGSALPAAEFRAAVRAAGITA
U5ELY0_NOCAS          DFATWSARFEAALRALPEERRKHTVLPLMHAYRRPGVPVAGSALPADGFRAAVRAAGVGA
H6R914_NOCCG          DYTEWLTRFEAGLRALPEPQRNASVLPLLHAFARPAPATPGSAIPATEFRAAVRAAKLGP
CAR_NOCIO             DYSDWFHRFETAIRALPEKQRQASVLPLLDAYRNPCPAVRGAILPAKEFQAAVQTAKIGP
D6ZDT1_SEGRD          DHATWFARFTTALRALPEKQRQLSLLPLAQVYSFPHPAVDGSPFRNAVFRADVQRARIGK
CAR_SEGRC             DYAEWLSRFETSLRGLPEAQRQHSVLPLLHAFAQPAPAIDGSPFQTKNFQSSVQEAKVGA
A0A2P7PL49_9ACTN      DYEQWRVRFEAALRGLPEHQRRLSMLPLMRAYARPTEPRTSSMVPARRFTAAVAESGAG-
A0A1T3NUL4_9ACTN      DYEQWRMRFEAALRGLPEERRRGSLLPLLPAYARPSEPRPAGAVPNARFTAALAAVG---
A0R484_MYCS2          DYDDWVRRFETALTALPEKRRAQTVLPLLHAFRAPQAPLRGAPEPTEVFHAAVRTAKVG-
A0A372PB04_9ACTN      DYQEWRERFEAALRELPDKQRQHSLLPLMRAWREPATPLAGSAFPAERFQEAV-------
A0A3D9TUD1_9NOCA      DYDEWFSRFSAAVADLPEPQRTTSLLPLLHAYEQAEYPAAGAHLPADGFRAAVIEES---
D5UWX9_TSUPD          DYDTWFARFEQALQQLPDEARQRSVLPLLHAVREPAPAAGTSALSVDRFRGAVRETGVG-
                       .  *  :*   :  **:  *  ::***      .  .   .      *   :       

CAR_MYCMM             DKDIPHVGAPIIVKYVSDLRLLGLL--------
CAR_MYCTU             DKDIPHLTAAIIAKYISNLRLLGLL--------
B2HE95_MYCMM          DNDIPHVGPAIIAKYASDLQLLGLA--------
F5YUX6_MYCSD          TQDIPHVTPAVIVKYITDLELLGLL--------
Q9CCT4_MYCLE          DKDIPHISPAIIAKYVSDLQLLGLV--------
A0QWI7_MYCS2          DKDIPHVTADVIVKYISNLQMLGLL--------
W9B0J1_9MYCO          DKDIPHVSAPVIVKYITDLQLLGLL--------
A1UFA8_MYCSK          DKDIPHVTPAVIVKYATDLELLGLI--------
A1T887_MYCVP          DKDIPHVTPQIVIKYVTDLQRLGLL--------
A0A448GMC3_MYCCH      DKDIPHITPEVIVKYVTDLRLLGLL--------
K0EPZ9_9NOCA          DKDIPHLTESTILKYITNLEHLGLL--------
A0A2G5PCS5_9MYCO      DKDIPHISREVIVKYADDLALLGLLPG------
A0A5S9NMT1_MYCVN      AGDIPHIDFGIIEKYLSDLELLGLLDTEHYHRD
A0A378YSF8_9NOCA      DGDIPHLTRELIEKYASDLRLLGLLA-------
Q5YY80_NOCFA          DGDIPHLTRALIEKYVADLRLHGLL--------
U5ELY0_NOCAS          DADIPHLGPELMRKYVGDLGALGLLG-------
H6R914_NOCCG          DADIPHLSADLIAKYVGDLRLRGLISSG-----
CAR_NOCIO             EQDIPHLSAPLIDKYVSDLELLQLL--------
D6ZDT1_SEGRD          DHDIPHLTRELILKYAADLAALGLL--------
CAR_SEGRC             EHDIPHLDKALIVKYAEDIKQLGLL--------
A0A2P7PL49_9ACTN      GGAIPSLSADFIDKYVADLRALGVL--------
A0A1T3NUL4_9ACTN      GEPVPSITPDYLAKCVADLRGLDLL--------
A0R484_MYCS2          PGDIPHLDEALIDKYIRDLREFGLI--------
A0A372PB04_9ACTN      -GDIPHLSRALIEKYVSDLRHLSLL--------
A0A3D9TUD1_9NOCA      DGDIPHLDRALIEKYLSDLEQLGLLTPL-----
D5UWX9_TSUPD          PGDIPVLDRALIEKYLRDFETAGWLAPGARD--
                         :* :    : *   ::