CLUSTAL format seed alignment for MF_03000

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EIF3A_DICDI       ---------MSTQQALAQANEHAL-SQANDLIKVGS---------KLRALSVLRDLLSDR
F0ZBR6_DICPU      -----------MTQLLATANEHAL-TQANDFIKANN---------KGRALNILRDLLIER
D3BGC0_POLPP      ------------MSQYLVVNEQCL-TKANEFVQMGQ---------PIAALDTMRELLLFR
EIF3A_HUMAN       --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVMKSK
G1P5I7_MYOLU      --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVMKSK
G1LTU8_AILME      --------MPAYF----QRPENAL-KRAGEFLEVGK---------KQPALDVLYDVMKSK
EIF3A_MOUSE       --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVMKSK
H0WQ74_OTOGA      --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVMKSK
EIF3A_RAT         --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVMKSK
EIF3A_DANRE       --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVIKSK
H3B4Y5_LATCH      --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVIKSK
EIF3A_XENTR       --------MPAYF----QRPENAL-KRANEFLEVGK---------KQPALDVLYDVIKSK
B7Q355_IXOSC      --------MPIYF----QRPENAL-KRAREFIDVGK---------KHRALDALYDVIKSR
C3YRF7_BRAFL      --------MPTYF----QRPENAL-KRANEFIDVGK---------KQPALDALYDVIKSK
EIF3A_NEMVE       --------MPTYF----QRPENAL-KRANEFIEVGK---------KEPALDALYDVIKSK
EIF3A_DROME       --------MARYT----QRPENAL-KRANEFIEVGK---------PLRALDTLQEVFRNK
EIF3A_DROPS       --------MARYT----QRPENAL-KRANEFIEVGK---------PLRALDTLQEVFRNK
W5JG72_ANODA      --------MSRYV----QRPDNAL-KRANEFIDVGK---------KARALDTLQEVFRAK
EIF3A_ANOGA       --------MSRYV----QRPENAL-KRANEFIDVGK---------KARALDTLQEVFRAK
EIF3A_AEDAE       --------MSRYM----QRPENAL-KRANEFIEVGK---------PARALDTLQEVFRIK
E9GZK2_DAPPU      --------MSRFY----QRPENAL-KRANEFIEVGK---------PIRALDALAEVIKSK
E0VV02_PEDHC      --------MARIG----QRPENAL-KRANEFIDVGK---------PARALDTLSEVFRNK
EIF3A_CAEBR       -------MAPNYF----QKPEAAL-KRAEELIQVGK---------ESDALDTLHDTIKAR
EIF3A_CAEEL       -------MAPNYF----QKPEAAL-KRAEELIQVGK---------ESDALDTLHDTIKAR
EIF3A_YEAST       --------MAPPP----FRPENAI-KRADELISVGE---------KQAALQSLHDFITAR
EIF3A_CANGA       --------MAPPP----LRPENAL-KRADELISVNE---------KPAALQSLYEFITAR
EIF3A_VANPO       --------MAPPV----LRPDNAI-KRADELISVGE---------SQAALQSLYEYLTAR
EIF3A_KLULA       --------MAPPA----LRPENAI-RRADELVSVGE---------PMAALQSLFDLLSSR
EIF3A_CANAL       ----MAPPHKNHN----FRPENVL-KRAEDLIAVGQ---------KEAALDTLYELIISK
EIF3A_EMENI       --------MPPPP---HIKPENVL-KRAQELIAVGQ---------APAALTVLHEHATSK
EIF3A_ASPFU       --------MPPPP---HIKPENVL-KRAQELIAVGQ---------APAALNVLHEHVTSK
C0NC78_AJECG      --------MPPPP---HIRPENVL-RRAEELIAVGQ---------QQAALTVLHEQVASK
Q0V6S4_PHANO      --------MPLTKGRLHGKPLTCKSKRAQELIGVEQ---------QQAALQLLHEHVTSK
C7YNL9_NECH7      --------MPPPP---HQKPENVL-KRANELIGVGQ---------APAALTLLHEHITSK
EIF3A_NEUCR       --------MPPPP---HQKPENVL-KRAHELIGVNQ---------APAALTLLHEHITSK
A7F4P3_SCLS1      --------MPPPP---HQKPENVL-KRAHELMGVGQ---------SQAALVLLHEHVTSK
D5GPY7_TUBMM      --------MPPPP---HAKPENVL-KRAQELVAVNK---------NLSALELLHEHVTAK
EIF3A_SCHPO       --------MAPPQ----GKPENVL-RLADELIALDQ---------HSSALQSLHETIVLK
A8P1V9_COPC7      --------MAPFS-----KPETVL-KQAEGLVSVGQ---------MHAALQSLTEMFSSK
EIF3A_USTMA       --------MPPFA-----KPETVL-KRSEELINVGQ---------HQAALAALNEIFTSR
F4NW26_BATDJ      --------MAPFYQ----KPENAI-KRAEELVAVNQ---------HSAALNLLHEVILSK
EIF3A_YARLI       --------MAPHQ---NVRPETVL-KRTDELIAVGQ---------QDAALELLHETVSAR
EIF3A_ARATH       --------MANFAK-----PENAL-KRADELINVGQ---------KQDALQALHDLITSK
F6I4Q7_VITVI      --------MATFAK-----PENAL-KRAEELINVGQ---------KQDALQALHDLITSK
C5XM02_SORBI      --------MATFAK-----PENAL-KRAEELIHVGQ---------KQAALQALHDLITSK
A9RFG7_PHYPA      --------MATFAK-----PENAL-KRAEELMNVGQ---------KQAALQALHDLITSK
A9SFU3_PHYPA      --------MSTFAK-----PENAL-KRAEELMNVGQ---------KQAALQALHDLITSK
A8HRF8_CHLRE      MARVYRGGPGYSAR-----PENAL-KRSDELEAIGQ---------KSAALQVLHDVICSK
D0P3U0_PHYIT      -------MSHFFHK-----PENAL-KRARELLAIPNVDAGVLKRTKHSALEILHDALIAK
H3GEW8_PHYRM      -------MSHFFHK-----PENAL-KRARELLAIPNADAGVLKRTKHSALEILHDALIAK
Q4UGH6_THEAN      --------MYNFQ-----KPENAL-KRAAELRAIGQ---------SDEALVILHSAIGHR
Q4N979_THEPA      --------MHNFQ-----KPENAL-KRAAELRAIGQ---------SDEALVILHSAIGHR
A7AQQ1_BABBO      --------MHNFQ-----KPENAL-KRAAELRAVGQ---------SEEALQTLHSAIGHR
Q8I5S6_PLAF7      --------MQTFQ-----KPENAL-KRAEELQFIGQ---------NEDALQILHSAIGHR
Q7RG05_PLAYO      --------MQTFQ-----KPENAL-KRAEELQFIGQ---------NEDALQILHAAIGHR
B3LCC3_PLAKH      --------MQTFQ-----KPENAL-KRAEELQFIGQ---------NEDALQILHAAIGHR
A5JZU1_PLAVS      --------MQTFQ-----KPENAL-KRAEELQFIGQ---------NEDALQILHAAIGHR
G4V5Q4_SCHMA      --------MPPSQ---YHKPETAL-TKARELIKCDK---------KANALEILYEVMRVR
EIF3A_CRYNJ       --------MPPIYVK----PENAL-KRSEELLALGTPQ------SQQQAFDNLVEVFQSK
EIF3A_MONBE       ------MSMNKFFQ-----PKNAL-KRAEDLEAVGK---------PNLALETLHDLLNSS
B7G0T8_PHATC      --------MATSNFF--HKPELAL-RRAQELEGIHQ---------DDAALAMLHEVLSSR
                                             :  :                 *:  :       

EIF3A_DICDI       S-----QWHSSLEQIMSLYVSLC--------AEQLDYQSLRDGIHHFKVSIMSQKEFSIV
F0ZBR6_DICPU      S-----QWHSSLEQVMSLYVSLC--------AENLDYQSLRDGIHHYKASITSQKEFSLA
D3BGC0_POLPP      N-----IWHPSLEHVMSLYIRLCVDIQPGTPAARDQVLYIKDGLHQYRGSLTNQKEFNVV
EIF3A_HUMAN       K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
G1P5I7_MYOLU      K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
G1LTU8_AILME      K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
EIF3A_MOUSE       K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
H0WQ74_OTOGA      K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
EIF3A_RAT         K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
EIF3A_DANRE       K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
H3B4Y5_LATCH      K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
EIF3A_XENTR       K--HRTWQ-KIHEPIMLKYLELC--------VDLRKSHLAKEGLYQYKNICQQV---NIK
B7Q355_IXOSC      K--HRTWQ-KVHEPIMQQYLELC--------VELKKSHIAKEGLFQYRNICQQV---NIK
C3YRF7_BRAFL      K--HRTWQ-KIHEPIMKKYLELC--------VDLRKSHVAKEGLYQYKNICQQV---NIK
EIF3A_NEMVE       K--HRTWQNKIHEPILFKYLELC--------VDLRRSHVAKEGLYQYKLICQQV---NIA
EIF3A_DROME       R-WNYAYSETVIEPLMFKYLYLC--------VELKKSHIAKEGLFQYRNMFQLV---NVN
EIF3A_DROPS       R-WNYAYSETVIEPLMFKYLYLC--------VELKKSHIAKEGLFQYRNMFQLV---NVN
W5JG72_ANODA      K-WNYNWSESIIEPIMFKYLELC--------VELKKSHIAKEGLFQYRNMFQLV---NVG
EIF3A_ANOGA       K-WNYNWSESIIEPVMFKYLDLC--------VELKKSHIAKEGLFQYRNMFQLV---NVG
EIF3A_AEDAE       K-WTYTWSESVIEPIMFKYLDLC--------VELKKSHIAKEGLFQYRNMFQLV---NVG
E9GZK2_DAPPU      KYRSTTYSEKVLEPIMIKYLELC--------VDLKKAYMAKEGLFQYRNMCQSV---NVA
E0VV02_PEDHC      K-WAYTWSESVLEPIMFKYLDLC--------VELKKSVVAKEGLFQYRNMFQSV---NVG
EIF3A_CAEBR       R--HKQWT-TVHEQIMIKHMELC--------VDLKKQHLAKDALFQYKALTQQI---NVK
EIF3A_CAEEL       R--HKQWT-TVHEQIMIKHMELC--------VDLKKQHLAKDALFQYKALTQQI---NVK
EIF3A_YEAST       R--IRWATPSTVEPVVFKFLEIG--------VELKKGKLLKDGLHQYKKLIQGST-EGLV
EIF3A_CANGA       R--IRYATPSQVEPIVFKFLELG--------VELKKGKLIKDALYQYKKLVHGSA-EGLV
EIF3A_VANPO       K--IRFAQPSTVEPIVFKFLELG--------VDLKRGRLIKDALHQYKKLVQGSQ-DGLS
EIF3A_KLULA       R--SRFADAATLEPIIFKFLELG--------VELRKGKMIKEGLYQYKKHMQHTP-EGLI
EIF3A_CANAL       R--IRYLQVQDLEPIASLLIELA--------VELRKGKLAKDALHQYKKNIQLSE-NGLE
EIF3A_EMENI       R--TRSSPIASLEPVMLLFVELC--------VDLRKGKAAKDGLYQYKNIAQNS---NVG
EIF3A_ASPFU       R--TRSSPIASLEPVMLLFVELC--------VDLRKGKAAKDGLYQYKNIAQNT---NVG
C0NC78_AJECG      R--SRNSPIASLEPVMILFVELC--------VDLRKGKSAKDGLYQYKNIAQNS---NVG
Q0V6S4_PHANO      R--TRNSPIASLEPVMILFVELC--------VDLRKGKLAKDGLYQYKNTAQNT---NVG
C7YNL9_NECH7      R--SRNVPIVSLEPVMLLLVELS--------VEQKKGKLAKDALYQYKNISQNT---NIA
EIF3A_NEUCR       R--SRNVPIASLEPVMLLLVELS--------VEQKKGKLAKDALYQYKNIAQNT---NVA
A7F4P3_SCLS1      R--SRNAPITSLEPVMLLLVEQS--------VEQKKGKLAKDALYQYKNISQNT---NVG
D5GPY7_TUBMM      R--SRLSPIASLEPVMVLFVELC--------VSLRKGKTAKDGLYQYKNIAQNS---SVQ
EIF3A_SCHPO       R--SRNAQGFSLEPIMMRFIELC--------VHLRKGKIAKEGLYTYKNAVQNT---SVT
A8P1V9_COPC7      R--FRSTPLTSLEPIMLRFIELC--------VEMRKGRTAKEGLMQYKNIAQNT---SVA
EIF3A_USTMA       R--FKQTPLQSLEPIMLRFVDLC--------VDLKKGRMAKEGLMQYKNVSQNT---NAQ
F4NW26_BATDJ      R--ARSTSIQVLEPIVIKFIEFA--------VILGKGKVVREALYQYKNIVQNT---TVV
EIF3A_YARLI       K--ARTTSVATLEPIVARFVQLS--------VDLRKGKIIKDGLHQYKKIVQST---NVN
EIF3A_ARATH       R---YRAWQKPLEKIMFKYLDLC--------VDLKRGRFAKDGLIQYRIVCQQV---NVS
F6I4Q7_VITVI      R---YRAWQKTLERIMFKYVELC--------VDMRRGRFAKDGLIQYRIVCQQV---NVT
C5XM02_SORBI      R---YRSWQKPLEKIMMKYVELC--------VDLRKGRYAKDGLIQYRIVCQQV---NVS
A9RFG7_PHYPA      R---YRAWQKTLEKIMFKYVELC--------VDMKKGRFAKDGLIQYRIVCQQV---NVS
A9SFU3_PHYPA      R---YRAWQKTLEKIMFKYVELC--------VDMKKGRFAKDGLIQYRIVCQQV---NVS
A8HRF8_CHLRE      K---HRTWSKTFEAIMLRHVELC--------VDMKKRNYAKEALLQYRNMCHQV---NIN
D0P3U0_PHYIT      K---NRTWQPTHEELMILYLDIC--------LELQMGRVAKDGLHQYRNLCIQH---NPA
H3GEW8_PHYRM      K---NRTWQPTHEDLMILYLDIC--------MELQMGRVAKDGLHQYRNLSIQH---NPA
Q4UGH6_THEAN      F-FRIQGWDMVQEQIMLEYVALC--------IDQDKLRLAREGLHQYRLISQHA---NVS
Q4N979_THEPA      F-FRIQGWDMVQEQIMLEYVALC--------IDQDKLRMARDGLHQYRLISQHA---NVA
A7AQQ1_BABBO      S-FKLQGWDMVQEQIMMEYVALC--------ISQDKLRMARDGLHQYRLVAQHA---NAT
Q8I5S6_PLAF7      T-FRLQGWHILQEQIMLRYIEFC--------LYLEKLSLVKDGLHQYRIICQHG---NIA
Q7RG05_PLAYO      T-FRLQGWHVLQEQIMLRYIEFC--------LYLEKLSLVKDGLHQYRIICQHG---NIA
B3LCC3_PLAKH      T-FRLQGWHILQEQIMLRYIEFC--------LYLEKLSLVKDGLHQYRIICQHG---NIA
A5JZU1_PLAVS      T-FRLQGWHILQEQIMLRYIEFC--------LYLEKLSLVKDGLHQYRIICQHG---NIA
G4V5Q4_SCHMA      R---TKQWQKVLEELMMLFVELC--------VELRKNIHFRKAIYTYKNMSVLE---NTV
EIF3A_CRYNJ       R--FKQTPINVLEPIVTKFIDLC--------VVLSRKAHAKSGLLVFKSAAQTT---NVG
EIF3A_MONBE       K--HKKQWTAVHEEIMIKFLDLC--------MQLKRAPEAKDGLYQFKIVTGTS---AVN
B7G0T8_PHATC      R---HRTWSPAFEQIMIVYVDLC--------LKLYKTREAKDGLHQYRNLSQTQ---APG
                              * :    :                    :..:  ::            

EIF3A_DICDI       PLENIFKEIITPIEQKVDELKEKIEK----------------------------------
F0ZBR6_DICPU      PFENILKEITSPIEAKIDEMKESLDK----------------------------------
D3BGC0_POLPP      PLDNILRDLLTRLDAKLEEAKSAAAA----------------------------------
EIF3A_HUMAN       SLEDVVRAYLKMAEEKTEAAKEESQQ------------------------------MVLD
G1P5I7_MYOLU      SLEDVVRAYLKLAEEKTEAAKEESQQ------------------------------MVLD
G1LTU8_AILME      SLEDVVRAYLKLAEEKTEAAKEESQQ------------------------------MVLD
EIF3A_MOUSE       SLEDVVRAYLKLAEEKTEAAKEESQQ------------------------------MVLD
H0WQ74_OTOGA      SLEDVVRAYLKLAEEKTEAAKEESQQ------------------------------MVLD
EIF3A_RAT         SLEDVVRAYLKLAEEKTEAAKEESQQ------------------------------MVLD
EIF3A_DANRE       SLEDVVRAYLKLAEEKTETAKEESQQ------------------------------MVLD
H3B4Y5_LATCH      SLEDVVRAYLKLAEDKTEAAKEESQQ------------------------------MVLD
EIF3A_XENTR       SLEDVVRAYLKLAEERTEAAKESSQQ------------------------------MVLD
B7Q355_IXOSC      SLEDVVRGYLDLAEEKTEAAREESQQ------------------------------VVVD
C3YRF7_BRAFL      SLEDVVRQYLSLAEERTEQARSSSQQ------------------------------AVLD
EIF3A_NEMVE       SLEDVIRYFLKLAESRAVEAQEDSRKEASAELD-----------------------EDVD
EIF3A_DROME       SLENVIRGYLKMAEEHTEAAQAQSSAAV----------------------------AVLE
EIF3A_DROPS       SLENVIRGYLKMAEEHTEAAQAQSSAAV----------------------------AVLE
W5JG72_ANODA      SLENVIRGYLKMAEERTEQAQQQSSQ------------------------------AIVD
EIF3A_ANOGA       SLENVIRGYLKMAEERTEQAQQQSSQ------------------------------ATVD
EIF3A_AEDAE       SLENVIRGYLKMAEERTEAAQQQSSQ------------------------------AILD
E9GZK2_DAPPU      SLENVVRFYLNLAEEKTEAARQESHQAV----------------------------VDI-
E0VV02_PEDHC      SLENVIRFYLKTAEERTEIARNQSQQAV----------------------------VDIE
EIF3A_CAEBR       SLETVVEHFLKLAEQRTEDAQKQSIE------------------------------KVEE
EIF3A_CAEEL       SLETVVVHFLKLAEQRTEDAQKQSIE------------------------------KVEE
EIF3A_YEAST       SVGAVARKFIDLVESKIASEQTRADELQ----------------------------KQEI
EIF3A_CANGA       SVGAVLRKFIDYVETKLASEQAKAEEKQ----------------------------KEEV
EIF3A_VANPO       SVGAVARKFIDCVETKMAFEHLKAEESQ----------------------------TEE-
EIF3A_KLULA       SVGAVARKFIDLIETKMTNIQAQTDAKEESN-------------------------KDQA
EIF3A_CANAL       SVQTIVRKFIDLAEKKLDAAQTKADIKIDEEENAAAAAAATSSAGAGGAGGDAGGAGAGG
EIF3A_EMENI       TIEIVLKKFIELAEKKVTEAQAKADEIQSSLESAA---------------------PSSN
EIF3A_ASPFU       TIEVVLKKFIELAEKKVTEAQAKADEIQSSLESAA---------------------PSSN
C0NC78_AJECG      TIEMVLKKFIELAEQKVTEAQAKADEIQSSLESAA---------------------PSTN
Q0V6S4_PHANO      TIELVFKRFIELAEQKVTEAQAKADEVQSTLETST---------------------QTQN
C7YNL9_NECH7      TIELVLKKFIELAVQKVTAAQQKADEVQESIEATA---------------------ATSS
EIF3A_NEUCR       TIELVLKKFIELAAEKVTAAQAKADEVQSSIEAT-----------------------TSN
A7F4P3_SCLS1      TIELVLKKFIELAEEKVKTAQAKADEVQSSLDTTA---------------------ATAS
D5GPY7_TUBMM      TIEMVLRKFIELAEAKVTEAQERAEQIT-----------------------------LDA
EIF3A_SCHPO       AIENVVKHFIELANKRVQEAQEKADKIS-----------------------------VEY
A8P1V9_COPC7      SIETVITKFVQLADDKVREAQEKAAVQHS----------------------------ALD
EIF3A_USTMA       SIELVIKHFIKLADAKVVEAQSKADAAVG----------------------------EID
F4NW26_BATDJ      TIEHVIKRYLELAEEQLAQAQQKAEKIN-----------------------------LDV
EIF3A_YARLI       AIEPVIKQFLSLAEQRVTDAQAQADKIAD----------------------------EEE
EIF3A_ARATH       SLEEVIKHFLHLATDKAEQARSQADALEE----------------------------ALD
F6I4Q7_VITVI      SLEEVIKHFMHLSTEKAEQARNQAQALEE----------------------------ALD
C5XM02_SORBI      SLEDVIKHFMQLSNEKAEQAKSQAEALED----------------------------ALD
A9RFG7_PHYPA      SLEEVIKYFLQLSSERAEAAQAQAAAAEV----------------------------TLD
A9SFU3_PHYPA      SLEEVIKYFLQLSSERAEQAQAQAAAAEV----------------------------TLD
A8HRF8_CHLRE      SLEEVIKHFLKRAADKAEEAQAKAAAV------------------------------TLD
D0P3U0_PHYIT      SLETIIKHFVTQAERKLAAAKKESNELNLL---------------------------AAA
H3GEW8_PHYRM      SLETIIKHFVTQAERKLAAAKKESNELNLL---------------------------AAA
Q4UGH6_THEAN      SLAKVIVELLDRAENRLVSAKSKLQVSDAGKSQTQL--------------------SGGI
Q4N979_THEPA      SLGKVIVELLDRAESRLVNVKSKLPASYTGKSPTQF--------------------TSGI
A7AQQ1_BABBO      SLGKVVVELLDHAEERLRRFKADIAADATKAENLEK--------------------TQIS
Q8I5S6_PLAF7      SLGKVITDFRDKAEEKVRLAKENVVLNKEK------------------------------
Q7RG05_PLAYO      SLGKVITDFRDKAEEKVRLAKENMNINKDK------------------------------
B3LCC3_PLAKH      SLGKVITDFRDKAEEKVRLAKENVNLNKEK------------------------------
A5JZU1_PLAVS      SLGKVITDFRDKAEEKVRLAKENMNLNKEK------------------------------
G4V5Q4_SCHMA      SLEQVIRSYLNQIKGKTEEAQEVSKSA------------------------------IME
EIF3A_CRYNJ       AIERVLNHFIAKAEARLAAAVEQAKKEVAAL-------------------------PDVP
EIF3A_MONBE       SLEKVVRYYLKTAEDKVAEAWQQSQLRDATN-------------------------VNDE
B7G0T8_PHATC      SLEKVIRYLLTAAEKKCTEAKASADAQQDQILE-----------------------ENGN
                  ..  :          :                                            

EIF3A_DICDI       ----------ENQENPLVEQNEISLIDPQQTLLFSYMKYLFEAYKAMIEVLTRQNTKFEH
F0ZBR6_DICPU      ----------TSAAEEQTDL--ITLIDPQQTVLFSYMKYLFEAYKSMIEVLTRPNIKFEH
D3BGC0_POLPP      ----------ASEGLEAEAA-----AAITEEKLNPQLKLMSEVYQILLDILK--------
EIF3A_HUMAN       IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
G1P5I7_MYOLU      IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
G1LTU8_AILME      IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
EIF3A_MOUSE       IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
H0WQ74_OTOGA      IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
EIF3A_RAT         IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
EIF3A_DANRE       IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
H3B4Y5_LATCH      IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
EIF3A_XENTR       IEDLDN-IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLR--------
B7Q355_IXOSC      IDDLDN-VQTPESLLLSAVSSEDTQDRTDRVVLTPWVKFLWESYRQCLELLR--------
C3YRF7_BRAFL      IDDLESEIYTPELLLLSAVSGEDIQARHDRLMLTPWVKFLWESYRQCLDLLR--------
EIF3A_NEMVE       IEDLDQ-IQTPESLLLSFVSGEDTQDRTDRVKLTPWVKFLWEAYRNVLELLR--------
EIF3A_DROME       LDDLDN-IATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLR--------
EIF3A_DROPS       LDDLDN-IATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLR--------
W5JG72_ANODA      IDDLDN-LATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLK--------
EIF3A_ANOGA       IDDLDN-LATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLK--------
EIF3A_AEDAE       IDDLDN-LATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLK--------
E9GZK2_DAPPU      -DDLDN-VATPESILLSAVSGEDAQDRSDRVILTPWVKFLWESYRQCLELLR--------
E0VV02_PEDHC      IDDLDN-LATPESILLSAVCGEDAQDRSDRTILTPWVKFLWESYCQCLELLR--------
EIF3A_CAEBR       IGDLDQ-GDVPERLLLAVVSGAAAQDRMDRTVLAPWLRFLWDSYRNCLELLR--------
EIF3A_CAEEL       IGDLDQ-GDVPERLLLAVVSGAAAQDRMDRTVLAPWLRFLWDSYRNCLELLR--------
EIF3A_YEAST       DDDLEG-GVTPENLLISVYESDQSVAGFNDEAITSWLRFTWESYRAVLDLLR--------
EIF3A_CANGA       SDDLEG-GVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWESYRTALDLLR--------
EIF3A_VANPO       DDDLEG-GVTPENLLKSVYIQDQSVAGFNDEVVTSWLKFTWESYRAVLDLVR--------
EIF3A_KLULA       EEDLEG-GVTPENLLVSVYEQEQTVGGFNNDDVSAWLRFTWESYRTTLDFLR--------
EIF3A_CANAL       DDDLET-AQTPESILLSAVSNTDSADRTERELVTPWLRFLWEAFRAVLDILR--------
EIF3A_EMENI       VEDLEA-IETPETILLATVSGEQSRDRTDRAVVTPWLKFLWETYRTVLEILK--------
EIF3A_ASPFU       VEDLEA-IETPETILLATVSGEQSRDRTDRAVVTPWLKFLWETYRTVLEILK--------
C0NC78_AJECG      IEDLDA-IETPETILLATVSGEQSRDRTDRAIVTPWLKFLWETYRTVLEILK--------
Q0V6S4_PHANO      IDDLEA-SETPESILLSTVSGEQSRDRTDRAIVTP-------------------------
C7YNL9_NECH7      VDDLEA-SETPESILLATVSGEQSRDRTDRAIVTPWLKFLWEAYRTVLDILR--------
EIF3A_NEUCR       IDDLEA-SETPESILLATVSGEQSRDRTDRAIVTPWLKFLWEAYRTVLDILR--------
A7F4P3_SCLS1      VDDLEA-TETPESILLSTVSGEQSRDRTDRAIVTPWLKFLWETYRTVLDILR--------
D5GPY7_TUBMM      IDDLEA-SETPESILLSTVSGEQSRDRTDRAVVTPWLKFLWETYRTVLDILR--------
EIF3A_SCHPO       VDDLEA-TETPESIMMSLVSGDLSKSRTDRALVTPWLKFLWDAYRTVLDILR--------
A8P1V9_COPC7      VDDLEA-SETPESILLGAVSGDQSKDRTDRAVVTPWLKFLWESYRTSLETLK--------
EIF3A_USTMA       VDDLEE-SETPESMLLGSVSADQNKDRTDRVLVTPWLKFLWEAYRTALDILR--------
F4NW26_BATDJ      VDDLEA-FETPESILMSTVSTDDTKDRTDRAVVTPWLRFLWEAYRTSLDTLR--------
EIF3A_YARLI       ADDLEA-EETPEDLLLATVSSEDTKDRTDRRVVTPWLKFLWEAYRSVLDVLR--------
EIF3A_ARATH       VDDLEA-DRKPEDLQLSIVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILR--------
F6I4Q7_VITVI      VDDLEA-DKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILR--------
C5XM02_SORBI      VEDLEA-DKRPEDLMLSFVSGEKGKDRSDKEVVTPWFKFLWETYRTVLEILR--------
A9RFG7_PHYPA      VEDLEA-EKRPEDLMLSYVSGERGKERSDRETVTPWFKFLWETYRTVLEILR--------
A9SFU3_PHYPA      VEDLEA-EKRPEDLMLSYVSGERGKERSDRETVTPWFKFLWETYRTVLEILR--------
A8HRF8_CHLRE      VEDLEE-DASPEELMLSYVSGEKNKDRTDRELVTPWFRFLWESYRSVLEILR--------
D0P3U0_PHYIT      KVDLDA-AQTPEDVMLSTTTFEGSNDRTDREVVVPWLRFMWETYRTVLDILK--------
H3GEW8_PHYRM      KVDLDA-AQTPEDVMLSTTTFEGSNDRTDREVVVPWLRFMWETYRTVLDILK--------
Q4UGH6_THEAN      VEEGMEYDETPEGLMASTLQVEMRDQCSKT--LHDVYRFLWEIYKMILDISR--------
Q4N979_THEPA      VEDGMEYDETPEGLMASTLQVEMRDPHSKT--LHDVYRFLWEIYKMILDITR--------
A7AQQ1_BABBO      AGFDAEYGEAPEEIMAFTLQLEVRDATARQ--LQNVYRFLWETYKMILDIMR--------
Q8I5S6_PLAF7      IEQEESNVDVTEKILMASLDIEITGKHERK--LQNAYRICMETYKMILEILR--------
Q7RG05_PLAYO      IEQEESNVDFTEKILMNSLDMEITGKYERK--LQNAYKICMETYKMILEILR--------
B3LCC3_PLAKH      IEQDESNVDFTEKILISSLDIEIAGKYERK--LQNAFRICMETYKMILEILR--------
A5JZU1_PLAVS      IEQDESNVDFTEKILMSSLDIEISGKYERK--LQNSFRICMETYKMILEILR--------
G4V5Q4_SCHMA      IEDLDV-LETPESLMLNAVSMEGTQDRSARTILMPWLKFLWDSYRLVLDLLR--------
EIF3A_CRYNJ       VVDDDLPLQPASLMLDCFVDSAGDRERIERRLIAPAQKFCWDSYDICLDIAK--------
EIF3A_MONBE       IDDLEE-AQTPEQVLLAAVSADGETERANRVQLMPWLRYLWEAYRAVLELLR--------
B7G0T8_PHATC      GDDEDGFRASPQAILLSTMSTDPAKSQRDSALLVPSLKFLWETYRAVLDILR--------
                             .                    :                           

EIF3A_DICDI       TKFDHSKFDSTLLKISTQALNYCSKYQRKPDFMVLTELFRSSIEQLFKVP----------
F0ZBR6_DICPU      AKFDHSKFDPILLKISIQALNYCLKYQRKPDFMVLTETFRSSIEALFKAP----------
D3BGC0_POLPP      ----HNKLEAIYQKISAQAINFCQVYDRKKDFYRIGEIFRNHVENLIKSAN---------
EIF3A_HUMAN       ---NNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQI-----------QRH
G1P5I7_MYOLU      ---NNSRVERLYHDIAQQAFKFCLQYTRK-EFRKLCDNLRMHLSQI-----------QRH
G1LTU8_AILME      ---NNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQI-----------QRH
EIF3A_MOUSE       ---NNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQI-----------QRH
H0WQ74_OTOGA      ---NNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQI-----------QRH
EIF3A_RAT         ---NNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQI-----------QRH
EIF3A_DANRE       ---NNSKVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLGQI-----------QRH
H3B4Y5_LATCH      ---NNSKVERLYHDIAQQAFKFCLLYTRKAEFRKLCDNLRMHLGQI-----------QRH
EIF3A_XENTR       ---NNSKVERLYHDIAQQAFKFCLLYTRKAEFRKLCDNLRMHLSQI-----------QRH
B7Q355_IXOSC      ---NNSRVECLYHDIARQAFKFCLKYNRKTEFRKLCDHLRTHLGQI-----------HRH
C3YRF7_BRAFL      ---NNSRVERLYQDIAQQAFQFCLKYSRKTEFRKLCDNLRSHLQQVL----------NRH
EIF3A_NEMVE       ---NNVRVEKLYHETAQQAFKFCLKYTRRTEFRKLCDNLRNHLNVT-----------LKH
EIF3A_DROME       ---VNTHCEALYHDIARMAFQFCLKYNRKSEFRRLCDKLRKHLEDI-----------CKS
EIF3A_DROPS       ---VNTHCEALYHDIARMAFQFCLKYNRKSEFRRLCDKLRKHLEDI-----------CKS
W5JG72_ANODA      ---VNSHCETLYHDIARMAFSFCLKYSRKMEFRKLCEKLRKHLEDI-----------CKV
EIF3A_ANOGA       ---VNSHCETLYHDIARMAFQFCLKYNRKMEFRKLCEKLRKHLEDI-----------CKV
EIF3A_AEDAE       ---VNSHCENLYHDIAKMAFGFCLKYNRKMEFRKLCEKLRKHLEDI-----------SKV
E9GZK2_DAPPU      ---TNSRVEKLYHDTAQHAFKFCLKYARKTEFRKLCENLRSHLALM-----------VKG
E0VV02_PEDHC      ---TNVHVETLYHDIARMTFQFCLKYNRKTEFRKLCDKLRKHLEDI-----------GKL
EIF3A_CAEBR       ---NNAQVEQLYHTISRHSFSFCLRYQRRTEFRKLCDLLRMHLNQIQKH----Q---YAP
EIF3A_CAEEL       ---NNAQVEQLYHTISRHSFTFCLRYQRRTEFRKLCDLLRMHLNQIQKH----Q---YAP
EIF3A_YEAST       ---NNALLEITYSGVVKKTMHFCLKYQRKNEFKRLAEMLRQHLDAANYQ----Q---SK-
EIF3A_CANGA       ---NNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYH----Q---SK-
EIF3A_VANPO       ---NNSQLEITYAGVVNRTMQFCLKYNRKNEFKRLAEMLRQHLDAANYQ----Q---SK-
EIF3A_KLULA       ---NNSQLEITYAGVVNRTMQFCYKYNRKNEFKRLAEMLRQHLDAANYQ----Q---QR-
EIF3A_CANAL       ---NNSKLEITYSAIVNQAFKFCLNFNRKAEFRRLCELLRTHMQSVTTQ----T---TTK
EIF3A_EMENI       ---NNARLEIMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAK-----------Y
EIF3A_ASPFU       ---NNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAK-----------Y
C0NC78_AJECG      ---NNARLEVMYQATALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAK-----------Y
Q0V6S4_PHANO      -------------MAEVPAFQFCSKYARKTEFRRLCELLPQPFAECCQV----------L
C7YNL9_NECH7      ---NNARLEILYQSTATQAFDFCLKYTRKTEFRRLCELLRNHVQTAAK-----------Y
EIF3A_NEUCR       ---NNARLEVLYQSTAMQAFDFCLKYTRKTEFRRLCELLRNHVQTAAK-----------Y
A7F4P3_SCLS1      ---NNARLEIMYQSTAMQAFEFCQKYTRKTEFRRLCELLRNHVQTAAK-----------Y
D5GPY7_TUBMM      ---NNARLEIMYQSTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAK-----------Y
EIF3A_SCHPO       ---NNARLEVMYQLIANSAFQFCLKYQRKTEFRRLCELLRSHLGNASK-----------F
A8P1V9_COPC7      ---NNARLETIYQQIAQQAFKFCLKYERKVEFRRLCETLRLHLANVAK-----------Y
EIF3A_USTMA       ---NNARLEVPYQQIANQALKFCLQYQRKTEFRRLCEVLRQHLQNVAR-----------Y
F4NW26_BATDJ      ---NNARLEMLYQYVANQAFAFCLKYSRKTEFRRLCDILRQHLSSATK-----------Y
EIF3A_YARLI       ---NNSKLEVIYQQVVEQAFNFCLKFSRKTEFRRLCELLRSHLQTTAQKG---P---NAP
EIF3A_ARATH       ---NNSKLEALYAMTAHKAFQFCKQYKRTTEFRRLCEIIRNHLANL-----------NKY
F6I4Q7_VITVI      ---NNSKLEALYAMTAHRAFQFCKQYKRTTEFRRLCEIIRNHLSNL-----------NKY
C5XM02_SORBI      ---NNSKLEALYAMTAHRAFQFCKQYKRTTEFRRLCEIIRNHLANL-----------NKY
A9RFG7_PHYPA      ---NNSKLESLYAMTAHRAFQFCLQYKRTTEFRRLCEILRNHLTNL-----------NKY
A9SFU3_PHYPA      ---NNSKLESLYAMTAHRAFQFCLQYKRTTEFRRLCEILRNHLINL-----------NKY
A8HRF8_CHLRE      ---TNPKLEPLYAMTATKAFHFCLQYKRTTEFKRLCDILRQHLVNLV----------NKF
D0P3U0_PHYIT      ---SNSKLEPLYKTTAMQAFDFCVEYQRKIEFRRVCEIMRNHLSALQKHVAAPT---SQS
H3GEW8_PHYRM      ---SNSKLEPLYKATAMQAFDFCVEYQRKIEFRRVCEIMRNHLSALQKHTAAPT---SQS
Q4UGH6_THEAN      ---ATPKLEKVYHETARKAITFCRENARLVEFKRLCDVMRGHYSFLLKVQ----------
Q4N979_THEPA      ---ATPKLEKVYHETARKAITFCRENSRLVEFKRLCDVMRGHYAFLLKVQ----------
A7AQQ1_BABBO      ---ATPKLERVYHDTARKAIQFCKENGRLSEFKRLCEVLRAHNAFLMKVK----------
Q8I5S6_PLAF7      ---ATPKLEKAYHETAKKAILFCKENKRVTEFKKLSDLLRNHYNLILRGK----------
Q7RG05_PLAYO      ---ATPKLEKAYHDTAKKALLFCKENKRLTEFKKLSDLLRNHYNLILRGK----------
B3LCC3_PLAKH      ---ATPKLEKAYHETAKKALIFCKENKRLTEFKKLSDLLRNHYNLILRGK----------
A5JZU1_PLAVS      ---ATPKLEKAYHETAKKALIFCKENKRLTEFKKLSDLLRNHYNLILRGK----------
G4V5Q4_SCHMA      ---SNSKLEKLYHEVAHDAYNFCLKYGRKTEFKKLCELIRQHTQKVQNQL---------Q
EIF3A_CRYNJ       ---SNDRLEVIYQSIAHRAFHFCKIHQRKADFRRLCEQRLRKDLANAA----------KY
EIF3A_MONBE       ---HHSKMEHAYHATARQAMRFCHQYERRNEFRRLCNMLSLHLNQWRTPYQ--------S
B7G0T8_PHATC      ---SNSKLEHVYHFAAQSALQFCQDYKRRMEFRNLCDMLRLHLGNLRQYGNLDANDDGKT
                                    :  :*    *  :*  : :                       

EIF3A_DICDI       ----------SLDTVNTHIEIRFHQLTVAISLGLYLIAYKSIEDINIMLFSLL-------
F0ZBR6_DICPU      ----------SLDTVNTHIEIRFHQLSVAISLGLYNIAYKSIEDINIMIFSLL-------
D3BGC0_POLPP      -------QYTTPDTIYTHIDVRFSQLNAAIAMGIWQEAFRSIEDIN-SLFGLL-------
EIF3A_HUMAN       HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
G1P5I7_MYOLU      HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
G1LTU8_AILME      HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFTLSK-------
EIF3A_MOUSE       HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
H0WQ74_OTOGA      HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
EIF3A_RAT         HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
EIF3A_DANRE       HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFALSK-------
H3B4Y5_LATCH      HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSK-------
EIF3A_XENTR       HNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFALSK-------
B7Q355_IXOSC      QSQQTAVNLNNPESQAMHLETRLVQLDSAIQMELWQEAYKATEDIHGLMTLSK-------
C3YRF7_BRAFL      QTQSTAINLNNADSQQLFLETRLVQLDSAITMELWQEAYKAVEDVWQLMNLSK-------
EIF3A_NEMVE       QGQPNSVNLNNPDSIQMHLETRLAQLDSAISMELWQEAFKAVEDVYGLMQLSK-------
EIF3A_DROME       SNQTTGVSINKVETQQLCLDTRLYLLDSAIQMELWQEAYKAIEDIHGLMALSK-------
EIF3A_DROPS       SNQTTGVSINKVETQQLCLDTRLYLLDSAIQMELWQEAYKAIEDIHGLMALSK-------
W5JG72_ANODA      SSQTANVSISKPETQQLNLETRLHQLDSAIQMELWLEAYKAIEDIHGLMALSK-------
EIF3A_ANOGA       SSQTANVTISKPETQQLNLETRLHQLDSAIQMELWLEAYKAIEDIHGLMQLSK-------
EIF3A_AEDAE       SSQTANVSISKPETQQLNLDTRLNQLDCAIQMELWLEAYKAIEDIHGLMTLSK-------
E9GZK2_DAPPU      TPSVTAVNLSNPETQQMNLETRLLQLDFAIQMELWQEAYKAIEDIHGLMILAK-------
E0VV02_PEDHC      APQVANVSISKPETQQLNLETRLYQLEYAIQMELWQEAYKAIEDIHNLMSLSK-------
EIF3A_CAEBR       NVNSFRVKLTSPESLTLMQDTRLVQLDTAIQMELWQEAYKSAEDVHGMMQLSKDKDK---
EIF3A_CAEEL       NVNSFRVKLTSPESLGLMQDTRLIQLDTAIQMELWQEAYKSAEDVHGMMQLSKDKDK---
EIF3A_YEAST       -SGNNLVDLSDADTLQRYLDQRFQQVDVSVKLELWHEAYRSIEDVFHLMKISK-------
EIF3A_CANGA       -FGSNQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTT-------
EIF3A_VANPO       -IGSNIVDLSDSETLQRYLDQRFLQLNVSVKLELWHEAFRSIEDVYHLMKMSK-------
EIF3A_KLULA       -YGHHTVDLSDPDTLQRYSDQRFQQVNVSVKLELWHEAFRSIEDVHHLMRLSK-------
EIF3A_CANAL       TSGHNAIDLSDAETVQRYLDQRFAQLNIAVKLELWQESFRSVDDVHSLITASK-------
EIF3A_EMENI       SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSK-------
EIF3A_ASPFU       SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSK-------
C0NC78_AJECG      SSQMHAINLSDPETLQRHLDTRFQQLNVAVELELWQEGFRSVEDIHTLLNLSK-------
Q0V6S4_PHANO      VTDACHQPLGHRTLCNATLIPRFQQLNVAVELELWQEAFRSVEDIHTLLSLSK-------
C7YNL9_NECH7      SSQMHAINLSDPDTLQRHLETRFQQLNVAVELELWQEAFRSVEDIHTLLNLSK-------
EIF3A_NEUCR       SAQMHAINLNDPDTLQRHLETRFQQLNVAVELELWQEAFRSVEDIHTLLSLSK-------
A7F4P3_SCLS1      SAQMHAINLNDPDTLQRHLETRFQQLNVAVELELWQEAFRSVEDIHTLLSLSK-------
D5GPY7_TUBMM      STQMHAINLNDPDTLQRHLDTRFQQLNVAVELELWQEAFRSVEDIHTLLNLSK-------
EIF3A_SCHPO       SNAPHSINLNDAETMQRHLDMRFSQLNVAVELELWQEAFRSIEDIHSLLTFSK-------
A8P1V9_COPC7      SHQQHSINLSDPDTLQNHLDTRFAQLNTSVELELWQEAFRSVEDVHNLLTLAK-------
EIF3A_USTMA       SHHAHAINLTDQDTLQRHLDTRFAQLNSAVELELWQEAFRSVEDIHNLLTMAK-------
F4NW26_BATDJ      QSHDHSIDLNDPETLQRHLDTRFVQLNAAAELEHWQEGFRSIEDIHHLLEVSK-------
EIF3A_YARLI       PVTATSVDLSDADTLQRYLDTRFSQLNVAVKLELWQEAFRSVEDVHTLLTVSK-------
EIF3A_ARATH       RDQRDRPDLSAPESLQLYLDTRFDQLKVATELGLWQEAFRSVEDIYGLMCMVK-------
F6I4Q7_VITVI      RDQRDRPDLSAPESLQLYLDTRFEQLKIATELELWQEAFRSVEDIHGLMCMVK-------
C5XM02_SORBI      RDQRDRPDLTAPESLQLYLDTRVEQLKVATELSLWQEAFRSVEDIHGLMSMVK-------
A9RFG7_PHYPA      RDQRDRPDLSQPESLQLYLETRFEQLKIATELELWQEAFRSIEDIHGLMSMVK-------
A9SFU3_PHYPA      RDQRDRPDLTQPESLQLYLDTRFEQLKIATELELWQEAFRSIEDIHGLMTMVK-------
A8HRF8_CHLRE      REQRD----AGPESMTMHLESRFEQLRVACELELWGEAFRSVEDIQQLISLTK-------
D0P3U0_PHYIT      TRQMRSWEGFTLDSVERLLEVRYRQLQVATDLELFSEAFRTIDDINNIMNLVE-------
H3GEW8_PHYRM      TRQMRSWEGFTLDSVERLLEVRYRQLQVATDLELFSEAFRTIDDINNIMNLVE-------
Q4UGH6_THEAN      ----NKPEMECMLKPELHIETRVNQLITACELGMWKEAFNTVEDLYTLGIRDYITKTFQG
Q4N979_THEPA      ----NKPEMECMLKPELHIETRINQLISACELGMWKEAFNTVEDLYTLGIRDYITKTFQG
A7AQQ1_BABBO      ----HKPEMECMLKPELHIETRINQLVAACDMSLWKEAFNTVEDLYMLGIRDYIAKTFQG
Q8I5S6_PLAF7      ----HKPEYQSLLKIEYHLETKIIQLEAACELAMWKEASNIAEDIYNLNMHDYFYKSLKS
Q7RG05_PLAYO      ----HKPEYQSLLKIEYHLETKIMQLETACELGMWKEASNIAEDIYNLNMHEYFYKTLKS
B3LCC3_PLAKH      ----HKPEYQSLLKIEYHLETKIIQLETACELGMWKEASNIAEDIYNLNMHDYFYRTLRA
A5JZU1_PLAVS      ----HKPEYQSLLKIEYHLETKIIQLEAACELGMWKEASNIAEDIYNLNMHDYFYRTLRA
G4V5Q4_SCHMA      PNALNAINLNNAETQTLHLETRLRQLDCAMELDMYNEAFKTVEDIWSFMMISR-------
EIF3A_CRYNJ       SHQQHAINLSDPETLGRFLDTRFLQLETAVELELWQEAFRSIEDVHGLIAGRK-------
EIF3A_MONBE       KSGQAGIDINNPQTIQYSLDTRFELISYAGKLEQWQEAFRAMEEVTGLLDSAP-------
B7G0T8_PHATC      NNKVRGWEGWTTESIELHLQTRFIQLETASVLHRYTEGFRTCEDIFNILQISQARRKHNP
                                       :   :  :  :  :  . .  :::               

EIF3A_DICDI       ------------------------------------------------------------
F0ZBR6_DICPU      ------------------------------------------------------------
D3BGC0_POLPP      ------------------------------------------------------------
EIF3A_HUMAN       ------------------------------------------------------------
G1P5I7_MYOLU      ------------------------------------------------------------
G1LTU8_AILME      ------------------------------------------------------------
EIF3A_MOUSE       ------------------------------------------------------------
H0WQ74_OTOGA      ------------------------------------------------------------
EIF3A_RAT         ------------------------------------------------------------
EIF3A_DANRE       ------------------------------------------------------------
H3B4Y5_LATCH      ------------------------------------------------------------
EIF3A_XENTR       ------------------------------------------------------------
B7Q355_IXOSC      ------------------------------------------------------------
C3YRF7_BRAFL      ------------------------------------------------------------
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       ------------------------------------------------------------
EIF3A_DROPS       ------------------------------------------------------------
W5JG72_ANODA      ------------------------------------------------------------
EIF3A_ANOGA       ------------------------------------------------------------
EIF3A_AEDAE       ------------------------------------------------------------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ------------------------------------------------------------
EIF3A_CAEBR       ------------------------------------------------------------
EIF3A_CAEEL       ------------------------------------------------------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      SVSV--------------------------------------------------------
Q4N979_THEPA      SVSV--------------------------------------------------------
A7AQQ1_BABBO      SVSV--------------------------------------------------------
Q8I5S6_PLAF7      NIMMEPELVSVIDTVKSGDKNEEEKNKVNDVDADAKAKEDILKGVEQQDNNVENNNNNNN
Q7RG05_PLAYO      GAM---------------------------------------------------------
B3LCC3_PLAKH      NLVESEASGAGESSTRKADKEKG-----------------------QLKSDGKESSKKGK
A5JZU1_PLAVS      NLVETEASAAGESAARKADKEKG-----------------------PLKSDSNETSKKGK
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      DV----------------------------------------------------------
                                                                              

EIF3A_DICDI       ------------------------------------------------------------
F0ZBR6_DICPU      ------------------------------------------------------------
D3BGC0_POLPP      ------------------------------------------------------------
EIF3A_HUMAN       ------------------------------------------------------------
G1P5I7_MYOLU      ------------------------------------------------------------
G1LTU8_AILME      ------------------------------------------------------------
EIF3A_MOUSE       ------------------------------------------------------------
H0WQ74_OTOGA      ------------------------------------------------------------
EIF3A_RAT         ------------------------------------------------------------
EIF3A_DANRE       ------------------------------------------------------------
H3B4Y5_LATCH      ------------------------------------------------------------
EIF3A_XENTR       ------------------------------------------------------------
B7Q355_IXOSC      ------------------------------------------------------------
C3YRF7_BRAFL      ------------------------------------------------------------
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       ------------------------------------------------------------
EIF3A_DROPS       ------------------------------------------------------------
W5JG72_ANODA      ------------------------------------------------------------
EIF3A_ANOGA       ------------------------------------------------------------
EIF3A_AEDAE       ------------------------------------------------------------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ------------------------------------------------------------
EIF3A_CAEBR       ------------------------------------------------------------
EIF3A_CAEEL       ------------------------------------------------------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      ----------------------------------------------------------LG
Q4N979_THEPA      ----------------------------------------------------------LG
A7AQQ1_BABBO      ----------------------------------------------------------LG
Q8I5S6_PLAF7      NNNDNNNNNNNNNNNNNNNNKEDEEDGKIQSGDTITKTTDGNVGTGHNTSHS------LN
Q7RG05_PLAYO      -ESDMNNNADQNDSKKKSSDKDEEKD-------TNEATTSGGVASTSAIASQ------NK
B3LCC3_PLAKH      DESKQGEDVEEDSSKVEKKDGTMEETEKDGANETKDNKVEGAHTVIHVNESSGNVNYALA
A5JZU1_PLAVS      DESTQEE--EDDSSKAEKEDGANETKD------AKDAKVEGTHTVAHVNESSGNVNYALA
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      ------------------------------------------------------------
                                                                              

EIF3A_DICDI       --VKPKPVVLATYYQKLAQVYWITN---AHLLHAYALYKHYVYNKNYNM-----------
F0ZBR6_DICPU      --AKPKPVVLATYFQKLAQVYWITN---AHLLHAYALYKHFFYNKNYNM-----------
D3BGC0_POLPP      --AKPKPNVLAAYFQKLAQIYWVAG---SHLLHAYALYKHLYYNKTYNT-----------
EIF3A_HUMAN       --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
G1P5I7_MYOLU      --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
G1LTU8_AILME      --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
EIF3A_MOUSE       --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
H0WQ74_OTOGA      --KPPKPQLMANYYNKVSTVFWKSG---NVLFHASTLHRLYHLSREMRK-----------
EIF3A_RAT         --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
EIF3A_DANRE       --KPPKPQLMANYYNKVSTVFWKSG---NALFHSCTLHRLYHLSREMRK-----------
H3B4Y5_LATCH      --KPPKPQLMANYYNKVSTVFWKSG---NALFHASTLHRLYHLSREMRK-----------
EIF3A_XENTR       --KPPKPQLMANYYNKVSTVFWKSG---NTLFHASTLHRLYHLSREMRK-----------
B7Q355_IXOSC      --KSPKPQLMANYYQKLALVFWKAG---NRLFHASALFRYFHLAKDLKK-----------
C3YRF7_BRAFL      --KPPKPQLMANYYTKLGMVFWKSG---NQLFHASALHRLFHLSKEQRK-----------
EIF3A_NEMVE       --RPPKPQVMANYYQKVALVFLKAG---NFLYHACTQQRLYLLMREQKK-----------
EIF3A_DROME       --KTPVPKTMANYYQKLAMVFSKAG---NQLFHAAALLKLFQLTRELKK-----------
EIF3A_DROPS       --KTPVPKTMANYYQKLAMVFSKAG---NQLFHAAALLKLFQLTRELKK-----------
W5JG72_ANODA      --KTPLPKTMAMYYQKLAMVFWKAG---NQLFHAAALLKLFQLSRDMKK-----------
EIF3A_ANOGA       --KTPLPKTMALYYTKLAMVFWKAG---NQLFHASALLKLFQLSRDMKK-----------
EIF3A_AEDAE       --KTPMPKTMALYYQKLAMVFWKAG---NQLFHAAALLKLFQLSRDMKK-----------
E9GZK2_DAPPU      --KMPRPQQMAQYYQKIALVFGKSG---NHLFHAAALFRLFQLSRDLKK-----------
E0VV02_PEDHC      --KSPMPKTMANYYQKLALVFWKAG---NYLFHAAALFKLFQLSKEMKK-----------
EIF3A_CAEBR       --RTVKPSSYVNYYDKLALVFWKAG---NRLFHAAALLQKFIIYKDMKK-----------
EIF3A_CAEEL       --RTVKPASYVNYYDKLALVFWKAG---NSLFHAAALLQKFIIYKDMKK-----------
EIF3A_YEAST       --RAPKPSTLANYYENLVKVFFVSG---DPLLHTTAWKKFYKLYSTNPR-----------
EIF3A_CANGA       --RKPKSSTLANYFENLVQIFLVSG---DQILHTLAWKKYFELYSTNPN-----------
EIF3A_VANPO       --HTPKSSTLANYYENLAKVFLISN---AQLLHTATWEKFYRLYQSNPN-----------
EIF3A_KLULA       --RAPKPSVLANYYENLAKIFFVSG---NYLLHAAAWEKFYNLYLKNPN-----------
EIF3A_CANAL       --KAPKPNMMANYYENLARIFAVSD---NTLYHAAAWNKFFNLYSQSPL-----------
EIF3A_EMENI       --RPAKNVMMANYYEKLARIFLVSE---NYLFHAAAWSRYYNLLRQSAVTLSTNQGS-KK
EIF3A_ASPFU       --RPAKNVMMANYYEKLARIFLVSE---NYLFHAAAWNRYYNLLRQSAAALAAGQGT-KK
C0NC78_AJECG      --RPAKNIMMANYYEKLTRIFLVSE---NYLFHAAAWSRYYNLLRQSS---GAGPGS-KK
Q0V6S4_PHANO      --RPAKNVMMANYFEKLTRIFLVSE---NYLFHAAAWSRYYNLLRQSAAAVASGQSP-KK
C7YNL9_NECH7      --RPAKNVMMANYYEKLTRIFLVGE---NYLFHAAAWSRYYTLLRQSSVLVASGQGK-KS
EIF3A_NEUCR       --RPAKNVMMANYYEKLTRIFLVGE---NYLFHAAAWARYYNLLRQSAALIASGHSK-KA
A7F4P3_SCLS1      --RPPKNVMMANYYEKLTRIFLVGE---NYLFHAAAWSRYYNLLRQSAQMVAAGQSK-KS
D5GPY7_TUBMM      --RPAKNVMMANYYEKLTRIFLVSD---NYLFHAAAWSRYYNLLRTSAAQVAAGSAPVKK
EIF3A_SCHPO       --RAPAAVMLGNYYRKLIKIFLVCD---NYLLHAAAWNRYFTFT----------------
A8P1V9_COPC7      --KAPRPAMMANYYEKLTKIFLMSG---NALFHAAAWGRYYAIVTSIGG-----------
EIF3A_USTMA       --KAPRPAMMANYYEKLARIFMVSD---NNLFHAAAWNRYYALARSIA------------
F4NW26_BATDJ      --NAPKSYMMANYYEKLARIFMVGE---NYLFHSAALSKFYSIMRQNKN-----------
EIF3A_YARLI       --RPAKPLMMGNYYENLARIFLVAG---NYLFHAAAWNKLFHLLSQSPR-----------
EIF3A_ARATH       --KTPKSSLLMVYYSKLTEIFWISS---SHLYHAYAWFKLFSLQKNFNKNLS--------
F6I4Q7_VITVI      --KTPKASLMVVYYAKLTEIFWVSS---SHLYHAYAWFKLFSLQKSFNKNLS--------
C5XM02_SORBI      --KMPKPSILVVYYAKLTEIFWISD---SHLYHAYAWLKLFNLQKSYNKNLS--------
A9RFG7_PHYPA      --RTPKPQMMAVYYAKLTLIYWVSD---NHLYHAYAWYKLYNLQKSYNKNLT--------
A9SFU3_PHYPA      --RTPKPQMMAVYYAKLTQIYWMSD---NHLYHAYAWYKLYNLQKSYNKNLT--------
A8HRF8_CHLRE      --KTPKQPQLASYYTRLTQIFAVSD---SPMYHAFAWLKLFSFARQHARGMS--------
D0P3U0_PHYIT      --QTPRVDLLVTYYEKLAQIFQVSK---NHLFHAYALYKWYSLRVAGLQGLAGSQAL-QE
H3GEW8_PHYRM      --QTPRVDLLVTYYEKLAQIFQVSK---NHLFHAYALYKWYSLRVAGLQGLAGAQAL-QE
Q4UGH6_THEAN      QQKEKLLKWLAIFYEKLALIFWASD---LLLFHALAVLRYVMHIRMYKK-----------
Q4N979_THEPA      QQKEKLLKWLAIFYEKLALIFWVSD---LLLFHALAVLRYVMHIRMYKK-----------
A7AQQ1_BABBO      QQREKLLKWLAIFYEKLALIFLVAD---LHLFHALAVLRYVMHIRMYKK-----------
Q8I5S6_PLAF7      QSKEKLRNWIAIFYEKMADILFVYE---SELFHGLAWLKYCFHILNFKR-----------
Q7RG05_PLAYO      Q-KENLKKWIATFYEKLADILFVYE---SELFHGLAWLKYCFHILNYGI-----------
B3LCC3_PLAKH      KSRDNLKNWVGTFYQRMAEILFVYE---SELFHGLAWLKYCFHILNYSK-----------
A5JZU1_PLAVS      KSRENLKNWIGTFYQRMADILFVYE---SELFHGLAWLKYCFHILNYSR-----------
G4V5Q4_SCHMA      --IHAMPSLMTNYYSKTAELFRRCG---CHLYHAAALHKLYTLYRDQKK-----------
EIF3A_CRYNJ       ---GTKPSMMANYYEKLTQIFKAEGGKQTAVFHAAAWARYFQHAERAGI-----------
EIF3A_MONBE       --EKPSPPVWGIYYHKLAQIFWRSK---DYAFHAAAWHQMFDNAIRNAK-----------
B7G0T8_PHATC      --PAPKAKLMASYYEKLTTLFWVSE---NYLFHAFAWYKYYTLCKEFNR-----------
                              :: .   :            *  :  :                     

EIF3A_DICDI       ---NFTQADSQLYSSVLLVAALSSPIQEVNQNQ---------------SLLQFDSQSQRA
F0ZBR6_DICPU      ---NFSPEDTQLYSSVLLVAALSSPIQENNTNN---------------SLLQFDSQSQRA
D3BGC0_POLPP      ---NFSNEDSMLFSSVLLVAAISSPVQESSQS----------------SLLQFDAQSQRN
EIF3A_HUMAN       ---NLTQDEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
G1P5I7_MYOLU      ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
G1LTU8_AILME      ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
EIF3A_MOUSE       ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
H0WQ74_OTOGA      ---NLTQDEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
EIF3A_RAT         ---NLTQDEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-Q
EIF3A_DANRE       ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-H
H3B4Y5_LATCH      ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIIVEK-H
EIF3A_XENTR       ---NLTQEEMQRMSTRVLLATLSIPITPERT------------DIARLLDMDGIILEK-Q
B7Q355_IXOSC      ---NITSEEIQKMASRVVLATLAVPMPPNRP------------EIDRLVETEENVNDKSH
C3YRF7_BRAFL      ---NLSLDELQKMASQVVLATLSIPISQPAT------------EFDKLLDMEGVSMEK-A
EIF3A_NEMVE       ---SITSEELQKMASHVLLATLSVPIQVSLS------------NTEKYLELDEVAREK-S
EIF3A_DROME       ---NLTKDDLQRMAAHVLLATLSIPLPSAHP------------EFDRFIEADKSPLEK-A
EIF3A_DROPS       ---NLTKDDLQRMAAHVLLATLSIPLPSAHP------------EFDRFIEADKSPLEK-A
W5JG72_ANODA      ---NVTAEEIQRMTTHVLIATLAIPLPSAHP------------EFDRFIETDKSPMEK-A
EIF3A_ANOGA       ---NVTAEEIQRMTTHVLIATLAIPLPSAHP------------EFDRFIETDKSPMEK-A
EIF3A_AEDAE       ---NVTQEEIQRMTSHVLIATLAIPLPSAHP------------EFDRFIETDKSPLEK-A
E9GZK2_DAPPU      ---NITTEELQKLGSRVLVATLAVPLPSAHP------------EFDRFIETEKSAMEK-T
E0VV02_PEDHC      ---NMSAEELQRMACRVLLATLSIPLPSAHP------------EFDRFIETDRSPLEK-V
EIF3A_CAEBR       ---SFTQEEAQEQATRVLLATLSIPEGSDLPS-----------DLSRNLDIEEQHVAN-M
EIF3A_CAEEL       ---SFTQDEAQEQATRVLLATLSIPEGSDSPS-----------DLSRNLDIEDQHVAN-M
EIF3A_YEAST       ----ATEEEFKTYSSTIFLSAISTQLDEIPSI---------------------GYDPH--
EIF3A_CANGA       ----ATEEEFKKIASTIFLSALSIQLDDLPNV---------------------RYNYQ--
EIF3A_VANPO       ----ATEEDFKKYSSIILLSALSTPLDILPTV---------------------GYDPQ--
EIF3A_KLULA       ----ASEEDFKFYSSQFVLSALAIQLDDLPIA---------------------GFDPQ--
EIF3A_CANAL       ----ATDEELKRYASVLVLSTLSIPQRVVQDV---------------------DEHKSKN
EIF3A_EMENI       DHPSVTEADMTKAASFVLLSALAIPVISTSRS-------------RGALIDVDEVRKNKN
EIF3A_ASPFU       ENPSVTEADMTKAASFVLLSALSIPVISTSRS-------------RGALVDVDEARKNKN
C0NC78_AJECG      DNLVVSEAEMTKTASFVLLSALSIPVISTSRS-------------RGALVDVDEVRKNKN
Q0V6S4_PHANO      DNPAVTEADMTKAASFVVLSALAIPVISTSRS-------------RGALVDVDEARKNKN
C7YNL9_NECH7      ENPPASEADLQKAASFVLLSALAIPVISTSRS-------------RGAMVDFDEARKNKN
EIF3A_NEUCR       DNPACSDADLQRAATFVILSALSIPVISTSRS-------------RGAMVDFDEARKNKN
A7F4P3_SCLS1      DNPATSEADLSKAASFVLLSALAIPVISTSRS-------------RGALIDVDEQKKNKN
D5GPY7_TUBMM      DFPAASDADLSRAASLYLLAALSIPVISQARS-------------KGALLDVDEAKRNKN
EIF3A_SCHPO       ------NVQKPATANFVILSALSIPIIDANKL-------------SGPSIEAEDAK-SKN
A8P1V9_COPC7      ----KSEEEMSRLAGQVLVSALAVPVGANAEP---------------------EELKGKN
EIF3A_USTMA       ----KSEQEHTQIASYVLISALAVPVISSNAPGTGN-----LHKSKSDFLQADHEARSRT
F4NW26_BATDJ      ----LPQEEHERLASLVLVSVLSIPIIVLSGS----------------RTAEADESKQRT
EIF3A_YARLI       --GAIPVSEYQRVASFVLLSALAIPHNSSAED------------------------RYRN
EIF3A_ARATH       ------QKDLQLIASSVVLAALSIPPFDRA-------QSASHMELENEKERNLRMANLIG
F6I4Q7_VITVI      ------QKDLQLIASSVVLAALSVTPYDLT-------RGASHLELENEKERNLRMANLIG
C5XM02_SORBI      ------QKDLQLIASSVLLAALSVAPYDQK-------YGASHLETENEKERNMRMANLVN
A9RFG7_PHYPA      ------AKDLQLMASAVVLATLAVPPYDRK-------HGAHHFELEMEKDRNIRMANILG
A9SFU3_PHYPA      ------AKDLQLMASSVVLATLAVPPYDRK-------HGAPHSELEIEKDRNIRMANILG
A8HRF8_CHLRE      ------QTDYQQMATAVLLAALAILPYERSNTPGARGAPSDAVAAEQEKERANRMATILG
D0P3U0_PHYIT      LPVLVSEGEQKEMATRVVLAALSIPLLDFEASSSVL-GDDETSAAQTAESSLSAAARDKN
H3GEW8_PHYRM      LPVQVSVDEQKEMATRVVLAALSIPLLDFEASSSVL-GDD--SAAQVAESSLSAAARDKN
Q4UGH6_THEAN      ---KVTEEEITYLCSKCVLAVLSVPNHALSQS-----------SS----TASSTAVYEMQ
Q4N979_THEPA      ---KVTEEEITYLCSKCVLAVLSVPNHSLSPS-----------SS----TASSTAVYEMQ
A7AQQ1_BABBO      ---KVAPEDVQYMCSKAVMAVLAVPEHSKNES-----------ETGDLMSSLSTSVYEMQ
Q8I5S6_PLAF7      ---NMTEKEKTYICNKAVLAVLSIPVIG-----------------NKKKSEDFTKQFEAH
Q7RG05_PLAYO      ---EISEERKKFICTKAVLAVLSIPRIG-----------------NKK-NEDYAKIFEAH
B3LCC3_PLAKH      ---NIPEKEKTFICTKAVLAVISIPLVG-----------------NKKKNEDYAKIFEAH
A5JZU1_PLAVS      ---NIPEKEKTFMCTKAVLAVLSIPLVG-----------------NKKKNEDYAKIFEAH
G4V5Q4_SCHMA      ---NITREELSDLGSRVLCATVAIPLPNAKLN--------------ADKFLSGEYTIMKQ
EIF3A_CRYNJ       --------VNDKASGCVLLSALAVPLGEVEVK----------------------------
EIF3A_MONBE       ---SFNRDDIQYAASAVLLASLTVPLANLDTM------------VKPMEGYLPEVRASRQ
B7G0T8_PHATC      ---GMSEDTKRMQASAVLLAALCIPSVPANESK-----ASHSNQHTIATTVEDGIVKQKM
                                   . : :                                      

EIF3A_DICDI       MGLASLLSL-QSIPKRETFLVDVRKVT---NEVYPELADLASIFEK--------------
F0ZBR6_DICPU      MGLASLLSL-QSIPRRETFLQDVRKVT---GDVYPELADLFSIFEK--------------
D3BGC0_POLPP      TSLASLLGL-SAYPKRETFIAEVRRIA---TNVYPELADLMNTFDR--------------
EIF3A_HUMAN       RRLATLLGL-QAPPTRIGLINDMVRFN-VLQYVVPEVKDLYNWLEV--------------
G1P5I7_MYOLU      RRLATLLGL-QAPPTRIGLINDMVRFN-VLQYVVSEVKDLYNWLEV--------------
G1LTU8_AILME      RRLATLLGL-QAPPTRIGLINDMVRFN-VLQYVVPEVKDLYNWLEV--------------
EIF3A_MOUSE       RRLATLLGL-QAPPTRIGLINDMVRFS-VLQYVVPEVKDLYNWLEV--------------
H0WQ74_OTOGA      RRLATLLGL-QAPPTRIGLINDMVRFN-VLQYVVPEVKDLYNWLEV--------------
EIF3A_RAT         RRLATLLGL-QAPPTRIGLINDMVRFN-VLQYVVPEVKDLYNWLEV--------------
EIF3A_DANRE       RRLATLLGL-QSPPTRQSLINDMVRFN-LLQYVVPEVKELYNWLEV--------------
H3B4Y5_LATCH      RRLATLLGL-QSPPTRQTLINDMVRFN-VLQYVVPDVKEVYNWLEV--------------
EIF3A_XENTR       RRLATLLGL-QAPPTRVGLINDMVRFN-MLQYVVPEVKELYNWLEM--------------
B7Q355_IXOSC      RLLATLLGL-NTPPTRASLVKELVRLG-VVGLAPLQLQDLYRWLEV--------------
C3YRF7_BRAFL      RRLATLLGL-QGLPTRASLIKDMVRSG-VLQHVHPQLQGLYEWLEVRSGVLQHVHPQLQG
EIF3A_NEMVE       KRLANLLNL-QNTPTRESLLQDMLKAN-VLQYVNTKVHCLYQLLEK--------------
EIF3A_DROME       QKLAVLLGL-PQPPTRVSLIREVVRLN-VPQLVSEDFRNLYNWLEV--------------
EIF3A_DROPS       QKLAVLLGL-PQPPTRVSLIREVVRLN-VPQLVSEDFRNLYNWLEV--------------
W5JG72_ANODA      QRLAFLLGL-QQSPSRALLLKELIRLN-VLQLAAPQFRNLYTLLEV--------------
EIF3A_ANOGA       QRLAFLLGL-QQSPSRALLLKELIRLN-VLQLAAPQFRHLYQLLEV--------------
EIF3A_AEDAE       QKLAVLLGL-QQPPTRASLLKDVLRLN-VLQLAAPQFQNLYKWLEV--------------
E9GZK2_DAPPU      QKLATLLHL-NQPPTRNGLIKDLVRLG-VVATAMPQLQQLYHFLEV--------------
E0VV02_PEDHC      QRLATLLGL-SQPPTRASLLKDIIRVN-VVNLASKQLQDLYSWLEV--------------
EIF3A_CAEBR       RLLSNLLRL-PIAPTKVGILKEAARIG-VPEAAGQVAKDLFKLLES--------------
EIF3A_CAEEL       RLLSNLLRL-PIAPTKNGILKEAARIG-VPEAAGQTAKDLYKLLES--------------
EIF3A_YEAST       LRMYRLLNL-DAKPTRKEMLQSIIEDESIYGKVDEELKELYDIIEV--------------
EIF3A_CANGA       SRSYRLLDV-ETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIMEV--------------
EIF3A_VANPO       MRLYRLLGL-ESRPTRNEMIELAKQED-IYKHIDEDIIKLYEIMEI--------------
EIF3A_KLULA       IRLCDLLDL-ESKPKRKDLITAAGEQQ-VVEKADADILKFFNILET--------------
EIF3A_CANAL       SKLSSLLNL-THVPTREGLIKSILSRS-ILKYVDEPIQQLFELLEGG-------------
EIF3A_EMENI       TRLTNLLGM-LQSPTRAVLFRDALNKG-LLKRVRPEIRELYNILEV--------------
EIF3A_ASPFU       ARLTNLLGM-AQPPSRAVLFRDALNKG-LLKRARPEIRDLYNILEV--------------
C0NC78_AJECG      TRLTNLLGM-PQAPTRAGLFKDALNKG-LLTRCRPEIRDLYNILEV--------------
Q0V6S4_PHANO      SRLTNLLGM-SQAPTRAILFKDALSKG-LLKRVRPEIRDLYNILEV--------------
C7YNL9_NECH7      SRLTHLLGM-TQAPTRTRLFRDALSKS-LLQRARPEIRDLYNILEV--------------
EIF3A_NEUCR       SRLTHLLGM-AQAPTRAGLFRDALSKS-LLRRAQPQIRDLYNILEV--------------
A7F4P3_SCLS1      SRLTHLLGM-GQAPTRAVLFKDAMSKG-LLKRARPEIRELYNILEV--------------
D5GPY7_TUBMM      TRLTNLLGM-SRAPTRAALFKDAISKG-VLKRARPEIRDLYSILEV--------------
EIF3A_SCHPO       ARLALLLNL-SKTPTRETLIKDAISRG-VLSFCDQAIRDLYQILEV--------------
A8P1V9_COPC7      ARLTALLGL-NKMPSRARLLQDALARD-VLKLSPEPVKKLYNILEV--------------
EIF3A_USTMA       GRLTSLLGL-SRTPTRAGLLKEALNRD-ILKKARPELRELYNILEV--------------
F4NW26_BATDJ      QRLMTLLRV-TQLPTRESLLKEALGKN-VFPLVRPEIKHLYKSLEV--------------
EIF3A_YARLI       TRLTGLLNL-QRTPTRDALLKSALSRN-ILAHVKPEIKALYKTLEV--------------
EIF3A_ARATH       FNLEPKFEG-KDMLSRSALLSELVSKG-VLSCASQEVKDLFHVLE---------------
F6I4Q7_VITVI      FNLEPKLDG-REVLSRSALLSELVSKG-VMTCVTQEVKDLYHLLE---------------
C5XM02_SORBI      FSLDSKREN-REMPSRASLLSELASKG-VLSCASQEVRDLYNLLE---------------
A9RFG7_PHYPA      FNIDAKKDS-REVLSRAALLSELVAKG-VMTYVSPEVKDLYTLLE---------------
A9SFU3_PHYPA      FSIDAKKDS-REVLSRAALLSELVAKG-VMTYVSPEVKDLFTLLE---------------
A8HRF8_CHLRE      FAVDAKKDA-RGLLTRQALLATISSSN-LLSLVPAEVRSIHDALS---------------
D0P3U0_PHYIT      ARMAALLGF-STTPTRANLLEDIEAAG-ILPKASTAASEIFQRVEL--------------
H3GEW8_PHYRM      SRMAALLGF-ATTPTRANLLEDIEAAG-LLPKASTAATEIFQRVEL--------------
Q4UGH6_THEAN      KRMSTLLGY-NTIPTKESLHHSLALKN-VLPLAHKNVQKLYELVEND-------------
Q4N979_THEPA      KRMSTLLGY-NTIPTKETLHYSLALKN-VLPLAHKNVQKLYDLVEND-------------
A7AQQ1_BABBO      KRMASLLGY-NTIPTKESLHYALTMKN-ILPMADENTKKLYDLMQGKG------------
Q8I5S6_PLAF7      KKMSQLLGH-TSVPVKESLKNALRIRN-ILNYADENIQKLYSLLENQ-------------
Q7RG05_PLAYO      KKMSQLLGH-TSVPVKESLKNGLKVRN-ILNYADENAQKLYSLVENK-------------
B3LCC3_PLAKH      KKMSQLLGH-TSVPIKESLKNGLKVRN-ILNYADENAQKLYSLMENQ-------------
A5JZU1_PLAVS      KKMSQLLGH-TSVPIKESLKNGLKVRN-IFSYADESAQKLYSLIENQ-------------
G4V5Q4_SCHMA      KTLAGLLGL-IQVPTRQSLIRDLVRHK-VHTVVPSNLAKLYQVLEA--------------
EIF3A_CRYNJ       QRLVALLNL-PKTPTREALVQDAAAKH--LKRVPADIRQIYKILEV--------------
EIF3A_MONBE       QRLAGLLGL-SRMPSRDELLQYMFDLN-VMTYVHPALKDLYNLVED--------------
B7G0T8_PHATC      ARMATLLGFHTRNPTRDALLAEIRSKG-ILEQAPAYLRELYELLEE--------------
                                 :  .                    .   ..               

EIF3A_DICDI       -------KTSPLMFAKLLEPKIKFIE----------------------------------
F0ZBR6_DICPU      -------KSSPLMFAKLLEPKIKFIE----------------------------------
D3BGC0_POLPP      -------RSSPLNLATQLAPKIEFIK----------------------------------
EIF3A_HUMAN       -------EFNPLKLCERVTKVLNWVR---------------------------------E
G1P5I7_MYOLU      -------EFNPLKLCERVTKVLNWVK---------------------------------D
G1LTU8_AILME      -------EFNPLKLCERVTKVLNWVR---------------------------------E
EIF3A_MOUSE       -------EFNPLKLCERVTKVLNWVR---------------------------------E
H0WQ74_OTOGA      -------EFNPLKLCERVTKVLNWVR---------------------------------E
EIF3A_RAT         -------EFNPLKLCERVTKVLNWVR---------------------------------E
EIF3A_DANRE       -------DFHPLKLCGRVTKVLNWVR---------------------------------D
H3B4Y5_LATCH      -------DFHPLKLCGRVTKVRKFVL---------------------------------T
EIF3A_XENTR       -------DFHPLKLCTRVTKVLDWVK---------------------------------E
B7Q355_IXOSC      -------DFHPLKLCGRVSQCFDFI----------------------------------N
C3YRF7_BRAFL      LYEWLEVEFHPLKLSSRVSNVFNFIL---------------------------------S
EIF3A_NEMVE       -------DFRPLDLCAKVNEVCQYLE---------------------------------S
EIF3A_DROME       -------DFNPLNLCKRIQSIVDFIE---------------------------------N
EIF3A_DROPS       -------DFNPLNLCKRIQSIVDIIE---------------------------------T
W5JG72_ANODA      -------EFDPLNLCNHVQSTIDEIE---------------------------------A
EIF3A_ANOGA       -------EFDPLNLCDQVQKIVDEIE---------------------------------A
EIF3A_AEDAE       -------EFDPLNLCERVQNIIQEIT---------------------------------V
E9GZK2_DAPPU      -------EFDPLHLCNKVKNILAFMA---------------------------------E
E0VV02_PEDHC      -------EFHPLLLCERVQTVIEVLQ---------------------------------S
EIF3A_CAEBR       -------NFSPLRVAKDVQSVLDTIT---------------------------------R
EIF3A_CAEEL       -------NFSPLKVAKDVQSVLDTVT---------------------------------R
EIF3A_YEAST       -------NFDVDTVKQQLENLLVKLS---------------------------------S
EIF3A_CANGA       -------EFDGESFKGKFEAILPKLE---------------------------------G
EIF3A_VANPO       -------NYNADTIKTEIAALLPKLE---------------------------------A
EIF3A_KLULA       -------NFDVKSAKSQLSALLPNLV---------------------------------E
EIF3A_CANAL       -------DFHPLSIKQEISQLFQIIE---------------------------------S
EIF3A_EMENI       -------DFHPLSICKKVTPILKKIG---------------------------------D
EIF3A_ASPFU       -------DFHPLSICKKITPILKQIG---------------------------------A
C0NC78_AJECG      -------DFHPLSICKKISPILIQIG---------------------------------A
Q0V6S4_PHANO      -------DFHPLSICKKISPILAQIG---------------------------------A
C7YNL9_NECH7      -------DFHPLSICQKISPILAKIG---------------------------------A
EIF3A_NEUCR       -------DFHPLSICQKISPILAEIG---------------------------------A
A7F4P3_SCLS1      -------DFHPLSICQKISPILSQIG---------------------------------A
D5GPY7_TUBMM      -------DFHPLSICKKISPILVQVA---------------------------------A
EIF3A_SCHPO       -------EFHPLSICKKLQPIIKRLA---------------------------------E
A8P1V9_COPC7      -------TFDPLTLCAAVAPLFRTLS---------------------------------E
EIF3A_USTMA       -------EFHPLSICAKIEPILASIS---------------------------------Q
F4NW26_BATDJ      -------DFHPLSICKKIAPSIAYFS---------------------------------E
EIF3A_YARLI       -------DFHPLSIRAKLTPVVGAIA---------------------------------E
EIF3A_ARATH       ------HEFHPLDLGSKIQPLLEKIS------------------------KSG-GKLSSA
F6I4Q7_VITVI      ------HEFLPLDLASRVQPLLAKIS------------------------KLG-GKLSSA
C5XM02_SORBI      ------HEFLPLDLASKVQPLLSKIS------------------------KIG-GKLSSA
A9RFG7_PHYPA      ------NEFHPLDLAAKAQPFLSKLP------------------------NLS-DKLSSA
A9SFU3_PHYPA      ------NEFHPLDLAAKANAFIVRLP------------------------SLS-DKLTPA
A8HRF8_CHLRE      ------QDFNPLELCQKLAPLLEKLP------------------------ELAASQLSGS
D0P3U0_PHYIT      ------QEVDPLQIVKQLEPFLTKIRAD----------------------PLAKAYVDGV
H3GEW8_PHYRM      ------QEVDPLQIVKLLQPFLTTIRAD----------------------PLAKAYVDGV
Q4UGH6_THEAN      ---------SSMKLCQQLVVILND--SNNTEGDLTDSKESETKS-EVKTGTDTNKQHTAG
Q4N979_THEPA      ---------NSMKLCQQLVLILNEPNSDNVEKDSTDSKEGETKTDEAKTGAEPNKPTTTL
A7AQQ1_BABBO      --------TVSMQLCKQVLPLLKE-----TEEPASAATSTPTTNLLYKAERQVPNPVVV-
Q8I5S6_PLAF7      --------FTPLSLCLECEVLLKE------------------------------------
Q7RG05_PLAYO      --------FTPLSLCLECEVLLKE------------------------------------
B3LCC3_PLAKH      --------FTPLSLCLECDVLLKE------------------------------------
A5JZU1_PLAVS      --------FTPLSLCLECEVLLKE------------------------------------
G4V5Q4_SCHMA      -------DFQPLKLWELVQPALAHIT----------------------------------
EIF3A_CRYNJ       -------DFEPTTASKVLAPLITSLS----------------------------------
EIF3A_MONBE       -------EFDPLQLSQKAAPVLEFLK----------------------------------
B7G0T8_PHATC      -------TNDPLIMVQKAKPLLEQLQQELGATTSNDVK---------------------N
                                                                              

EIF3A_DICDI       ---GHAQLSQYLKPFL-RVVFTKIALQVSKVYEVIKIEEFIKLVPFYTKT----------
F0ZBR6_DICPU      ---SHAQLSQYLKPFL-RVVFTKITLQVSKVYEVIKIEEFIKLIPFYNKG----------
D3BGC0_POLPP      ---QHPQLAQYNKSFL-KTIFTKIALQVSQVFEVIKISEFVKLIPFFDRN----------
EIF3A_HUMAN       QPEKEPELQQYVPQLQ-NNTILRLLQQVSQIYQSIEFSRLTSLVPFVD--AF--------
G1P5I7_MYOLU      QPEKEPELQQYVPQLQ-NNTILRLLQQVAQIYQSIEFSRLTSLVPFVD--AF--------
G1LTU8_AILME      QPEKEPELQQYVPQLQ-NNTILRLLQQVAQIYQSIEFSRLTSLVPFVD--AF--------
EIF3A_MOUSE       QPEKEPELQQYVPQLQ-NNTILRLLQQVAQIYQSIEFSRLTSLVPFVD--AF--------
H0WQ74_OTOGA      QPEKEPELQQYVPQLQ-NNTILRLLQQVAQIYQSIEFSRLTSLVPFVD--AF--------
EIF3A_RAT         QPEKEPELQQYVPQLQ-NNTILRLLQQVAQIYQSIEFSRLTSLVPFVD--AF--------
EIF3A_DANRE       QAEKESDLQQYVPHLQ-NNTILRLLQQVAQIYQSIEFSRLASLVPFVD--AF--------
H3B4Y5_LATCH      NAFKFNTLDNIVISCQKNNVICALIIQVAQIYQSIEFSRLASLVPFVD--AF--------
EIF3A_XENTR       QAEKEPELQQYVPQLQ-SNTILRLLQQVAQLYQTIEFSRLASLVPFVD--AF--------
B7Q355_IXOSC      KWEECSELRMYVSALQ-DITVMRLLKEVSQVYQTIELSRLLELAPFAT--PF--------
C3YRF7_BRAFL      AEEL--ELSQYVPALQ-NVTLMRLVQQVSQVYQTIQMSRLVALAPFAT--SF--------
EIF3A_NEMVE       CDDA--DLCQYIKPIQ-NIAVTRLLKQVSQVFQTIEFSRLMALVPFMT--EF--------
EIF3A_DROME       GP-ENALLTPYIQSLK-DVTIMRLIRQISQVYESIKFQRLLQLASFCN--IF--------
EIF3A_DROPS       GPTETNLLSPYIQSLK-DVTIMRLIRQISQVYESIEFKRLLELATFCN--IF--------
W5JG72_ANODA      DE--KSPYLQYVQALK-DVTLVRLVRQISQVYQTIEFSRLLELAKFAD--YH--------
EIF3A_ANOGA       DP--NSVYGQYIQALK-DVTLVRLVRQISQVYQTIEFPRLLELAKFAD--YH--------
EIF3A_AEDAE       DE--NNPYAQYTQALQ-DVTLVRLVRQVSQVYQSIEFSRFLALAKFST--SF--------
E9GZK2_DAPPU      VE-ETSYLNQYIHALE-EITLTRLVKQIAQLYSTIRFERLVQLAPFAS--PF--------
E0VV02_PEDHC      -E-ESSSLQQYIPALQ-DVTLVRLIKQVAQVYQTIELSRMMQLAKFTD--AF--------
EIF3A_CAEBR       PD-----HLQYVESLQ-AVAAVKALKQVSVIYEAISWERIRKIIPFYH--DL--------
EIF3A_CAEEL       PD-----HLQYVESLQ-AVAAVKALKQVSVIYEAISWERIRKIIPFYS--DL--------
EIF3A_YEAST       KT----YFSQYIAPLR-DVIMRRVFVAASQKFTTVSQSELYKLATLPA---PLDLSAWDI
EIF3A_CANGA       ES----YFANYSVSLR-DVIIRRMFVFASQKYEDISLNDLYSSVTFSS---SFKLSEWDI
EIF3A_VANPO       KP----YFKQYINQLR-NVLLRKNYVSLSETENAIPTDALYDKASLPG---VLSLPHWDM
EIF3A_KLULA       KP----YFAQYVAPLR-NLFIRRSIIEVSKAQTSIHLVELHEMLSLPA---PFELSVFEL
EIF3A_CANAL       DK----EFKKYIPTLT-EVILIRIFQQVSQVYDAVKLDFLISLGIFPD--LEYSLSELQV
EIF3A_EMENI       DP----EMEKYVVPLQ-QVILTRLFQQLSQVYESVELKFVYELAQFPD--PF----QITP
EIF3A_ASPFU       DP----EMEKYVLPLQ-QVILTRLFQQLSQVYESVELKFVYELAQFPD--PF----QITP
C0NC78_AJECG      DP----EMEKYVLPLQ-QVILTRLFQQLSQVYESVEVKFVHELAQFPE--PF----QVTT
Q0V6S4_PHANO      DE----GMEKYVGPLQ-QVILTRLFQQLSQVYDSVEIKFVLELAQFPE--PF----HVSS
C7YNL9_NECH7      DA----EMEKYILPLQ-QVILTRLFQQLSQVYETVDLSFVESLAQFPE--PY----QVTR
EIF3A_NEUCR       DA----EMQKYILPLQ-QVILTRLFQQLSQVYETVDLEFVESLAQFPE--PF----QVTR
A7F4P3_SCLS1      DA----EMEKYVLPLQ-QVILTRLFQQLSQVYETVDLNFVENLAKFPE--PF----QVTR
D5GPY7_TUBMM      EP----DMKPYVIPLQ-QVILTRLFQQLSQVYDTIQLSFVINLASFPE--PF----EVTP
EIF3A_SCHPO       SN----DTAQYIRPLQ-QVILTRLFQQLSQVYDSISLKYVMDLATFEE--PY----DFNP
A8P1V9_COPC7      DS----LYASYLPLLQ-RALLSRLLSQLSQVYSTIKIAHLLSLVVPLK--DAGLEAAYDA
EIF3A_USTMA       DA----EMAKYVKPLH-SVVLTRLFQQLSQVYDAVKLSKVMQLVSAFK--AP---HSYTP
F4NW26_BATDJ      NA----EFSRYAKLLH-QVVLTRLLQQLSQVYSIIKIDHVVQLASLPA--PY----NFDA
EIF3A_YARLI       AP----EFKPYFAPLY-QVILTRLFQQLSQVYESVKLDFVIQLATFPA--PF----SATP
EIF3A_ARATH       PSLPEVQLSQYVPSLE-KLATLRLLQQVSKIYQTIRIESLSQLVPFFQ--FS--------
F6I4Q7_VITVI      SSVSEVQLSQYVPALE-KLATLRLLQQVSQVYQTMKIESLSKVIQFFD--FS--------
C5XM02_SORBI      SSVPEVKLSQYISALE-KLTTLRVLQQASSIFQSMKIDMLSRMIPFFD--FS--------
A9RFG7_PHYPA      SPVPEVRLEQYVPALE-RLTTLRVLLQASQVYSTIRIADLTRMVTFFD--FS--------
A9SFU3_PHYPA      SPVPEVRLEQYVPALE-RLTTLRVFQQASQVYSTIRIPELTRMVTFFD--FS--------
A8HRF8_CHLRE      APVRSVALDKYVPALK-QAAVLRLLKQLSEVYSVMRISELAALVPFYT--FA--------
D0P3U0_PHYIT      ERLVVRRVLFQLTRVY-ASVTITHLRSIFVGLDISYEEIETLIARSRS--LS--------
H3GEW8_PHYRM      ERLVVRRVLFQLTRVY-ASVTIAHLRSIFVGLDVSYEEIEALIARSRS--LS--------
Q4UGH6_THEAN      QNVYREDLEKYYEKVK-SVVFHKVLTRLSKVYASMTIDFFTKSICPADFYTW--------
Q4N979_THEPA      PNTYKEDLARYYEKVK-SVVFHKVLTRLSKVYASMTIDFFTKTICPPEFYTW--------
A7AQQ1_BABBO      --KFFDKLSNYYPMIK-AVIYHKVLNSISNVYATMTIDFFVKAICPEEFYPW--------
Q8I5S6_PLAF7      --LENTEYAIYTKKIK-EVIFHKLILQLSRVYSYISIDYFIENICPDHFMSW--------
Q7RG05_PLAYO      --LEKTEHNIYINKIK-EVIFHKLILQLSKVYNYISIDYFIENICSEHFISW--------
B3LCC3_PLAKH      --LEATEHSVYISKIK-EVIFHKLILQLSKVYSHISIDYFIENICPESFISW--------
A5JZU1_PLAVS      --LEATDHHVYISKIK-EVIFHKLILQLSKVYSYISIDYFIENVCPESFIPW--------
G4V5Q4_SCHMA      ---TCSDLQVYITQLH-DVIVAKTLLQLSQVYQSLNFDEFVKLCPFME-----------P
EIF3A_CRYNJ       -----PEYQPYLPALR-DVVLSRLLQALAQVYDSVTLSHILDLVKPLDNTPW----ATDM
EIF3A_MONBE       ---SHEQFAQYVTPLK-YILLLRLLKQLSQLYSSLKLERCFKLASFMT-----------P
B7G0T8_PHATC      DDVDDTTLGRYVKPIT-NVLLLKLIRNLSAAYHTVSMDHLKSLTSGLDLSFE--------
                                                                              

EIF3A_DICDI       -QIELYLLESIKRKLIGARIDHKNGVIRFGHY----------------------------
F0ZBR6_DICPU      -QIELYLLEAIKRKLIGARIDHKAGVVRFGHY----------------------------
D3BGC0_POLPP      -EIELLLLDSIKRKLIGARIDHRNGVVRFGHY----------------------------
EIF3A_HUMAN       -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
G1P5I7_MYOLU      -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
G1LTU8_AILME      -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
EIF3A_MOUSE       -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
H0WQ74_OTOGA      -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
EIF3A_RAT         -QLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAP------------------
EIF3A_DANRE       -QLERSIVDAARHCDLQVRIDHSSRTLSFGSDLNYSTKEDSP------------------
H3B4Y5_LATCH      -QLERAIVDAARHCDLQVRIDHTTRTLSFGSDLNYSTREDAP------------------
EIF3A_XENTR       -LLERAIVDAARHCDLQVRIDHSSRTLSFGSDLNYSTREDAP------------------
B7Q355_IXOSC      -YLENMVVDAVRRNNLQVRIDHKQRCLHFGSELSVSQQEEVV------------------
C3YRF7_BRAFL      -QLERVVVEAARNGDLKVRLDHCSKSLRFGEEVGLFSSEEITES----------------
EIF3A_NEMVE       -QLERMIVDIAKEKNLQVRLDHRTKSISFGLDLHVAHREEVP------------------
EIF3A_DROME       -ELEKLLVESVRHNDMQIRIDHQKNSIYFGTDLTESQREYRP------------------
EIF3A_DROPS       -ELEKLLVESVRHNDMQIRIDHQKNSIYFGTDLTESQREYRP------------------
W5JG72_ANODA      -HLERILVDCVRHNDMQITIDHRNGCVHFGTDLSESQREDHP------------------
EIF3A_ANOGA       -HLERILVDCVRHNDMQITIDHRNECVHFGTDLSESQREDHP------------------
EIF3A_AEDAE       -YLERILVDCVRHNDMQITIDHRNHCVHFGTDLSESQREDHP------------------
E9GZK2_DAPPU      -DLERIVVNAVRHTDMQIRIDHRNNCLHFGTELFEAQREDLP------------------
E0VV02_PEDHC      -HLERLLVDCVRHNDMQIRIDHGAKCIRFGIDLSEAQREDKP------------------
EIF3A_CAEBR       -ALERLVVEASKHRIVKAQLDHRADCVRFGSSDATLAGGVDEYDNNEG------------
EIF3A_CAEEL       -ALERLVVEASKHRIVKAQLDHRADCVRFGSSDATLAGGVDECDNNEG------------
EIF3A_YEAST       ---EKSLLQAAVEDYVSITIDHESAKVTFAKDPFDIFASTASKEVSEEENTEPEVQEEK-
EIF3A_CANGA       ---EKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVEEEEEEEEEEEEEE-
EIF3A_VANPO       ---EKTLLQAAVEDYVSISIDHDSNTVTFFKDPFEIISKAAGTVEEEEEEEEEEGEEVEG
EIF3A_KLULA       ---EKYLIQAAMDDYVSISIDHETDTVSFAQDPFDAWQASLVEVPESSTSDEAKNSESE-
EIF3A_CANAL       ---EDLIVNAVKDDLVSLTIDHESGVVSFKSNPFDEIDQEFANAGTTTTNTITTTTTIG-
EIF3A_EMENI       SMIEKFIMNGCKKGDLAIRVDHISGVLTFDTDVFSSAKALHSGSAAGSAESELGS-----
EIF3A_ASPFU       AMIEKFIMNGCKKGDLAIRVDHTAGVLTFDTDIFSSAKALHSGSAAGSAESEVGS-----
C0NC78_AJECG      SMIEKFIMNGCKKGDLAIRVDHISGVLTFDSDIFSSAKAMHPGSAAGSAESEVGS-----
Q0V6S4_PHANO      GTIEKFIMNGCKKGDLAIRTDHATGILTFDSDVFSSAKAMHPGSGAGSAETETRS-----
C7YNL9_NECH7      GTIEKFIMNGNKKGDLSVRMDHATGVLSFDNDVFSSSKASHSGSGAGSAESETGT-----
EIF3A_NEUCR       GTIEKFIMNGNKKGDLAIRMDHATGVLSFDADVFSSAKAVHAGSSAGSAESETGS-----
A7F4P3_SCLS1      ETIEKFIMNGNKKGDLAIRMDHATGVLSFDTDVFSSTKAIHAGSAAGSAEAETAS-----
D5GPY7_TUBMM      SIIEKFIMNGCKKGDLSIRIDHAAGVLTFESDIFSSTKPLHPGSVAGSAEKETGS-----
EIF3A_SCHPO       GQIEKFIMNGNKKGAFSIRLNHIENSISFSSDLFSNPIKSSDS-----------------
A8P1V9_COPC7      EQVEAYIMGCARRGELNIRVDHKEGSIAFVDDAFAAVEEPVASTSALAEQT---------
EIF3A_USTMA       AEIEKFCLNACKKGHLNIRIDHVAQAITFQDDVFSTDVHPAASASSEADNVG--------
F4NW26_BATDJ      HAIERFVMNGCKRGELTIRVDHKTKTLSFDAGFFASTSESSSEGPR--------------
EIF3A_YARLI       LEIEQFIVRACAQGELAIKIDHDQRSVLFEEVRAATGSA---------------------
EIF3A_ARATH       -EVEKISVDAVKNNFVAMKVDHMKGVVIFGNL----------------------------
F6I4Q7_VITVI      -VVEKISVDAVKHGFIAMKVDHMKGVILFGNL----------------------------
C5XM02_SORBI      -VVEKISVDAVKRNFVAIKVNHLSGAVHFGTV----------------------------
A9RFG7_PHYPA      -VIEKLIVEAVKYNFVQMKVDHLKEVVNFGSQ----------------------------
A9SFU3_PHYPA      -TVEKLIVEAVKYNYVQMKVDHMMGVVNFGSQ----------------------------
A8HRF8_CHLRE      -EVEAVVVDAVKYDYLTMRVDHRNGTLHFGAQ----------------------------
D0P3U0_PHYIT      -TVAHTSAPSLSGMYRRNVTQHGSNNAETSSADAVASAQTRTKIRIDHVEQCIRF-----
H3GEW8_PHYRM      -TVAHASAPSLSSMYRRNVTQHGSNNAETSSNDAVSSAQTRTKIRIDHVEQCIRF-----
Q4UGH6_THEAN      DYAEKEIVELVHRGLCHVRFDYTNRVLYFNSSSANA------------------------
Q4N979_THEPA      DYAEKEIVELVHKGLCHVRFDYTNKVLYFNSSSVNS------------------------
A7AQQ1_BABBO      NVAEKSIADLVQRGLCHIRLDYSNGVLYFNASKGTV------------------------
Q8I5S6_PLAF7      NEAEKMLVDLVYQRELEMKIDLTMRAIHFG-DKQVL------------------------
Q7RG05_PLAYO      NDAETMLVDLVYQKELEMRIDLTKRAIYFG-DKENV------------------------
B3LCC3_PLAKH      NEAETMLVDLVYQKELEMRIDLIKRAIYFG-DKENT------------------------
A5JZU1_PLAVS      NEAETMLVDLVYQKELEMRIDLIKRAIYFG-DKENT------------------------
G4V5Q4_SCHMA      IRLERIVLELIHNLELPIRVNHLQQAIFFDKFTDLGISQCEYGGQL--------------
EIF3A_CRYNJ       SSLEKFLVTACRRGDIRASVDHVAQTITFVSTPPDA------------------------
EIF3A_MONBE       EECEEVLVHAVQDKVLQLRIDHARGSLHFNNNIFAFNERQVND-----------------
B7G0T8_PHATC      -QVEKTIVTSSKT--LAVRLDHRAGCLRFGNV----------------------------
                                      :                                       

EIF3A_DICDI       ---------------------------DFDSAKISDQLSNLATGVGKALNMIEPEKKQQQ
F0ZBR6_DICPU      ---------------------------DFDSAKISDQLSNIASGVGKALKMVEPEKKEQQ
D3BGC0_POLPP      ---------------------------DFDSANIGDQLSNLAQGVRKALKMIESERKDDS
EIF3A_HUMAN       ---------------------IGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQE
G1P5I7_MYOLU      ---------------------LGPYLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHVLQE
G1LTU8_AILME      ---------------------IGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQE
EIF3A_MOUSE       ---------------------VGPHLQSMPSEQIRNQLTAMSSVLAKALEVIRPAHILQE
H0WQ74_OTOGA      ---------------------IGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQE
EIF3A_RAT         ---------------------IGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQE
EIF3A_DANRE       ---------------------VGPFLQNMPSEQIRNQLTAMSSSLAKAIQVIKPASILQD
H3B4Y5_LATCH      ---------------------VGPYLQSMPSEQIRNQLTAMSSALAKALDVIKPAHILQE
EIF3A_XENTR       ---------------------FGPFLQNMPSEQIRNQLTAMSCVLSKAVGAIKPAHVLQE
B7Q355_IXOSC      ---------------------EGPHLQGMPSEQIRCQLVKLYSVLQRSVHLIRPDEIKES
C3YRF7_BRAFL      ---------------------EGPTLQPLQSEQFNRQLVQMSVALNMAVNVIQPPHLMKE
EIF3A_NEMVE       ---------------------EGPYLQAMPSEGLRNQLTLMSVALQRSIFTIQHDHIKAK
EIF3A_DROME       ---------------------DGPALQSMPSEQIRSQLVNMSTVLTRAVSIVYPNRERDQ
EIF3A_DROPS       ---------------------DGPALQSMPSEQIRSQLVNMSTVLTRAVSIVYPNRERDQ
W5JG72_ANODA      ---------------------DGPTLQSMPSEQIRSQLVNMSVVLHRAIATINPNRKKVD
EIF3A_ANOGA       ---------------------DGPTLQSMPSEQIRSQLVNMSVVLHRAIATINPNRKKAE
EIF3A_AEDAE       ---------------------DGPTLQSMPSEQVRSQLVNMSVVLHRAIATINPNRNKAE
E9GZK2_DAPPU      ---------------------EGPTLQAMPSEQIRTHLITMYCVLNKATIAVVGNAPTKE
E0VV02_PEDHC      ---------------------EGPTLQCMPSEQVRNQLVNMAAVLHKAMATINPNKKKLE
EIF3A_CAEBR       ---------------------FTGDDTQLGVEGVRNHLEAMYTRLRVLVEGLDSEKRRKE
EIF3A_CAEEL       ---------------------FTGDDTQLGVEGVRNHLEAMYTRLRGLVEGLDAEKRRKE
EIF3A_YEAST       EETDEALGPQ-ETEDGE-EKEEESDPVIIRNSYIHNKLLELSNVLHDVDSFNNASYMEKV
EIF3A_CANGA       KEAEGAEGAEGDTEEGQ-EAVAEPEPVIKRNYYIRKRLSELYEKLLEDTDYNTVSYLDKV
EIF3A_VANPO       EEAETGEEIVEEGEEHENEENKEPEPVITRTTFIRNRLAELSNVLEEIDAFKNASYLEKV
EIF3A_KLULA       --EETSQETHADEEQNE--------QVFTRNSEVRSKLTDLSKILKANEEYENGSYYYRV
EIF3A_CANAL       ----------------------TSRLQISPAELVRTQISKLAATLSESIYLIDPNYEARQ
EIF3A_EMENI       ----------------------VQRLQNTPAEIARLQLTRLAKTLHVTCMYVDPSYNDSR
EIF3A_ASPFU       ----------------------VQRLQNTPAEIARLQLTRLAKTLHVTCMYVDPSYNEAR
C0NC78_AJECG      ----------------------VQRLQSTPAEIARSQLTRLAKTLHLTCMYVDPSYNQAR
Q0V6S4_PHANO      ----------------------VQRLQSTPAEIVRTQLTRLAKSLFVTCQYVDPSFNADR
C7YNL9_NECH7      ----------------------VQRLQNTPSEIVRSQLTRLAKSLFTTCHYIDPSFNKER
EIF3A_NEUCR       ----------------------VQRLQSTPSQIVRSQLTRLAEALYTTCRYIDPSFNEAR
A7F4P3_SCLS1      ----------------------VQRLQNTPSEIVRTQLTRLAKALFITCQYVDPSLNEAR
D5GPY7_TUBMM      ----------------------VQKLQSTPSEIVRSQLSRLAKALYLTCSHVDPDFQQYR
EIF3A_SCHPO       -----------------------VSLQSTPSELITSQLTRIAKSLSSVLMRFDTDFCLLR
A8P1V9_COPC7      -------------------------IQPTMSELVRTRLSKVATCLYNSLEKIEGPSKAAQ
EIF3A_USTMA       -------------------------LQASPSELVRTQLSRLATCLDTTLKTIDPTILADA
F4NW26_BATDJ      -----------------------LHQIMLPGERVRLHLTCFAKRLHSVMGFVDPSITKQK
EIF3A_YARLI       ------------------------SLQDTPIEIVRTQLSRLGRTLSVADPLNSAEAREQQ
EIF3A_ARATH       ---------------------------GIESDGLRDHLAVFAESLSKVRAMLYPVPS---
F6I4Q7_VITVI      ---------------------------GLESDRMRDHLTVFAEFLNKARALIHPPAK---
C5XM02_SORBI      ---------------------------DIESDGLSDHLSILADSLNKARIHICPPVK---
A9RFG7_PHYPA      ---------------------------DLESEKVKTHLAILAKRLKKACSMISPPTVE--
A9SFU3_PHYPA      ---------------------------DLESEKVKTHLTILAKRLKKACIMISPPFEE--
A8HRF8_CHLRE      ---------------------------SVEADRVRGHLAAVAKRLAKAVTMMSPTPLPLS
D0P3U0_PHYIT      -------------------------TDAVDLEANAAQLTLLGERLSRAMSK---------
H3GEW8_PHYRM      -------------------------TDAVDLEANATQLTLLGERLARAMSKVPAAASASI
Q4UGH6_THEAN      ----------------------------DSIASIRHQLTDLGKNLYYVIRILSPADVNKS
Q4N979_THEPA      ----------------------------DSIASIRHQLTDLGKNLYYAITILSPTDVNKS
A7AQQ1_BABBO      ----------------------------DSIAAVRHHLTNLGRNLYHAMRIIDP-NYTKN
Q8I5S6_PLAF7      ----------------------------NSSVMIKDSLINMYNDLQNGLKMINETIAIEN
Q7RG05_PLAYO      ----------------------------NRSKLIKDSLINMYNELYNGLRMINESISIEN
B3LCC3_PLAKH      ----------------------------NSSKLIKESLTNLYYELQTGLKIMNETISIEN
A5JZU1_PLAVS      ----------------------------NSSKLIKESLTNLYHELQTGLKMINETISIEN
G4V5Q4_SCHMA      ---------------------VSQSTHVNDPDKLSRQLTMFAQVMQQITDILEVGQSLAN
EIF3A_CRYNJ       -----------------------------------NGLQTLAVCLYNTIQYLNPSRLAPV
EIF3A_MONBE       ----------------------GPKLQNLQAEMMNGQLTTLSRRLYTAINMIKPAVVQES
B7G0T8_PHATC      ---------------------------QLESDAMRSQLVNLSKQLQAVSNVLTPPDRQSV
                                                       :  .   :               

EIF3A_DICDI       HDKLKKE---------------------------------------------VYVKIINS
F0ZBR6_DICPU      HNRVKKE---------------------------------------------VYVKIINS
D3BGC0_POLPP      AAKVKRE---------------------------------------------VYVKIINS
EIF3A_HUMAN       KEEQHQL---------------------------------------------AVTAYLKN
G1P5I7_MYOLU      KEEQHQL---------------------------------------------AVTAYLKN
G1LTU8_AILME      KEEQHQL---------------------------------------------AVTAYLKN
EIF3A_MOUSE       KEEQHQL---------------------------------------------AVNAYLKN
H0WQ74_OTOGA      KEEQHQL---------------------------------------------AVTAYLKN
EIF3A_RAT         KEEQHQL---------------------------------------------AVTAYIKN
EIF3A_DANRE       HEEQRQQ---------------------------------------------AITAYLKN
H3B4Y5_LATCH      KEDQHQL---------------------------------------------AVTAYLKN
EIF3A_XENTR       KEEQHQI---------------------------------------------AITAYQKN
B7Q355_IXOSC      TKELKMH---------------------------------------------IIDAYRLV
C3YRF7_BRAFL      HEDLKLG---------------------------------------------CMAAYRKS
EIF3A_NEMVE       KREEQEQ---------------------------------------------MAQNYLRT
EIF3A_DROME       RAKLRNQ---------------------------------------------MVNHYHEI
EIF3A_DROPS       RAKLRTQ---------------------------------------------MVHHYHEI
W5JG72_ANODA      RERLRTQ---------------------------------------------MVQQYLEN
EIF3A_ANOGA       RERLRAQ---------------------------------------------MVHQYEEN
EIF3A_AEDAE       RDRLRAQ---------------------------------------------MVKSYEEN
E9GZK2_DAPPU      ERQLKAQ---------------------------------------------IAALYHQN
E0VV02_PEDHC      REKLRAK---------------------------------------------MVQQYHES
EIF3A_CAEBR       IVKKIEN---------------------------------------------HVTSYEKN
EIF3A_CAEEL       ILKKIEG---------------------------------------------QVTSYEKN
EIF3A_YEAST       RIARETL----------------------------------------------IKKNKDD
EIF3A_CANGA       RIAREAL----------------------------------------------IKHTKDT
EIF3A_VANPO       KLARETL----------------------------------------------ITQTKDS
EIF3A_KLULA       KLVREEL----------------------------------------------IRRKEEV
EIF3A_CANAL       QQAKQQA----------------------------------------------LQRCIKD
EIF3A_EMENI       LQAKQAA----------------------------------------------LTRAAAG
EIF3A_ASPFU       IQAKKAA----------------------------------------------QARAEAG
C0NC78_AJECG      IQAKQIA----------------------------------------------FAKAKAG
Q0V6S4_PHANO      HRAKDAA----------------------------------------------LARAKEG
C7YNL9_NECH7      LEARAAA----------------------------------------------LARAKDG
EIF3A_NEUCR       IKARDEA----------------------------------------------LARAKAG
A7F4P3_SCLS1      IKSRDEA----------------------------------------------YARAKAG
D5GPY7_TUBMM      LEAKAAA----------------------------------------------YARAQAG
EIF3A_SCHPO       KQQAEAA----------------------------------------------YERAQAG
A8P1V9_COPC7      ELTKEEQD-------------------------------------------AKFKALVAA
EIF3A_USTMA       QAAKRHV----------------------------------------------FARAVAA
F4NW26_BATDJ      TAFKIKS----------------------------------------------FQNAAAH
EIF3A_YARLI       YVAALTT-------------------------------------------------AQDN
EIF3A_ARATH       --KASKLA-------------------------------------------GVIPNLADT
F6I4Q7_VITVI      --KASKLG-------------------------------------------DMLSGLAET
C5XM02_SORBI      --KPSKLS-------------------------------------------ESLVSLAGI
A9RFG7_PHYPA      --RSSKQI-------------------------------------------LPYAELQAI
A9SFU3_PHYPA      --KASRQI-------------------------------------------LPYAELQAL
A8HRF8_CHLRE      AADAQRRA-------------------------------------------LIIKEARET
D0P3U0_PHYIT      -----QKK-------------------------------------------KLLASTRAR
H3GEW8_PHYRM      AARDEQKK-------------------------------------------KLFTATRAR
Q4UGH6_THEAN      AEHR----------------------------------------------RLHLVSMKNS
Q4N979_THEPA      AEQR----------------------------------------------RLQLVSMKNS
A7AQQ1_BABBO      TEDR----------------------------------------------HLQMLSMKNN
Q8I5S6_PLAF7      EVENLTMSTLTYEEEFAYLDKSNKNI-NYNTATLEDIIENEVFEEKPIENEKLLKKIYEK
Q7RG05_PLAYO      EVENTNTKLLNYEHEFNLLDKGNKHISNYATADIEDIVENEIIDDKPIDDEKILKKIYDK
B3LCC3_PLAKH      EVEHLHMKKLTYEKEFDMLDRAHHKIMNYETANIEDVIENEVFEDKPIEDEKMLKKIYDK
A5JZU1_PLAVS      EVEHLHMKKLTYEKEFDMLDRGHHKIMNYETANIEDIIENEIFEDKPIEDEKLLKKIYDK
G4V5Q4_SCHMA      CRRALVH------------------------------------------------DYRKN
EIF3A_CRYNJ       SRSDAFA------------------------------------------------AAIAQ
EIF3A_MONBE       QMGVKAI-----------------------------------------------NRIKDE
B7G0T8_PHATC      LQSRLST----------------------------------------------YQSVREN
                                                                              

EIF3A_DICDI       LQDEHRRILARKEIIEKKKIYMEQQDRIKK---QKEHEELQKKIQEKVARDQQRLKEDME
F0ZBR6_DICPU      LNDEHRRILARKEIIEKKKIYMEQQERIKK---QKEQEETLKRAQEKALRDQQRIQEDLE
D3BGC0_POLPP      LGDEHRRILARKEIIEKKKIYVEQQERLRR---QREEEQLAAAAAQKAEKDQAMVKENLE
EIF3A_HUMAN       SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
G1P5I7_MYOLU      SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
G1LTU8_AILME      SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
EIF3A_MOUSE       SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
H0WQ74_OTOGA      SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
EIF3A_RAT         SRKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
EIF3A_DANRE       ARKEHQRILARRQTIEERKERLESLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
H3B4Y5_LATCH      ARKEHQRILARRQTIEERKERLENLNIQRE---KEELEQREAELQKVRKAEEERLRQEAK
EIF3A_XENTR       SRKEHQRILARRQTIEERKERLENLNIQRE---KEEMEQKEAELQKVRKAEEERLRQEAK
B7Q355_IXOSC      CKKEHKKILERQQIIEARKEMLENLTFQRE---EEERKQIEERQQKLREAEEERIVREAE
C3YRF7_BRAFL      ARAEHLHILARQRTIEERKEKLENLNMQRE---EEEKRAQEEQLRAQKEAEEARLAQEAQ
EIF3A_NEMVE       ARKEHKLMLERKTVIEARKEYLESVMQERE---RREYEKIKKQKVENQEAEQKRLDEERR
EIF3A_DROME       KDREHQRILQRQKIIEDRKEYIEKQNNARE---EEEARRQEEESRKAKLAEQKRLEQEQE
EIF3A_DROPS       KDREHQRILQRQKIIEDRKEYIEKQNNARE---EEEARRQEEESRKAKLAEQKRLELEQE
W5JG72_ANODA      MEKEHQRTLQRQKKIEDRKEYIERVNLERE---EEVQRLQEEQARAHKLAEQRRLELENE
EIF3A_ANOGA       ADKEHQRILQRQKKIEDRKEYIERMNQERE---EEELRLQEEQVRMQKLAEQRRLEAENE
EIF3A_AEDAE       MVKEHQRILQRQKKIEDRKEYIERVNLERE---EKELRELEEVARQHKLAEQRRLEQENE
E9GZK2_DAPPU      KARDHHQLLSRQKIIEDRKEYLEKLNTERE---EEEGRRQEELIRQQLLAEQRRLEAERQ
E0VV02_PEDHC      KISEHERILKRHKIIEDRKEYIERKNTQRE---EEEMRRQEHIQRQLLLQEQKRLEAERE
EIF3A_CAEBR       RVTEIERIHRRKKMLENYKENWERVKAEKA---ATAATEQAKREEAARAEEMKRLDEQNK
EIF3A_CAEEL       RPTEIERIHRRKKMLENYKENWERVKAEKT---AAAATEQAKREEAARAEEMKRLDEQNK
EIF3A_YEAST       LEKISKIVDERVKRSQEQKQKHMEHAALHA---EQDAEVRQQRILEEKAAIEAKLEEEAH
EIF3A_CANGA       IEDMKKNSEERAKMHQERRRQHMESAAMNA---EKDAEQRQKRIMEERASIEAKLEEEAH
EIF3A_VANPO       IENLKQIAEDRAKRAQEQKKKYMASAAVRA---EEDAEIRQRQILEEKAALEAKLEQDAH
EIF3A_KLULA       IKLEKEAAEIRAKSNAERKKRSEEENKILA---KKALEERQRRMAEEKAAVESSMEKEAE
EIF3A_CANAL       MVNEQQRIADRSKILKDRKVAAEKRKREEE---ERQARLRQEKLAMEQKLEQERLIAEQE
EIF3A_EMENI       AAKEHEDTLERRVIIEKKKEAATDALQRKQ---KEEETRKRIRTQQLQEAEKQRLAEEQR
EIF3A_ASPFU       AAKEHEETLARRVLIEKKKEAATDALQRKQ---REEETRKRIRNQQLQEAEKQRLLDEQR
C0NC78_AJECG      AAKEHEDTLSRRIIIEKKKEAALESLQRKQ---QEEERQKRIRTQQLQEAEKRRLHDEHL
Q0V6S4_PHANO      AEKEHQDILTRRDIISQKKEAALKAQQAKE---NEEQTRKMIRQQQQKEEESRRLAEEQK
C7YNL9_NECH7      AEQEHLEILARKEVIQKRKEEASEIQARKE---KENARQKRLREQALQEAEDKRLAAEQK
EIF3A_NEUCR       AEKEHQEVLARKEIIQTRKDKASEAQAQKE---KENARKKLLQEQALQQAEAARLAEEQK
A7F4P3_SCLS1      ADEEHKETLKRKETIQKRKEEASEIQSRKE---KEEATRKRIKAAQLQEAEDKRLEAEQK
D5GPY7_TUBMM      AQEEHEDTLARRTIIEKKKEAAETALLKKE---KEEAQQRLLRAEEARAAEAARAADQQK
EIF3A_SCHPO       VEQERKAVIAQRSLLELRRGQADTLATQRE---AELAAQRALKQKQESEAESLRVQEEIN
A8P1V9_COPC7      VEAERKALQLRRALVARRRELLSELSVRKE---KEESSRRAEISRREREEAEKRRQEEIK
EIF3A_USTMA       AEDEHKAAIARKALLARRKELLEEMATRKE---REEAAARAERARAAAEAEQKRIAEEQK
F4NW26_BATDJ      LEEERSAVSVRRALVFKKKEMRDADAASKK---QEALALRAQRLQQEQAAEKIRLEEEFK
EIF3A_YARLI       AEREHAETLARRAEIEARKAQAEAERAQRE---EEEARKRAQRLLDEELAEKERLAAEQH
EIF3A_ARATH       VEKEHKRLLARKSIIEKRKEDQERQQLEME---REEEQKRLKLQKLTEEAEQKRLAAELA
F6I4Q7_VITVI      VDKEHKRLLARKSIIEKRKEEQERQLLEME---REEESKRLKLQKITEEAEQKRLASEYE
C5XM02_SORBI      VENEHKRLLARKSIIEKRKEELERQILEKE---KEEEKKRMSSQKKTADEERVRLLNEQR
A9RFG7_PHYPA      VEKEHKKLLARKVLIERRKEEQERQMLEME---REEESKRLKQQRLTEEAEAKRLANESA
A9SFU3_PHYPA      VEKEHKKLLARKVLIERRKEEQERHMLEME---REEESKRLKQLRLTEEAEAKRLANESA
A8HRF8_CHLRE      LEGEHLKAVARKMAIEKKKEEAERAMQEAE---HLENQRKLQAAALHAQAEDRRRKEEAL
D0P3U0_PHYIT      LQSQRSEMLARREIIERKKEELEKLQQEKL---QSLEKKRREFAKRRAELERERLTQEAR
H3GEW8_PHYRM      LQEQRSDMLIRREVIERKKEELEKLQQEKL---HSLEKKRHEFAQRRAELERERLTQEAR
Q4UGH6_THEAN      IEKERSRLMKRTSEIYQRRQEHQEEQMRVE---EERKKQELQQKINEEKAEKERREEAFR
Q4N979_THEPA      IEKERSRLMKRTSEIYQRRQEHQEEQMRVE---EERKKQELQQKINEEKAEKERREEALR
A7AQQ1_BABBO      IEKERQKLMKRTSEIYQRRQEHQEEMLRAE---EERKRQEIEQKILEERAEKERREEVLR
Q8I5S6_PLAF7      IDEEHHKIQLLSEEHNKKRKELLKKQKELE---QAQLKLKMEKKLLEEKLEKEKKEELAR
Q7RG05_PLAYO      IDEEHHKLQLLSEEHNKKRKEMLRKQKEQE---QAQLKIRMEKRLLEEKLEKEKREELAK
B3LCC3_PLAKH      IDEEHHKFQLLSEENSRKRKELLRKQKELE---QAQLKLKMEKKLLEEKLEKEKREELAK
A5JZU1_PLAVS      IDEEHHKFQLLSEENSRKRKELLKKQKELE---QEQLKIKMEKKLLEEKLEKEKREELAK
G4V5Q4_SCHMA      EKVLRSELLNRRCLIEARKEEIETYQVKRDQYYSIVEERRQAEQERLLKAEETNLANEAI
EIF3A_CRYNJ       AEEERKAASHKRQIVIRRRELLEEAKLRRE---KEASTALAERLKIKAEEDARRAKEEAK
EIF3A_MONBE       VAREHVSNLSRRDEIEKQKEELEQSRRRRH---QEQMQKHHQNQMQVRQKMAEAVKKNQE
B7G0T8_PHATC      LHAEHAAVLERKNLIETRKEETERVAQEKS---KQEARVKAEEEAARKAEEEQRIVREQR
                                    :                                         

EIF3A_DICDI       RREKEQAEEESQQ--------------------------------------NQLDQTINA
F0ZBR6_DICPU      RREIEQQQQQQQV--------------------------------------SQLDQTINA
D3BGC0_POLPP      RRENEN-KEPTRS--------------------------------------QMINQTINA
EIF3A_HUMAN       EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
G1P5I7_MYOLU      EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
G1LTU8_AILME      EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
EIF3A_MOUSE       EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
H0WQ74_OTOGA      EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
EIF3A_RAT         EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
EIF3A_DANRE       EREKERIMQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
H3B4Y5_LATCH      EREKERIMQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIEDLEELDPDFIMAKQVEQ
EIF3A_XENTR       EREKERILQEHEQIKKKTVRERLEQIKKTEL-GAKAFKDIDIENLEELDPDFIMAKQVEQ
B7Q355_IXOSC      ERAKQRSQREQDEMKKKVVLEKIELLRKTDI-GARIFEGLEEEELERLDPEEILNRQVEQ
C3YRF7_BRAFL      ERERQRRLQERREIQRKQVQERLDILRKSSL-GARALKDIDLEDIDELDPDAIMQKQVEQ
EIF3A_NEMVE       QREIQRRRQELQDIEKRQAMDKIAALKKTTV-GAKALKDLSPEEIDNMNADDIIAKQVEQ
EIF3A_DROME       ERERKRHQNEIQAIREKSLKEKVQQISQTAH-GKKMLSKLDEEGIKKLDAEQIAKRESEE
EIF3A_DROPS       ERERKRHQNEIQAIKEKSLKEKVQQISQTAH-GKKMLSKLDEEGIKKLDAEQIAKRESEE
W5JG72_ANODA      ERERKRHENEMQMIKERNIKDKIDQIKQTAS-GQKLLKKMDEEEIRKMNAEEIAAREAEE
EIF3A_ANOGA       ERERKRHENELQMMKERNMKEKIEQIKQTAT-GQKLLKKLDEEEIRKLNTEEIAAREAEE
EIF3A_AEDAE       ERERKRYENEVQMIKERNMKEKIDQIKQTAA-GQKILKKFDEEDIKKMNAEEIAAKEAEE
E9GZK2_DAPPU      ERERLRQEAELRQVQARHLKEKVAQFSQTAI-GQKVIKKMEDEDISKLDPDLIMARQLEE
E0VV02_PEDHC      ERERRRQENEIQQIRDRHLKERMQAISQTAH-GQKILKKLDEDDMKKLDAEQIAAKEQEE
EIF3A_CAEBR       ESERKRKQAEQEEIQKKIKRDQLHKMQQNVI-YQAIIKEKGLEQFRDMDPEQVLREQRER
EIF3A_CAEEL       ESERKRKQAEQDEIQKKIKQDQLYKMQQNAI-YQEIIKEKGLEQFRDMDPEQVLREQRER
EIF3A_YEAST       RRLIEKKKREFEAIKEREITKMITEVNA-----KGH-VYIDPNEAKSLDLDTIKQVIIAE
EIF3A_CANGA       RRLIEKKKREFEEVKQREIRKLVDELNA-----KGNGTKVEYDEVKDMDIPDITKYFVNR
EIF3A_VANPO       RRLVEKKKREFEDLKQREIQKFIDEFNK-----KDHAAKIASEEVQGLDIKEIKTLIFSK
EIF3A_KLULA       RRAEEMMEREREAIHEQEMKKLIAETNA-----NGV-IHIDPKEAKNLTSDKINQMVIEQ
EIF3A_CANAL       RKKLEKLEKERELIKENEKRKIAEEINA-----KGI-IKIDLNNLKELDTTKLQLMQIEQ
EIF3A_EMENI       ERELKRIKDEQDRIRQQELKKQLEELKS-----GVKGIDLNEIDLEDLDANRLRAIKLAQ
EIF3A_ASPFU       EREKKRLRDEQERIRQQELKKQLEELKS-----GVKGIDISEIDLEDLDANRLRAIKLAQ
C0NC78_AJECG      ERERKRMKDEKDRIRQEELKKQLEELKT-----GVKGIDVSEINLDELDSNSLRHIKLAQ
Q0V6S4_PHANO      QRAEARIKQEQQRIQREEMAKQIEELKK-----TTKVDIDLPEDLAEIDSTRIRILKLQA
C7YNL9_NECH7      EREAKRMKAERDRVRKEELKKQIADLKM-----GDKAIDIDLEDLDNLDSNRLRAMKLAQ
EIF3A_NEUCR       LREAKRLANEREQIKRKEVEALLKDMKL-----EELQ----GEDIETLDSNKIRMIKLQQ
A7F4P3_SCLS1      KREEDRLKAELERVRKAELQKQIDDLKI-----GNKALDIDLDDLDNLDGNKLRAMKLAQ
D5GPY7_TUBMM      KRELERMRQEQEKIRKEELKKQLDELSL-----DAKI---DVENLEDLDSNQLRAMKLAQ
EIF3A_SCHPO       KRNAERIRREKEAIRINEAKKLAEELKA-----KGGL-EVNAEDLEHLDADKLRAMQIEQ
A8P1V9_COPC7      RREIEKTKREIEEIRADEAKKYAQTLVD-----KGILKPNDVDKLENYDTEGLITIQVAQ
EIF3A_USTMA       KREQDRLNKEVEAVRIEEAKKMAKSLQE-----RGGLKLS-EEELANLDTDKLVQMQVEQ
F4NW26_BATDJ      RREIERMEEVRRDIQRQEAQKLAEQLASEL---REKNVNFKEEDLSNMDTNKLVMLQISQ
EIF3A_YARLI       ARELERIRKEQDAIREEEKKKLAEEINA------KGIITIDLDKLEGLDTNALRKMQVDQ
EIF3A_ARATH       ERRKQRILREIEEKELEEAQALLEETEKRM--KKGKKKPLLDG--EKVTKQSVKERALTE
F6I4Q7_VITVI      QRKTQRILREIEERELEEAQALLQEAEKRS--KKKGKKPIAEG--EKVTKQSLMELALSE
C5XM02_SORBI      QREQDRIRREIEEKNKAEAKKLLEDL------KKAGKKHVVVE--GELTKEAIMELARNE
A9RFG7_PHYPA      RREEARIRKEIEEKELEEARALLAEAEKRK--GKKGKKGGVDGVISKLSKQLLMEEALSE
A9SFU3_PHYPA      RREEARIRKEIEEKELEEARAMLAEAEKRK--GKKGKKGITDGVISKLSKQHLMEEALSE
A8HRF8_CHLRE      RREAERIQREMEEKEQEELRAHLGARNIKV--KDG----------EKLEKNTVIKDLMSE
D0P3U0_PHYIT      RREADKKQKIQDEIKLKETRQMLDKL---------GHTNVSDMDLATIDKEKVLNEAKEK
H3GEW8_PHYRM      RREAEKKQKIQDEIKLKETRQMLDKL---------GHTDVSDLDLATIDKEKVLNEAKEK
Q4UGH6_THEAN      QLELQRKKDERYKIKSDIANQMLQELRKLCL-SSSSKIYIKGKGLDEYTVDDLIEGLLEY
Q4N979_THEPA      QLELQRKKDERYKIKSDIANQMLQELRKLCL-SSSSKIYIKGKGLDEFTVDDLIEGLLEC
A7AQQ1_BABBO      QMENQRKKDEKMKMKMETAQQMLEAIRKLGG-GQASKIVIKGKTLAEINVEDVMDGFVDF
Q8I5S6_PLAF7      KGEKLRIKEEKHKKKTEAAEQMLKEIKKLCS-TNTTKILMKGKYMDEITIDDILNGYVDF
Q7RG05_PLAYO      KGEKLRIKEEKIKKKSEAAEQMLKEIKKLCT-NSTSKILMKGKYLDEITIEDILNGYVDF
B3LCC3_PLAKH      KGEKLRIKEEKTKKKSEAAEQMLKEIKKLCT-NNTGKILMKGKYLDEITIEDILNGYVDF
A5JZU1_PLAVS      KGEKLRIKEEKTKKKSEAAEQMLKEIKKLCT-NNTTKILMKGKYLDEITIEDILNGYVDF
G4V5Q4_SCHMA      QRERMKTEDEKARLKLRMARTSLKMFLDLKIDTKLDLKELTEEQLENFDADKLINKQKQE
EIF3A_CRYNJ       QAEIDRVRKQIHETKQAEAKQLAASLAA------QGALKVDISSIEDLDSSKLVAMQVEQ
EIF3A_MONBE       ELERQKLQLQREEIERQKALEALNDVSSSSAGQKVVQALNKSDLGTKITAQDIHKMAYEQ
B7G0T8_PHATC      LREIEKQRKIQQELDNQEKKRFLAAMGKKTE-------DISEEQIAKIDTEALQREHEAK
                                                                              

EIF3A_DICDI       IDKAKVEMKAKIAKIA----------KQLYILERAYREEELPVVESLQKTKAVEDKQYFE
F0ZBR6_DICPU      VDKAKVEMRAKVAKIS----------KQLYILERAYREEELPVVEKLQEVKKVEDKEYFE
D3BGC0_POLPP      MDKAKVEMATKVAKLS----------KQIYYLERAFRHEEVPVIKSQLEAKQSEDREYFA
EIF3A_HUMAN       LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWE
G1P5I7_MYOLU      LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWE
G1LTU8_AILME      LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWE
EIF3A_MOUSE       LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRVKDMDLWE
H0WQ74_OTOGA      LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWE
EIF3A_RAT         LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKSAYEEQRVKDMDLWE
EIF3A_DANRE       LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKKAYEEQRIKDMELWE
H3B4Y5_LATCH      LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLIKKAYEEQRVNDMEVWE
EIF3A_XENTR       LEKEKKELQERLKNQE----------KKIDYFERAKRLEEIPLLKKAYEEQRINDMELWE
B7Q355_IXOSC      LDRERKEMQTKLKKQE----------RKVDYLERAKRLEEIALLQEAYERSKLEDEKFWQ
C3YRF7_BRAFL      LEKEKKELAEKLKAQE----------KKVDHFERAKRLEELPALQKSHAELLEERRLTWD
EIF3A_NEMVE       LDKEKRELQTKLKTQE----------KKVDYFARAMRMEEIPLLNKQYEEHLVADREFWE
EIF3A_DROME       LQREAKELQSKLKSQE----------KKIDYFERAKRLEEIPLFEKYLAEKQVKDKEFWE
EIF3A_DROPS       LQREAKELQSKLKSQE----------KKIDYYERAKRLEEIPLFEKYLAEKQVKDKEFWE
W5JG72_ANODA      RVKERKAHDTSLKTQE----------KKIDYFERAKRLEEIPLIEKYLQERSVQDKEFWE
EIF3A_ANOGA       RLKERKAHENNLKTQE----------KKIDYFERAKRLEEIPLIEKYLQDRSVQDKEFWE
EIF3A_AEDAE       RQKERKAHDNNLKSQE----------KKIDYFERAKRLEEIPLIEKYLEDKLVQDKQFWE
E9GZK2_DAPPU      LEKERKELQTKLRSQE----------KKIDHLERAKRIEEIPLLEKYLAERKVQDKLLWK
E0VV02_PEDHC      IQKEKREMQQKLKTQE----------KRVDYFERAKRLEEIPLLEKAFEEKQVQDKALWE
EIF3A_CAEBR       LDKERAETQRRLQQQE----------KKFDHHIRALHLEEMNERRAVMHMRLNEAPRLHE
EIF3A_CAEEL       LDKERAETQRRLQQQE----------KNFDHHVRALHLEELNERRAVMNMRLSEAPKLHD
EIF3A_YEAST       VSKNKSELESRMEYAM----------KKLDHTERALRKVELPLLQKEVDKLQETDTANYE
EIF3A_CANGA       LSKNKDELEERMNFAV----------KRMDHLERAYRKVELPLLKKQADELRATDEVNFG
EIF3A_VANPO       LSQDKSELEDRMTSSL----------QKLDHAERAYRKSELPLLRKEAESLKETDMNKFN
EIF3A_KLULA       VAKNKKDLTERMTYAF----------KKLDHLERAYRQMELPLLEKDAEEQKKRDRENYD
EIF3A_CANAL       LNKDKKELETKLQATA----------KKADHLERAYRRYELNLLEADLEIQLDLEKKDYE
EIF3A_EMENI       LEKEKNELTERVRATG----------KRIDHLERAFRREELKHIAEDYEAQKKVDMEIYE
EIF3A_ASPFU       LEKEKNELNERIRTTA----------KRIDHLERAFRREELKHIPEDYEAQKKRDMELYE
C0NC78_AJECG      LEKEKNELNDRVRITA----------KRIDHLERAYRREELKHLPADYEAQRKLDLEVYE
Q0V6S4_PHANO      LEKEKEQLGEQLRIAG----------KRIDHLERAYRKEEVKHLKEDYEKQMESDKAAYE
C7YNL9_NECH7      LEREKNDVNERLRITG----------KRLDHLERAFRKEEAKKLHEDHAKQIEEDRAIYE
EIF3A_NEUCR       LEREKNSVAEKLRITG----------KRLDHLERAFRKEEAKKLPEDYAKQRERDLAAYE
A7F4P3_SCLS1      LEREKNDTNEKLRITG----------KRIDHLERAFRKEEAKKLPADYEAQRQRDLAAYE
D5GPY7_TUBMM      LEKEKREMAEKLRITG----------KRIDHLERALRREEVNVLPKDLERQRAEDLAAYE
EIF3A_SCHPO       VEKQNKSMNERLRVIG----------KRIDHLERAYRREAIPLWEEDAKQQAEHDREIFY
A8P1V9_COPC7      LEKEKKEMNERLRIIA----------KRIDHIERAYRKEERPLLAQDYELQQKLDKELFI
EIF3A_USTMA       IEKEKKELAERLRLIH----------RRMDHLERAYRREEAPLLSADYERQKQEDLQYHK
F4NW26_BATDJ      LDKERRELMLKIKAVH----------RRIDHTERAMRLEEIPLLEKDYKKQDEMDRLAFD
EIF3A_YARLI       LAKETKELGDRLRVTA----------RRIDHTERAYRMEEIKLVEDDFVKQKQRDREIYD
EIF3A_ARATH       QLKERQEMEKKLQKLA----------KTMDYLERAKREEAAPLIEAAYQRRLVEEREFYE
F6I4Q7_VITVI      QLRERQEMEKKLQKLA----------KTMDYLERAKREEAAPLIEAAFQQRLVEEKAFHE
C5XM02_SORBI      QLKERQEMEKKLQKFA----------KTMDYLERAKRQEEAPLIEQAFQKRLEEEKILHE
A9RFG7_PHYPA      QIRERQEMERKLQKLA----------KTMDYLERAKREEERPLIEEAYHKRLQDDERFYQ
A9SFU3_PHYPA      QIKERQEMERKLQKLS----------KTMDHLERAKREEERPLIEEAYRKRLQDDEKFYQ
A8HRF8_CHLRE      RIKEQQEMERRMARLA----------KNMDHLERARREEEAPYLEAAWKERQEADRAYWE
D0P3U0_PHYIT      ARKAKELAQQKLRENA----------RRLDYIVRATREEEQPILQRQAAEAKAEALKRYE
H3GEW8_PHYRM      ARKAKELAQQKLRENA----------RRLDYIVRATREEEQPILQRQVSDAKAEALKRYE
Q4UGH6_THEAN      EDLEKAQEEHMVRERQELQKQRRNEVRKVEHFLRAVREADKQLYDAYLEELVKNDTALLL
Q4N979_THEPA      EDLEKAQEEHMVRERQELQKQRRNEVRKVEHFLRAVREADKQLYDAYLEDLVKRDTALLL
A7AQQ1_BABBO      DDVEKAQEELKLKERQEIAKQRRAEIKRLDHYVRALREHQQELYESWKKQVLEEDTKKLL
Q8I5S6_PLAF7      DDIEEAQEKLRLNERNEIIKVRKMEAKKVDHYFRAVRQVELSHMNRWIALVFQEDTEILL
Q7RG05_PLAYO      EDIEEVQGKIRLNERNEIIKIRKAEAKKVDHYFRALRQVELSHMNKWIALIFQEDTEILL
B3LCC3_PLAKH      EDIEEAQEKLRLNERNEIIKVRKMEYKKVDHYFRALRQVELSHMNKWIALVFQEDTEILL
A5JZU1_PLAVS      EDIEEAQEKLRLNERNEIIKVRKMEYKKVDHYFRALRQVELSHMNKWIALVFQEDTEILL
G4V5Q4_SCHMA      VKKKRKELAEKAKTMA----------KKLDYYTRACRIEEIPLLQANVEPEAMESRELFE
EIF3A_CRYNJ       LAKEKKELSERLRIVG----------KRVDHLERAMRKEERPLLAQDYERQKAEDRAAHD
EIF3A_MONBE       QKKDARERQERLRAEE----------KRLDHMERAKRLREIPRRKEHIAAMSEQNAKWHT
B7G0T8_PHATC      INKEREEAERKTRETA----------KKLDYLVRAIRIEELPLIKKKYEEKTKLDKERYE
                                            :      ** :                       

EIF3A_DICDI       STQAEFLKLHREVHDRNVTEKA--RLNRIVPEYQKFTQAVIEERKKQLPALQKEQEKRFQ
F0ZBR6_DICPU      KTQNDYLQTHKSIHDRNIAEKN--RLNRIVSDYQTFTQHILEERKKQLPALQQEQEKRFQ
D3BGC0_POLPP      AQQAEHLAKHKERFELDVKEKH--RLARMFDDIQAHTNKVLDQRRQHLPALQKQQQARFE
EIF3A_HUMAN       QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLA
G1P5I7_MYOLU      QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFEMRLKAARQSVYEEKLKQFEERLA
G1LTU8_AILME      QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLA
EIF3A_MOUSE       QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLA
H0WQ74_OTOGA      QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFVMRLKAARQSIYEEKLKQFEERLA
EIF3A_RAT         QQEEERITTMQLEREKALEHKN--RMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLA
EIF3A_DANRE       LQEEERITNMKMEREKALEHKQ--RMSRMMEDKENFLSKIKAARSFIYEEKLKQFQERLV
H3B4Y5_LATCH      QQEEERIMNMKLEREKALEHKR--RMFRMLEDRDSFETKLKAARRSIYEEKLKQFQEKLA
EIF3A_XENTR       LQEEERISTLLLEREKAVEHKN--RMSRMVEDKELFVSKLKASRQSLYEAKLKQFQERLA
B7Q355_IXOSC      QKEEERIRLLVQEREIALQHKV--RMLRMREDKEEFLSRLTQDRYQVYKDKRDRFEARLE
C3YRF7_BRAFL      QVEEERIHTLTEEREVALQHKH--RMACMMDDKDKFINMLKDSRKSVFKDKIAAFNAQLN
EIF3A_NEMVE       NQEEERVRKAIEEHEKLVETSA--RLQRMIPDKDAFINTLRESRTEEYQAKFQAFQAKLE
EIF3A_DROME       ATEKTRIENAIAERKDAVAQQE--RLKRMYPDRDEFLEALKKERASLYVEKLKKFEAALE
EIF3A_DROPS       ATEKTRIENAIAERKDAVSQQE--RLKRMYPDRDEFLEALKKERASLYVEKLKKFEIALE
W5JG72_ANODA      KQEAARIEAAIAERKTAEACQE--RLKRMLPDRDIYWQQLKNERGNQFAEKLKQFNVALE
EIF3A_ANOGA       KQEAARIEAAIAERKNAEACQE--RLKRMLPDRDVYWQQLKNERGNQFAEKLKQFNQALE
EIF3A_AEDAE       KQEASRIEAAIAERKNAEAVQE--RLKRMQPDREIFWQKLKGERSNQFAEKLKAFNVALE
E9GZK2_DAPPU      QQEEERIAQLQEERKVAMLHRD--RLMRMRVDKEKFIDNLKSARRSVFKEKLAEFETMYD
E0VV02_PEDHC      QREKERIEKLIEDRELAVKCAE--RLKRMADDKNAFLEKLKSERKNVYLEKLKDFEKRLD
EIF3A_CAEBR       EYENKRIEKEIAAHENHVKLWS--MWDQVREATLDWVETVKVENQENLEKKISDWEVKLE
EIF3A_CAEEL       LYEEARIAKEIAAHDSHVKLWG--MWDQVRDATFDWVESVKIDNQETLEKKLSDWQAKLE
EIF3A_YEAST       AMKKKIVDAAKAEYEARMADRK--NLVMVYDDYLKFKEHVSGTKESELAAIRNQKKAELE
EIF3A_CANGA       NMKKKIVDAAKAEYEAKMEDYN--RVSSVFDDYKTLRDRMLAAHNEKFAAIRAENAAKLE
EIF3A_VANPO       DMKSKIVDTARAEFDAKMEDHN--RLVGVYNDYVSLKDRLTTTVEEKFKLIRAENAAKFE
EIF3A_KLULA       NFKKKLIETSKADYEKKLALHQ--RLNKIYSTFNQYKSSVIAEKKEELEKQRALKEAQLE
EIF3A_CANAL       FLKQSKINKAKKDHDNAIELKK--RLQRILPDYSKFKSEIDAKNEVKLKQLQKEAQIKFE
EIF3A_EMENI       RQKAQTLAEAEAKHKEAVALKH--RLSRLIPVFSSFRKEVSEKRHEEFEKRRKAAEREFE
EIF3A_ASPFU       AIKAETLKEAEEKHKEAVALKH--RLSRLVPVFSSFRKEVSEKRHEEFEKRRKAAEREFE
C0NC78_AJECG      KNKADTLAAAKLKHKEDVALKH--RLGRLVPYFNDFRKNLQEKRHVEFEKNRKAAEREFE
Q0V6S4_PHANO      KATAETLKEAEEKHKADVALKH--RLSRLVPTYQEFVTTVKQQRKNEFEKRSKAAQKELE
C7YNL9_NECH7      KVKAQTLKDAEQKHKESVELKH--RLSRLVPQYESFRDSLHERRRDEFEKRRRDAERELE
EIF3A_NEUCR       RTKAQTLKEAELKHKADVELKH--RLTRLMPFYESFRSDLHERRRDEFEKRRRDAEREME
A7F4P3_SCLS1      KTKAQTLKDAEAKHAENVALKH--RLARLVSHYESFRDDIAERRHEEFDKRRRDAEKELE
D5GPY7_TUBMM      KKKRITLANSKRQHEEAVALKR--RLSRLVPIYETFRNDIKQQRHQEFESRRKAAEKQLE
EIF3A_SCHPO       EREKQRKEVQERKHEQAIKDKK--AFAQFASYIHAYKQNIDDERDKAYQEAYAKAKNVID
A8P1V9_COPC7      NTQKAHKEAARLAHQETVDAKH--RLARMRADYEAKKAEILERKGGEYQKKLDAAKKKIE
EIF3A_USTMA       AARITLLQTSKDKHAADLEIKK--RLTRILPDYQQLRSIIEDKRRGEFEERRRKATEQIE
F4NW26_BATDJ      NGHAARLEAAKAKYACDKKQKT--SVLRMMDDYTCYLNDLKSRQKEEFAVLQEQAAAKLK
EIF3A_YARLI       TRIKLIKDTAKAEHDAKVELAK--RLQRAVPFYKSFRDDIRVKREAEFTRLREEAVKNLA
EIF3A_ARATH       REQQREVELSKERHESDLKEKN--RLSRMLGNKEIFQAQVISRRQAEFDRIRTEREE--R
F6I4Q7_VITVI      HEQQQEIEVSRQRHDGDLREKN--RLVRMLDKKMIFQERVMNRRQAEYSRLRAEREE--R
C5XM02_SORBI      QEQLREIELSKQHHAGDLQEKN--RLSRMLEHKNAFQERIVQRREAEFGRLEKERDE--R
A9RFG7_PHYPA      QQQEQAIEQSKKQHETDVVEKH--RLERMGEDKEIFQRQVVSRRHGEFERLKRLREE--R
A9SFU3_PHYPA      EQQEQALEQSKKQHDTDVVEKN--RLIRMAEDKEIFEEQVISRRQGEFARLRRLREE--R
A8HRF8_CHLRE      QSQAEAARLHRQAWEVDVEEKK--RLAYMVADKEVFKGIIMQRREAEFHALRRERER--R
D0P3U0_PHYIT      EESAAKLKRAKEEHEHGLKEKA--RLAPAIEASAEFVKAHKARRIEEYKKASEEQKKKAM
H3GEW8_PHYRM      QESAAKLKRAKEEHEHGLKEKA--RLAPAIQVSAEFIEAHKARRIEQYKKASEEQKKKAM
Q4UGH6_THEAN      EVQKSREDKYKQDAEAMRQEKI--LFKSYAAEKQQWVEKQLVSRKKDFQSKLDAQNARFK
Q4N979_THEPA      EVQKSREDKYKQNAEAMRQEKI--LFKSFEAEKQQWVEKQLQSRKKEHQSKVDAQNARFK
A7AQQ1_BABBO      EIQQKREAMWKADTEILKEQKN--ALIEAIPEKEKWINDTMARRQAIYDAEIEEQRKRFT
Q8I5S6_PLAF7      QEQKAAEEEQKADFEAALKEKE--EYVKFSIDIEEFTKNEMKLRVEEFEKNLKAQKERLY
Q7RG05_PLAYO      QEQKAVEEEKKADFEAALKEKE--EYMKFSNDIEEFTKSEMQQRIVEFEKDLKEQKERLH
B3LCC3_PLAKH      QEQKAAEEEQKADFEAALKEKE--EYVKFSNDIEEFTKSEMKDRIVEFEKNLKDQKDRLH
A5JZU1_PLAVS      QEQKAAEEEQKADFEAALREKE--EYVKFSNDIEEFTKSEMKDRIVEFEKNLKDQKDRLH
G4V5Q4_SCHMA      QSVREIEEHSKAEHARQLKERN--RLIRMKSDVQRLVSQLKEARDNRYRAKLAEWEALCD
EIF3A_CRYNJ       RANQIAREQAIEQQRAARELKQ--RLGRMLEDYEAVKERIESQMQEELKAAKEEARRKIE
EIF3A_MONBE       ELQSARLEKARVDHAKALGLKE--LLKAFAPDKDAYIEEKTAERRKEYMAKLDDFKQRMQ
B7G0T8_PHATC      QENIEKAQKAKLQWEADVKDKAVLESHNVFAYCSEFENSVMVGRQAEHDVICQRAEEEAE
                                                                              

EIF3A_DICDI       EFLIQQEQDVQERKAKREK-------ARIAAAQEKARKEEQERERLEQEHLEQERLEEER
F0ZBR6_DICPU      EFLRQQEQEVAERKAQKEA-------TRKAAAEAKAREEEEKRRREEEERAAREKEEQER
D3BGC0_POLPP      KFMEQQAAEQAAKKAKKEEEKRIAEEKRIREAEEAARLEKERQEALANETYSQRKERERR
EIF3A_HUMAN       EERHNRLEERKRQRKEERRI------TYYREKEEEEQRRAEEQMLKEREERERAERAKRE
G1P5I7_MYOLU      EERHNRLEERKRQRKEERRI------TYYREKEEEEQRRAEEQMLKEREERERAERAKRE
G1LTU8_AILME      EERHNRLEERKRQRKEERRI------TYHREKEEEEQRRAEEQMLKEREERERAERAKRE
EIF3A_MOUSE       EERHSRLEDRKRQRKEERKI------TYYREKEEEEQRRAEEQMLKEREERERAERAKRE
H0WQ74_OTOGA      EERHNRLEERKRQRKEERRI------TYYREKEEEEQRRAEEKMLKEREERERAERAKRE
EIF3A_RAT         EERHNRLEERKRQRKEERKI------TYYREKEEEEQRRAEEQMLKEREERERAERAKRE
EIF3A_DANRE       EERKKRLEERKKQRKEDRRK------AFYHQKEEEAQRIREEQLKKEREERERLEQEQRE
H3B4Y5_LATCH      EERKKRLEERKKQRKEDRRI------AFYKAKEEEEQRVQEEQLKNEREERERIEREKRE
EIF3A_XENTR       EEKAARLEERKRERKEERRV------NYYRDKEEEEERLREEQLKQEREEQEKVENEKRE
B7Q355_IXOSC      EERNKRLAARKAERKEERRE------KYLREKEESERRAALEKQRKIEEE----------
C3YRF7_BRAFL      TERKKRLAQRKEQRKEERRR------KWLEEKEEEEQRRRDEELIREREQKEAEEQEKRE
EIF3A_NEMVE       QVRKERLEVRRKRRIKDRKE------RKKIEMEEAKKREQEEKERK-KEEKERIEREERE
EIF3A_DROME       AERKKRLADRIIRRREERRQ------AFLREKEE-ERLRKEEEIRLAQAAEERAAAEARR
EIF3A_DROPS       AERKKRLADRVIRRREERRQ------AFLREKEE-ERLRKEEEIRLAQAAEERAAAEARR
W5JG72_ANODA      EERKRRLADRVIKRREERRQ------KWLKEKEE-ERRRVEEELRKKKEEEERIERERRA
EIF3A_ANOGA       EERKRRLADRVVKRREERRM------KWLKEKEE-ERRRIEEELRKQKEEADRIERERRA
EIF3A_AEDAE       EERKRRLTERVYERREERRQ------KWLREKEE-ERRRAEEEIRKQRQEEERIERERRA
E9GZK2_DAPPU      TVRSDRLKQRREQRREQRR-----------------------------------------
E0VV02_PEDHC      EERKKRLAERRQRRKEERRE--------KQAAAE-KKRLEEEERRKQREEEEKQEKLRKM
EIF3A_CAEBR       AVRNSRLAERAEKRKKERKE------AAMQAKIAEERKRREEEERARQAVIDSQRRPHGE
EIF3A_CAEEL       AVRNNRLAERAEDRKKKRKE------DAIQAKIAEERKKREEEERARLQVIEGQRRQHND
EIF3A_YEAST       AAKKARIEEVRKRRYEEAIA------RRKEEIANAERQKRAQELAEATRKQREIEEAAAK
EIF3A_CANGA       AAKKARIEEVRKQRYEELLA------RSEAEKKAAEEAERRAKLDEIARKQREMEEALER
EIF3A_VANPO       AAKKARIEEVRKQRYEELVA------ERKAEIEAEEREERAKKQEETARKQKEMEEAAER
EIF3A_KLULA       EAKKQRIEQVRKERYEAKVA------EIQAAIEAEAAEKEALAKEEELAKRRAERERINK
EIF3A_CANAL       KAKQERIESVKKHRIEELKI------RKERERKAAAEEAARQAKAAEMAKLKEELRIQKE
EIF3A_EMENI       AKKKQRVKEVQERRRREKI--------ERENAERAKREEEE---RIKREEEERAARDAER
EIF3A_ASPFU       AKKKQRIKEVQERRRRERA--------EREAEERRRKEEEE---RAKREEEERIAKEEER
C0NC78_AJECG      NKKRQRIKEVQERLRRERM--------EREEEERRQREEQE---RIEREEQEKAARDAER
Q0V6S4_PHANO      SKKAARVKEFRERFLREKR--------EREEAERRQREEEE---REREEAEAKAKADEEK
C7YNL9_NECH7      KQISIRKKEVRDRRLREKR--------EREEKERELREAEE---KAAREREERELREEAR
EIF3A_NEUCR       KQINARRKEAREKRIREKR--------EREERERQLREAEE---RAAREKEEERKRLEAR
A7F4P3_SCLS1      KQVAQRRKEFKERKIREKR--------EREEQERKLREEEE---RAQKEKAEKDEREEKR
D5GPY7_TUBMM      VEMGKRRQEVRAAKERKRK--------EAEAAERRRVEEEE---RARKEEEERVRKEAEL
EIF3A_SCHPO       AERERQRKEIFEQKLAEAI--------REAEEEAARAAEEE---ANRELHEQEEAQKRAI
A8P1V9_COPC7      AEKEKRREAVFKAREEERQR------KEMEEAEARAREEEERRLEAEREAEEARRREEEE
EIF3A_USTMA       LEKERRRQQVRDERRRERQ--------EAEEAERRRVQEEQ---EARARAEEEERLAEQR
F4NW26_BATDJ      AAKAKRVKELRARHEADKIR------RANEEAERIKREEEE-LLEAERAKQNAIKAEEE-
EIF3A_YARLI       EAKAARIEEVKAKRIADAK--------RAEEEAKAAAEAEA---KAAAEAEAKAKAEQEM
EIF3A_ARATH       ISKIIREKKQERDIKRKQIY------YLKIEEERIRKLQEEEEARKQEEAERLKKVEAER
F6I4Q7_VITVI      ISQIIQSRKQEREAKRKMLF------YLRSEEERMKKAREEEEARKREEAERRRKEEAER
C5XM02_SORBI      ISQLISSRKRERETVRKLMY------YLNLEEQRIEMLREEEEARKREEEERRKREEAER
A9RFG7_PHYPA      LAEERAIRSHEREIRRKKEY------FKRQEEQRLLKIQEEEEARKREEEERKRREEAER
A9SFU3_PHYPA      LREERAMRSLDRQIRRKKEY------FRRQEEARLLKIKEEEEARKREEEERKRKEEAER
A8HRF8_CHLRE      LAEMRAQKKYEREIARRKAY------VTRCRAEVEDRIREMEEQKRREEEAKKK------
D0P3U0_PHYIT      LERLSARVAHAKERYEEEQR------CLREEEEEKERIRREEEAE-RERQRLIQVEEELR
H3GEW8_PHYRM      LERLSARVAHAKERYEEEQR------HLREEEEEKERVRREEEAE-RERERQLEVEEELR
Q4UGH6_THEAN      KMLLEEKIARAKMRYNQEQMRLEQKRKEEQLKLEQKRKEEEMRLEQKRKEEEMRKRREQE
Q4N979_THEPA      KMLVEEKIARAKMRYNQEQLRLEQKRKEEQLRLEQKRKEEELRLEQKRKEEELRKRREQE
A7AQQ1_BABBO      EILIKDKIQRARERRD-----YELRRQKE---LEEERIREEERM--RREMEEKRKQEEEA
Q8I5S6_PLAF7      NILKEEKIQRAKERRDQHIRKLKAEEERKRREEEEERLLKEEMERKKKEEA-RKKLEEIS
Q7RG05_PLAYO      KLLKEEKIQRARDRREQHIRKLKAEEERKRREEEEERLRKEEIERKKKEEAHKKKLDEIS
B3LCC3_PLAKH      QLLKDEKIQRAKERREQHLRKLKAEEERKRREEEEERLMKEEMERKKKEEAHRKKLDEIS
A5JZU1_PLAVS      QLLKDEKVQRAKDRREQHLRKLKAEEERKRREEEEERLMKEEMERKKKEEAHRKRLDEIS
G4V5Q4_SCHMA      QTRSERLAERRAKHEAELEAEARRRAAQEAIEREEQKKRELAAEAERQKREQEAKEAAER
EIF3A_CRYNJ       EEKAQLREKVIKRKREEKER-------KLKEAREAEERKRKEEEEAAQKAEEEARAAAAL
EIF3A_MONBE       EQKIRLEREERERKREEKRR-------AEEEEQRRIKQEEEDRKQREREAKREQERQEQL
B7G0T8_PHATC      MEAEKAKISRARKRKAAEEKLMAAEAAREAEEEARRKEEEEKRKKDEARREREAKEEERR
                                                                              

EIF3A_DICDI       K-----NAPYVPPSS------RRTFRDDDD------EREESGRWG-----GRRGGDDFGR
F0ZBR6_DICPU      K-----NAPYVPPS-------RKTFDDDSGSGRPFGDRGNRDNWG-----DDRRGG-FGR
D3BGC0_POLPP      EKAAADAAAGVSPKEENWRGRDEPRRDESWGREPRRDEPREGGWGREPRRDEPREGGWGR
EIF3A_HUMAN       EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGT
G1P5I7_MYOLU      EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGT
G1LTU8_AILME      EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGT
EIF3A_MOUSE       EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGT
H0WQ74_OTOGA      EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGT
EIF3A_RAT         EELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGT
EIF3A_DANRE       EEEREYQERLRKLEEQERKQRARQQEIEERERRKEEERRAPEE---KPNKEWAERE-ESG
H3B4Y5_LATCH      AEEQEYQERLRKLEEQERKKRQRELEIEERERRREEERKAAEDTFQRRESRWSEKDTESG
EIF3A_XENTR       AEQRDYQERLKKLEEQERKKRQRELEIEERERKREEERRGGDDTFRKDSSRWGERE-ESG
B7Q355_IXOSC      --------RLAKLREMEAIKLAREREIEEKQRRLEEEERQRQDTSEKSRAAPARIE-ESS
C3YRF7_BRAFL      KEEEAYRAKLAQLEAIAEKQRQREREIEEREAKRRMELQTEAEPVRAQDGGRDDWRAKDG
EIF3A_NEMVE       AKEREYAERIAKQNEIDRKRREKELEIERRLEERAGVGQVQQIRCLFITGWGDHEDGGDR
EIF3A_DROME       LER---EAEDEKRRAQYEKQRAKEEEAERKIKEDRDRLSRELASERERTEKDRDTWRPRG
EIF3A_DROPS       LER---EAEDEKRRAQYEKQRAKEEEAERKIKEDRDRLAREVAVERERSDKERDTWRPRG
W5JG72_ANODA      EER---RIENEKQRLIAEKQRAKEEEVERKLAEERE--RLKEADRREREA-----RRERG
EIF3A_ANOGA       EER---RIQDEKNRQLAEKQLAIAEEVERRRREELE--QMKEADGR------------RE
EIF3A_AEDAE       EER---RIEDEKARLLEEKRRAREEEATKKAEENRQ--MQAKAREREREREADSWRDRRG
E9GZK2_DAPPU      ------------------IQWIKGLHLQIRFLKNKTKTH---------------------
E0VV02_PEDHC      REDELYRKEKEKKDHQAEIQRAREEEAERKRLEEEKKFKDYEPWRSEKEPRFRDDRRDRD
EIF3A_CAEBR       RGQRREMENSAAMQDSDWRRNAPPRDSMPQREPRPMRDGP--------------PREPFR
EIF3A_CAEEL       GRGRREMENSVAMQDNDWRRN-PPRESLPPRETRPMRDGPTREPREFRGDRDREPREPFR
EIF3A_YEAST       KSTPYSFRAGNREPPSTPSTLPKATVSPDKAKLDMIAQKQREMEEAIEQRLAGRTAGGSS
EIF3A_CANGA       KSAARTFTQ------------PRAPVVPN-ANLDEIARKQREMEEAIERKLAGKSAA-PA
EIF3A_VANPO       KSKASSAAAAK--------SILTGGNDARSAKLDEIARRQREIEQAAERKAQGPSAS---
EIF3A_KLULA       ER-------------------------------DEIARKQREIEELLEKKN-GSSRSSPV
EIF3A_CANAL       KD-------------------------------EALARKRAELEAAAAAAAAPSSSP---
EIF3A_EMENI       R---------------RILAEEKAKREEERAKMDEIAAKQRQREEEAEARLRAKRAGLSE
EIF3A_ASPFU       R---------------RILAEEKAKREEERKRLDEIAQRQKQREEEAEARRAARKSGLAE
C0NC78_AJECG      R---------------RQLAAEKAAREEERRILDEKAAIQKKREEEAEAKLKARKAGAVP
Q0V6S4_PHANO      R---------------ERMLEEKAKRDEERKALDEKARIQREREEAAEAKLAAKKAGRFG
C7YNL9_NECH7      K---------------EELAKLKEQREKERQEMLEKAALQQRREEEALARRKAEKE--RG
EIF3A_NEUCR       R---------------EELQRLKEEKEKEREKLREIAARQQQREEEAMARRKAEKEKLAA
A7F4P3_SCLS1      K---------------AEFAQLKAIREKERQEALEIAALQERRAEEASKRRAEEKA--RG
D5GPY7_TUBMM      R---------------ARMAEEKAKRDEERKRLDEIAAKQRQREQEVEERKARERAERES
EIF3A_SCHPO       E---------------ERTRAAREAKEREQREMAEKLERQRRIQQERDEEISRKLA----
A8P1V9_COPC7      RRAAEEEAARIK--AEEEKAALRKQRELERQEALEKARLQQQREEEAEARRAARRAEEKE
EIF3A_USTMA       R---VEEAQRAE--LEAKKRAEIEER---RAKFQATADKQRQREEEAEANRRSRAAGT--
F4NW26_BATDJ      ----------------------KAKAEEYRRKADEIANKQRERELEVEQKRLRVAEEPRR
EIF3A_YARLI       R---------------EKLLAEKKAREEANARADAAYEKQRQKEAELEAKLEAKRAGFSG
EIF3A_ARATH       KANLDKAFEKQRQREIELEEKSRREREELLRGTNAPPARLAEPTV----TPVGTTAPAAA
F6I4Q7_VITVI      RAKLDEIAEKQRQRERELEEKEKLRREALLGRPTEVPPKPSEPPTGGRPLEPGSAAPAAA
C5XM02_SORBI      KAKLDAIAEKQRQREIELEEKAKASREKLLKGSEAVRAPDSSPVALPPRESAAAPAAAAA
A9RFG7_PHYPA      LAKLEEIAQKQREREAAAEEREKREREEALQARLQEKPGKFVPPSLRKFRESGEELKRPS
A9SFU3_PHYPA      RAKFEELAAKQREREIAAEERQKREREEALRPKLDVKPGKFVPPSLRKRMESGNDTRRVG
A8HRF8_CHLRE      ------------------------------------------PASLATEGLAGAP-----
D0P3U0_PHYIT      RQEEEEAEERRIAEEKEREERSQRQREEEEKRVEQRSQGRFGSAGARGLSGSYRDSNRSR
H3GEW8_PHYRM      RQEEEEAEELRIAEEKEHEEKAQRERDEEEKHFEQRSQGRFGSAGARGVTGGPRDSFRSR
Q4UGH6_THEAN      LHRQRLDEIAEIQRQKQLEIERRLAATNNTVTVNSGYPYSNQLNKDVGRNYQKGLGRELN
Q4N979_THEPA      LHRQRLDEIAEIQRQKQLEIERRLAATNNTVTVNSGYGFSNSVNKDVGRNYQKGMTRDLN
A7AQQ1_BABBO      ERKRKLMEIAEKQRAKELEIQRRLDEQAARKS------------------------RTLT
Q8I5S6_PLAF7      KAQRERDLEMDLQMKRKKEESRRSERSHRKSSIDDDLTWRRG-DKGGSQNGDD-SYRRHD
Q7RG05_PLAYO      RIQRERDLEIEQQLLKQNEESRSGEKSLRKSSADDEFTWRRH-ETGTSQYDDD-NYKRHH
B3LCC3_PLAKH      RIQRERDLEIEQQLLKRKEESRIGDKYYRKPSYEDDFSWKRG-DKAGSQHDEDSNYKRLD
A5JZU1_PLAVS      RIQRERDLEIEQQLLRRKEESRNGDKYYRKSSYEDDFSWKRGGDKAGSQYDEDNNYKRLD
G4V5Q4_SCHMA      EVARLEEESKSWTRGDIKKDEPVSANPFARHRQSEISNTSGNAFRDFRRDDTSRYSDFGR
EIF3A_CRYNJ       EAEAAAAEQRRAEREAQRQSDLERIRAQQEREEEALRRRQAEKAAATSGGSAYRPPARAG
EIF3A_MONBE       KLEEAERKKMEEATKLQRQREEQVRAREQEKLSNLSAQTSQPTWKRSARSDAPTTAAPSS
B7G0T8_PHATC      RAEDERMEEERRKKAGPAKYIPPSQRLASGGERGGGGGEDRPSRFGGAGSYPGGGRYEGR
                                                                              

EIF3A_DICDI       SKADEGDR--WGRREDA-------------------------------------------
F0ZBR6_DICPU      DDRRSGDRDNWGSRRGG-------------------------------------------
D3BGC0_POLPP      RDEPRRDDGPWGRREEPR------------------------------------------
EIF3A_HUMAN       WRKGPEADSEWRRGPPEKEWRRG--------------EGRDEDRSHRRDE----------
G1P5I7_MYOLU      WRKAPEVDSEWRRGPPEKEWRRG--------------EGRDEERPIRRDE----------
G1LTU8_AILME      WRKGPEVDSEWRRGPPEKEWRRG--------------EGRDEERPHRREE----------
EIF3A_MOUSE       WRKGPEADSEWRRGPPEKEWRR---------------ETRDDERPHRRDE----------
H0WQ74_OTOGA      WRKGPEADSEWRRAPPEKEWRRG--------------EGRDEERPHRRDE----------
EIF3A_RAT         WRKGPEADSEWRRGPPEKEWRR---------------ETRDDERPHRRDE----------
EIF3A_DANRE       WRKRGEGESEWRRPVPDRDWRQE--------------GREGREEPDREDR----------
H3B4Y5_LATCH      WRK-SEPDNEWRRG------------------------GQDKYLPLQHRK----------
EIF3A_XENTR       WRRGADPD-ERKQVPPERDWRRGGPDSKPVINEDASNREEDENAALRKDEEQVSSRAFEE
B7Q355_IXOSC      WRK-------------------------------------REEDSNRKNE----------
C3YRF7_BRAFL      LGSRDEGAWRRRGDDAPR--------------------SRDMETPAEESS----------
EIF3A_NEMVE       WRD---------------------------------------------------------
EIF3A_DROME       GDRPS----ASN----------------------------GGSSEWRRAA----------
EIF3A_DROPS       GDRPS----AASAG------------------------GGGGAGEWRRAA----------
W5JG72_ANODA      RAPAG----AAGD---------------------------AKQESDWRSR----------
EIF3A_ANOGA       RRPAA----GPAE---------------------------PKPEESWRKG----------
EIF3A_AEDAE       GDAPA----AAAQ---------------------------PNPAAQEATK----------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      PDRNRDRER-------------------------------ERDRDRDRDR----------
EIF3A_CAEBR       EMPSS-------------------------------------------------------
EIF3A_CAEEL       EVPSS-------------------------------------------------------
EIF3A_YEAST       PATPA-------------------------------------------------------
EIF3A_CANGA       PAPAP-------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       PSTPT-------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       PPRTE-------------------------------------------------------
EIF3A_ASPFU       PPTRA-------------------------------------------------------
C0NC78_AJECG      VRMER-------------------------------------------------------
Q0V6S4_PHANO      ADRPI-------------------------------------------------------
C7YNL9_NECH7      PPTFS-------------------------------------------------------
EIF3A_NEUCR       TPSAY-------------------------------------------------------
A7F4P3_SCLS1      PVRGA-------------------------------------------------------
D5GPY7_TUBMM      LKRAA-------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      RERAA-------------------------------------------------------
EIF3A_USTMA       ---GA-------------------------------------------------------
F4NW26_BATDJ      KPVEA-------------------------------------------------------
EIF3A_YARLI       AGRQA-------------------------------------------------------
EIF3A_ARATH       AAA---AGAPAAPYVPKWKR----------------------------------------
F6I4Q7_VITVI      AAA---AAPASGKYVPKFRR----------------------------------------
C5XM02_SORBI      AAA---AAPAPSKYVPKFKRG---------------------------------------
A9RFG7_PHYPA      MEDRRDVRPPVEERRPLFLSSRSAPP----------------------------------
A9SFU3_PHYPA      ED--RDARPPVEERRPVFVSARVAP-----------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      DDDHRGDDRNDGEWTQVSRGGPSSRA----------------------------------
H3GEW8_PHYRM      DDDRRGDDKDDGEWTHVNRGGLSSRA----------------------------------
Q4UGH6_THEAN      NSSVRDMSVRDSSVVDSSMRDNVSVRNNV-------------------------------
Q4N979_THEPA      NSSVRDMSIRDSSVRDAS------VRDTS-------------------------------
A7AQQ1_BABBO      TAPVPEIR----------------------------------------------------
Q8I5S6_PLAF7      DHHDGTHRDRSEMRDRRDWSGRDRDRDRER------------------------------
Q7RG05_PLAYO      ENNDDHYRDASEKKDRKTWSGRDRERDRE-------------------------------
B3LCC3_PLAKH      DAQDSSYIDRSDRRERRDWPGRDRERERD-------------------------------
A5JZU1_PLAVS      EAQDSSYRDRSDRREKRDWPGRDKERDRD-------------------------------
G4V5Q4_SCHMA      LSGSK-------------------------------------------------------
EIF3A_CRYNJ       TTPPT-------------------------------------------------------
EIF3A_MONBE       MRVSSWKGDASDD-----------------------------------------------
B7G0T8_PHATC      SDDRG-------------------------------------------------------
                                                                              

EIF3A_DICDI       -----------------------------------------------PPPRRDEGGDRWG
F0ZBR6_DICPU      -----------------------------------------------DDDRRSGERDNWG
D3BGC0_POLPP      ----------------------------------------------RDEPREGGWRDAPR
EIF3A_HUMAN       -------ERPRRLG-DDEDREPSLRPDDDRVPR---------RGMDDDRGPRRGPEEDRF
G1P5I7_MYOLU      -------DRPRRLG-EDEERESSLRLEDDRIPR---------RGMDDDRAPRRAPDEDRF
G1LTU8_AILME      -------DRPRRLG-DEEERESSLRPDDDRIPR---------RGMDDDRGPRRGLDEDRF
EIF3A_MOUSE       -------DRLRRLGGDDEERESSLRPDDDRIPR---------RGLDDDRGPRRGPDEDRF
H0WQ74_OTOGA      -------ERPRRLG-DEEERESSLRPDNDRIPR---------RGMEDDRGPRRGPDEDRF
EIF3A_RAT         -------DRLRRLGGDDEERESSLRPDDDRIPR---------RGLDDDRGPRRGPDEDRF
EIF3A_DANRE       -------DLPFRRGGESARRGAS----DEKGLR---------RGCDDDRGPRRGGDDERP
H3B4Y5_LATCH      -------DSALLGGKNSVEGLPPCTVDGRDYPRG--------RGIDGWVFSDK---ENRG
EIF3A_XENTR       KVSLPDADEEKGGSWRDEDRGPKRGLEEDRGPRRGIDDAGPRRGFEEDRGPRRGIEDDRA
B7Q355_IXOSC      ---------LWRAS----------------------------RPKDNRETERKWGRDDSG
C3YRF7_BRAFL      ---------PAKQPWRPSGRSSWRDREQGGGVR------------DRAPADGRYPPDDSG
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       -------------------------------------------PAASERNDRGGERIERG
EIF3A_DROPS       -------------------------------------------APIGDRNERAGDRIERG
W5JG72_ANODA      -------------------------------------------PAAPAAGGGDDQQPGGA
EIF3A_ANOGA       -------------------------------------------PAAAAPANPAADEP---
EIF3A_AEDAE       -------------------------------------------PESGWRTAGAREPRGED
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      -------------------------------------------DRDRDRDRDRDRDRDKD
EIF3A_CAEBR       -------------------------------------------KADTDSSWRSSAQPTRK
EIF3A_CAEEL       -------------------------------------------KADTDNSWRSSAQPTRK
EIF3A_YEAST       -----------------------------------------------TPATPATPTPSSG
EIF3A_CANGA       -----------------------------------------------AASTPAASTPAA-
EIF3A_VANPO       -----------------------------------------------------TEAPDDE
EIF3A_KLULA       -----------------------------------------------PAPAPAQTAPVS-
EIF3A_CANAL       ----------------------------------------------------------PP
EIF3A_EMENI       -----------------------------------------------SEV-----RTAPR
EIF3A_ASPFU       -----------------------------------------------AELERPVERTAPR
C0NC78_AJECG      -----------------------------------------------TES---TERTAPR
Q0V6S4_PHANO      -----------------------------------------------SRDAPAEPSSAAA
C7YNL9_NECH7      -----------------------------------------------RGPERAERAERVE
EIF3A_NEUCR       -----------------------------------------------RPPAAAERTEAAA
A7F4P3_SCLS1      -----------------------------------------------PIERSDSTGERRA
D5GPY7_TUBMM      -----------------------------------------------PVEETPAIEAPGS
EIF3A_SCHPO       -----------------------------------------------------EKAAARR
A8P1V9_COPC7      -----------------------------------------------ALGRRPAVAAPTA
EIF3A_USTMA       -----------------------------------------------APAQELAAADATW
F4NW26_BATDJ      -----------------------------------------------FNSSWRPRPAAVE
EIF3A_YARLI       -----------------------------------------------PPSGGYVPPSRRE
EIF3A_ARATH       ------------------------------------------------------QTTEVS
F6I4Q7_VITVI      ------------------------------------------------------ERGESA
C5XM02_SORBI      -------------------------------------------------GDSSSSSSGSQ
A9RFG7_PHYPA      -----------------------------------------------RDADRPIDRESAN
A9SFU3_PHYPA      -----------------------------------------------RETDRHMERDAAS
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      -----------------------------------------------QTVAPEGRWERRG
H3GEW8_PHYRM      -----------------------------------------------QTVAPEGRWERRG
Q4UGH6_THEAN      ------------------------------------------------MARNSVMRHNVL
Q4N979_THEPA      ------------------------------------------------MRDNLTVRNNVM
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      ----------------------DRDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDR
Q7RG05_PLAYO      ---------------------------------RDRDRDRERDRDRDRERDRDRDRDRKY
B3LCC3_PLAKH      -----------------------------------RERDR------DRERERERDRDRIF
A5JZU1_PLAVS      -----------------------------------RERDRERDRDRDRERDRDKDRDRKY
G4V5Q4_SCHMA      -----------------------------------------------RVGFDNTPNTRSD
EIF3A_CRYNJ       ----------------------------------------------ASPAPSSGGPSWLA
EIF3A_MONBE       -----------------------------------------------SGRSQPFRPSRGG
B7G0T8_PHATC      -----------------------------------------------GGWRGGGDRSGDY
                                                                              

EIF3A_DICDI       RREDAPP---PRRDEGGDRWGKREDAP--PPRRDEGGWGRRDDAPPPRRDEGGDRWGRRD
F0ZBR6_DICPU      SRRDDAP---PQRGDGEDSW-KRDDAP--PQRREGGVFGREE----RRGDDRRGGYGREE
D3BGC0_POLPP      DAPRDAPRDAPRDAPRDAPRDAPRDAPRDAPRRDDGPWGREP-----RRDEPREGGWRDA
EIF3A_HUMAN       SRRGADDDRPSWRNTDDDRPPR---RIADEDR--------------------GNWRHADD
G1P5I7_MYOLU      PRRGADDDRPSWRNADDDRPPRPPRRIGDDDR--------------------GSWRHMDD
G1LTU8_AILME      SRRGVDDDRPSWRNADDDRPPR---RIGDEDR--------------------GSWRHADD
EIF3A_MOUSE       SRRGTDDDRPSWRNADDDRPPR---RIGDDDR--------------------GSWRHTDD
H0WQ74_OTOGA      SRRGADDDRPSWRNTDDDRPPR---RIGDDDRPPRRIGDDDRPPRRIGDDDRGSWRHADD
EIF3A_RAT         SRRGTDDDRPSWRNADDDRPPR---RIGDDDR--------------------GSWRHTDD
EIF3A_DANRE       PRRGFDDDRGTRRGFDDDRGQR----------------------------------RGDD
H3B4Y5_LATCH      FVKKKKNWLPLIKNAGKEGRSRDLPVVVGKMP-----------------EIHIIKPEMDI
EIF3A_XENTR       PRRGFDDDRGPRRGFDDDRGPR---RGFDEDR--------------------GPRRGIDD
B7Q355_IXOSC      PEKERAPPRPE-RDVGDDNWRR--------------------------------------
C3YRF7_BRAFL      PRR---DDWERRPPMDRDRRPG-----FEDGE-----------------------RRPLS
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       GERIERGGERLERGGERIERGG--------------------------------------
EIF3A_DROPS       GERMERGGDRMERGGDRMERGGE---------------------------------RTEH
W5JG72_ANODA      APPKKDVWQPRRDGGPRAAGAG-------------------------------------R
EIF3A_ANOGA       ---KKNVWQ-----GSGRYGPG-------------------------------------P
EIF3A_AEDAE       APKKDGVYQPRFRDVRGGGAGG-------------------------------------A
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      RDRDDGNDDMNWRRGGGPLKDEP---------------------------------KKVE
EIF3A_CAEBR       PDDRRSDDFRRDDGPRRSDDHRR-------------------------------------
EIF3A_CAEEL       PDDRRSD-----------------------------------------------------
EIF3A_YEAST       PKKMTMAEKLRAKRLAKGGR----------------------------------------
EIF3A_CANGA       PGKMSFAERMRLKRQQQQQK----------------------------------------
EIF3A_VANPO       GRNLTYAEKMKLRRASKK------------------------------------------
EIF3A_KLULA       NKPMSMAEKLRLKRMNAGRG----------------------------------------
EIF3A_CANAL       KKTMTFAERMRLKREGKLP-----------------------------------------
EIF3A_EMENI       LNIAPRTSGGPSWRERQAAKEA----AGGA---------APEAPKAEPEPPRRTGGYVPP
EIF3A_ASPFU       LNLVSRTGSGPSWRERQAAKEA----AGAAPAP-----AAAEAPKEEVQLPRRTGGYVPP
C0NC78_AJECG      LNLVGRA--GPTWRERQAAKEA----EAAAGSAIPPTEGAAPAAKEELPPPRTTGGYVPP
Q0V6S4_PHANO      PPRIALPGGKMTWREREAMKAAGQTPPPAAGAAPAPAESASPAPPAEAEAPK-RGGYVPP
C7YNL9_NECH7      RAEPSDGRRPPVFGAGKWREREANKGDDAPPPARGPPMER----AESNDRPPAGGPPR--
EIF3A_NEUCR       PPRIALAGNRPSWREREAAKAASGETAAPAPAAAEPVAERPRAAAPPAERTEAAAPPR--
A7F4P3_SCLS1      PLALAGASGKINWREKERLRAEGKEVPSDAPPAPRP--------APSVERTSSTGERRAP
D5GPY7_TUBMM      RR--WAPPKASSWRDREAERKTGDSASPLNGARDRE-RDRDSANASPAPAGERKKLNIAP
EIF3A_SCHPO       ANIGASSPSPGAWRRGGASAGGVS------------------------------------
A8P1V9_COPC7      LRASASMGKEEGVWRRSTPVNSGPPTPSRASGPGTPIAPTRSESPTPAAAGKYRPGALAA
EIF3A_USTMA       RRASGSPAPTQAESQR--PPIFGAARTGGAGGWRERLAAKEAAGGNATAAPSAPAAAPAP
F4NW26_BATDJ      PSKSVESSDKYVSPAARAALSGASTARPFEQ-------------SGFNSSRPGPGSHASD
EIF3A_YARLI       GGYVPPSRRGDAGAAPGAGSGG---------------------YTPPSRREGGGGGYVP-
EIF3A_ARATH       GPSAPTSSETDRR-----------------------------------------------
F6I4Q7_VITVI      VQAPP--PEPDRW-----------------------------------------------
C5XM02_SORBI      RPTDVRPRDEDRW-----------------------------------------------
A9RFG7_PHYPA      APPSKAYQPPRAR-----------------------------------------------
A9SFU3_PHYPA      PLSTDRYQPPRAR-----------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      PTARESFGDRDGRESGGLRRDFGGDR----------------DSGSRRGFGGDRDERESG
H3GEW8_PHYRM      PPARESSSDRDGREGGGLRRAFGGERGEREGGLRRGFGGEEREGGLRRGFGGDREEREGG
Q4UGH6_THEAN      RENSLMERNQSRRREYSNANQSQGSSGFSRHDPFNRNVARN---------------DSDV
Q4N979_THEPA      RDNAVMERNQNRRREYSNAHQGQGSSGFSRHDPFNRNLARN---------------DSDL
A7AQQ1_BABBO      -----------------------------RPEPRGKTQVSE---------------EPEM
Q8I5S6_PLAF7      DRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDR
Q7RG05_PLAYO      RREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDR
B3LCC3_PLAKH      RKDRDYRRDRSKDRERERSRDRDREYRKERDYRGDRDREYRSYRDK----------ERDR
A5JZU1_PLAVS      RKDKEYRRDRSKDRERERSRDRDREYRKDKDYRRDREKERDRDRDY----------RRDR
G4V5Q4_SCHMA      PSKDIWSRSGPRRTVPSEFDSLYEDDSG----------------------NAGGWTQVGS
EIF3A_CRYNJ       RRKAMEAQSAGGAPVASSPKPVP-------------------------------------
EIF3A_MONBE       ERDSGRSFSGLGDRGDRAPRDTGRSFSGLGDR-------------------GDRAPRDTG
B7G0T8_PHATC      RRGGDDRRGGDDRRGGDDRRGGD-------------------------------------
                                                                              

EIF3A_DICDI       DAPPRRDDAPPPR-------------RDDAPPPRRDEGGDRWGRRDDAPPRRDGGGSGGF
F0ZBR6_DICPU      ----RRGTDNWGR-------------RDEAPPRRDDNEG--WGRRDDAPPRPREGG--AF
D3BGC0_POLPP      ---PRDAPRDVPR-------------RDEP---RREEGGWRDGPRRDEPRREEGGWREGP
EIF3A_HUMAN       DRPPRRGLDEDR----------GSWRTADEDRGPRRGMDDDRGPRRGG-ADDERSSWRNA
G1P5I7_MYOLU      DRPPRRGLDEDR----------GNWRAADEDRGPRRGMDEDRGPRRGG-ADDERSSWRNA
G1LTU8_AILME      DRPPRRGLDEDR----------GSWRTADEDRGPRRGMDEDRGPRRGG-ADDERSSWRNA
EIF3A_MOUSE       DRPPRRGLDDER----------GSWRTADEDRGPRRGMDDDRGPRRGG-ADDERSSWRNA
H0WQ74_OTOGA      DRPPRRGLDEDR----------GSWRTADEDRGPRRGMDEDRGPRRGGGADDDRPSWRNT
EIF3A_RAT         DRPPRRGLDDDRPPRRGLDDERGSWRTAEEDRGPRRGMDDDRGPRRGG-ADDERSSWRNA
EIF3A_DANRE       DRGPRRGMDDDR--------------------GPRRPIDDDRGPRRSD------------
H3B4Y5_LATCH      CQSTTTGLESYS------------QRACCLGPCPKIGMKIEEWRRGEG-REDDKPSFRRD
EIF3A_XENTR       DRGPRRGFDEDR----------TPRRGFDDDRGPRRGFDDDRGPRRGF--DEDRGPRRGF
B7Q355_IXOSC      ----RRDQDEER-------------------PAPRASESSWRRDRDTS------------
C3YRF7_BRAFL      DDRDRRGPPDDR------------WRDADRRPAPREDSDWRRGPDRAP------------
EIF3A_NEMVE       ----------------------------------------ERGG----------------
EIF3A_DROME       -DRDRKDNEGAD----------SSWRVRREPDSQR-----AAAPKD--------------
EIF3A_DROPS       RDRERRDNEGAD----------SSWRVRREPDSQR-----GAGVKDAS------------
W5JG72_ANODA      DDGPRGGESAPS----------DKWRRGPEDDKDNQAGAGRDGPRRGP------------
EIF3A_ANOGA       RE--RGGETGPK----------DKWRTGPEDHEKD--GGGAGGMRR--------------
EIF3A_AEDAE       GGVERRADDQES----------NKWRHGGDDGGKD----DRDGPRR-M------------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      SWRPPALRNRGA----------ENRNMDRESKPADISENWRSGSRAEP------------
EIF3A_CAEBR       NDEFRRSDDFRR----------------------NDDFRRDGPPRPMS------------
EIF3A_CAEEL       --EFRRNDDVRR----------------------NDDVRRNDPPRPAS------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       HARG--GSDAAP---------------------PAGNRYVPPSQR----SSQPPSRTQ--
EIF3A_ASPFU       HLRS--GANASPA--------------TPPSNGPAPEKYVPRHMRESS-SSQPPSRTQ--
C0NC78_AJECG      QRRAVAGRDISAN--------------GERMPERVPERMPPRFNREAVPPPKSLSRSP--
Q0V6S4_PHANO      ALRAAGGAAPGGGWRELDVGLLHDQRGPSHQLPVAVSRLLPAGGRSFGDDRKASPASGGG
C7YNL9_NECH7      LQLSGSGNRPSWR-------------------DREAARSGGSGGADAGSSAPPPRFAPRG
EIF3A_NEUCR       LALAG--NRPSWR-------------------EREAAKAAS-GGGNAAAVPERSAPPLRA
A7F4P3_SCLS1      LALAGSGAKVGWR-------------------EREAAKGAAGGPSPSSRSEEK-------
D5GPY7_TUBMM      RTLPKEDIQVPPQ-----------------LTERTVERGAAPSPDAAAPKPGVYRPPALS
EIF3A_SCHPO       ---------------------------------RDSPRYSRGGYSRGS------------
A8P1V9_COPC7      AGGGWRARMEAKE--------------------RAAAEGGGAGSGGSGANTPARAASPAP
EIF3A_USTMA       ASSG--AYRPGMF--------------------RAAA---GAGAGGRTDRVAATPLPPAA
F4NW26_BATDJ      NRSGAFAANTSSR--------------------PAFGNSSSAGPRRDPSGFTPPPTFS--
EIF3A_YARLI       -----------------------------------PSRREGGGGGYVPPSR---------
EIF3A_ARATH       ---------------------------------SNRGPP-PGDDHWGSNRG--AAQNTDR
F6I4Q7_VITVI      ---------------------------------GSRGAPNPESDRWGSRQDDRPPQPSDR
C5XM02_SORBI      ---------------------------------GSREERSRPDVRPLRQDGP-ARQDAPP
A9RFG7_PHYPA      ---------------------------------QSDPE---APPRAYEPPPVRRTYDAPP
A9SFU3_PHYPA      ---------------------------------QSDAADSPPPPRAYELP-VRRSYGAPG
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      VRRAFGGDREDREGGLRRGFGGDREE--SGSRWGSRESFRRSGDRDGDRESFRRGGDRDG
H3GEW8_PHYRM      LRRGFGGDREEREGGLRRGFGGDREEREGGLRRGFGGDREESGSRWGNRDSVRRSGDRDG
Q4UGH6_THEAN      TRADVTRAENKAE-------------------NAKGSYGEPDKPVVKDLNR---------
Q4N979_THEPA      TRAEVTRADNKVE-------------------NANSTYGDPDKPAVKEINR---------
A7AQQ1_BABBO      WRSDSKKSDTTAK-------------------TGSTFDSD--------------------
Q8I5S6_PLAF7      DRDRERDRDRDRE-------------------RDRDRDRERERDRDRDRDRDIKRSDRDH
Q7RG05_PLAYO      DRERDRERDRDRE-------------------RGRDYRKDKDHRRDRERDR-----ERDY
B3LCC3_PLAKH      DRDYRRDRDRDYR-------------------RDDDYRRDRDYKNDRDDKL-----DRDY
A5JZU1_PLAVS      DRDYRRDRDRDYR-------------------RDDDYRREDDYRRDDDYRR-----DDDY
G4V5Q4_SCHMA      RRENERTKPFGRG-------------------GSTMGGGFNRGPKNPDMDTGSSTPWRRE
EIF3A_CRYNJ       --------------------------------SNSAAASAPASNGPES------------
EIF3A_MONBE       RSFSGLGDRAPRDFS-------------------GRSEPSRSGPRDFSGRSEAGRTSGER
B7G0T8_PHATC      --------------------------------DRRGGDDRREGDDRRG------------
                                                                              

EIF3A_DICDI       GGRRDD--------------------------------------APPRRDEGGDRWGRRE
F0ZBR6_DICPU      GNIRRG--------------------------------------DEDRRG-GNDSWGRRD
D3BGC0_POLPP      RDGPRDGP----------------------------------RRDEPRREEGGWRDGPRR
EIF3A_HUMAN       DDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRG-LDDDRGPWRN
G1P5I7_MYOLU      DDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGPRRG-LDEDRGPWRN
G1LTU8_AILME      DDDRGPRR------------------------------GMDDDRGPRRG-LDDDRGPWRS
EIF3A_MOUSE       DDDRGPRR------------------------------GMDDDRGPRRG-LDDDRGPWRN
H0WQ74_OTOGA      DDDRGPRR------------------------------GMDDDRGPRRGGLDDDRGPWRN
EIF3A_RAT         DDDRGPRR------------------------------GMDDDRGPRRG-LDDDRGPWRN
EIF3A_DANRE       -DDRGPRR------------------------------GFDDDRGPRRG-MDEPRGPRRG
H3B4Y5_LATCH      DDRKPFRR-------------------------------GDDDRGPRWG--DDDRGPKRG
EIF3A_XENTR       EDDRGPRR------------------------------GFEDDRGPRRG-FEDDRGPRRG
B7Q355_IXOSC      --------------------------------------DQDVDRS----------GPWRS
C3YRF7_BRAFL      --DRGPDR--------------------------------GPDRGPERS--WRQDGPGRD
EIF3A_NEMVE       ------------------------------------------DRGPDRG-----------
EIF3A_DROME       ----------------------------------------SGAPQSRDDK---WRRGGER
EIF3A_DROPS       ---------------------------------------GSAAPPSRDDK---WRRGGDR
W5JG72_ANODA      ---------------------------------------GGE---MRRG----DDRGPIR
EIF3A_ANOGA       ---------------------------------------GGD---MRRGQ---DDRGPIR
EIF3A_AEDAE       ---------------------------------------GGDRPPMRRGGDDRDDRGPIR
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ---------------------------------------SDRFNRDRMRDRDRDRDRDRD
EIF3A_CAEBR       --------------------------------------KADTDQKWERGAVTKTVVSPPK
EIF3A_CAEEL       --------------------------------------KADTGDKWERGV--KPVVSPPK
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       -TPPT----------------------------------------------------SSP
EIF3A_ASPFU       -TPPA----------------------------------------------------AAP
C0NC78_AJECG      -APSS----------------------------------------------------PAP
Q0V6S4_PHANO      YVPPSRRG------------------------------------------------QADG
C7YNL9_NECH7      GAPMDRGNSGRGE--------------------------------------GRGEEDRKQ
EIF3A_NEUCR       AAPQRAGS-------------------------------------------GRPENDRD-
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      GRTLQ----------------------------------------------------TDR
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ---------------------------------------------------------RKE
EIF3A_USTMA       ---------------------------------------------------------AAA
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       --------------------------------------WTSNRERSGPPAEGGDRWGSGP
F6I4Q7_VITVI      --------------------------------------WRRD--------DRGSSFGS--
C5XM02_SORBI      --------------------------------------TRQDG-----PPPSTDRWRPGS
A9RFG7_PHYPA      --------------------------------------ARGDTNEPPRSGVYAPPNRGGG
A9SFU3_PHYPA      --------------------------------------ARGDTYEPPRAGARGDAYAPPG
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      --------------------------------------DRESFRRGGDRDGERDSFRRGA
H3GEW8_PHYRM      --------------------------------------DRDSFRRGGERDGERDSVRRGG
Q4UGH6_THEAN      --------------------------------------------------NTTDDSNWRS
Q4N979_THEPA      --------------------------------------------------QTTDDSNWRS
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      KKDRDDKLDRDSRRRERSG--------------------KPENEKKRENDISKRNGTTEE
Q7RG05_PLAYO      RKDGERENRRGDTRRSEN-----------------------DREKKRDKDDYTPNNSDNE
B3LCC3_PLAKH      RKVERSGKGEHERR------------------------------RDRDEEEYERNDLD--
A5JZU1_PLAVS      RRDRDRDYKKGERR------------------------------RDRDEEEYERNESD--
G4V5Q4_SCHMA      ---------------------------------------------------GPNAAGGKS
EIF3A_CRYNJ       --------------------------------------------------------IAGE
EIF3A_MONBE       --------------------------------------------------RALHVPSGGA
B7G0T8_PHATC      ----------------------------------------------------------GA
                                                                              

EIF3A_DICDI       DAPPPRRDEGGDRWGRRDDAPPRRDGGGGSGFG---------------------------
F0ZBR6_DICPU      DAPP-RPTNDSDNWRRDDTPPQRREGGGGGAFG---------------------------
D3BGC0_POLPP      DEPK--REEGGWRDGPRDGPRDGPRDGQRGGFGP--------------------------
EIF3A_HUMAN       ADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFP-RRGDDSRPGPWRPLVKP---GGW
G1P5I7_MYOLU      ADDDRIPRRGTDDDRGPWRNMDDDRISRRADDDRIPSRRGEDSRPGLWRPFVKPEI-GGW
G1LTU8_AILME      TDDDRISRRGADDDRGPWRNMDDDRIPRRGDD----------ARPGPWRPFVKP---GGW
EIF3A_MOUSE       AAEDRISRRGADDDRGPWRNMDDDRVPRRGDD----------ARPGPWRPFVKP---GGW
H0WQ74_OTOGA      TDDDRISRRSADDDRGPWRNMDDDRVPRRGDD----------SRPGPWRPFVKPEL-GGW
EIF3A_RAT         AAEDRISRRGADDDRGPWRNMDDDRVPRRGDD----------ARPGPWRPFVKP---GGW
EIF3A_DANRE       ADDDWGPRRGGDDERGGRRGMDDS-GPRRGED------------SRPWKPLGRPGA-GGW
H3B4Y5_LATCH      GGDD--------DDRGPRRGMDDDRGPRRGDD----------SRPGPWRPLSRP---VQF
EIF3A_XENTR       FEDDRGPRRGFEDDRGPRRGFDEDRGPRRGFE----------DDRGPRRGFDEDRTPRRG
B7Q355_IXOSC      -GGTGSSWRSGGGERGASTPWKRDRAPRTGDS---------------WR-----------
C3YRF7_BRAFL      DRDDWRRDGPRRDDRGP----PERRGPPARDE----------------------------
EIF3A_NEMVE       -----------GDKPGAWRPKWQREEPDRGGD----------------------------
EIF3A_DROME       DRDFRIDGARRDRDDGPRRDRDDGPRRDRDDE----------------------------
EIF3A_DROPS       DR----DRDRDFRNDGPRRDRDD--RDDRD------------------------------
W5JG72_ANODA      RAGPEDREQRDDR--GPIR-RGTDRPDDRDRR----------------------------
EIF3A_ANOGA       RGGGEERGEREDR--GPIR-RGGGPGD----A----------------------------
EIF3A_AEDAE       RGG----DDRDDR--GPIR-RGDRPPMRDGER----------------------------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      WDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRD----------------------------
EIF3A_CAEBR       TENQPAPAAEAPKADGPRRFIPPALRNKP-------------------------------
EIF3A_CAEEL       TD---APSVSEPKSEGPKRFVPPHLRNRQGGG----------------------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       KPEEPKPLASGTG--GKWVPRWKQQQQNQ-------------------------------
EIF3A_ASPFU       ASSD-KPEASPAP--QKWVPRWKQQQQ---------------------------------
C0NC78_AJECG      ESREGSNPPASGT--QAWRPKFRQQQQQQ-------------------------------
Q0V6S4_PHANO      EERESAPPPAQGASDGKYRPGAFRRTPGQ-------------------------------
C7YNL9_NECH7      SPAPPAEPLPATRAPGKWVPPHMRNKA---------------------------------
EIF3A_NEUCR       --VPPAEPLKASGAPGKYVPKWRREGA---------------------------------
A7F4P3_SCLS1      ---TSDAPPAKPAAGGKWVPPHLRKA----------------------------------
D5GPY7_TUBMM      PASPASGGEADKPKSEKWVPRRRLGGDSKEGESSERRGGGSWGSRR--------------
EIF3A_SCHPO       --VPPRETLAPSK--GAYVPPSRRNQQQQ-------------------------------
A8P1V9_COPC7      EPKQDDDGFTTVSKPGVWRPRRGRG-----------------------------------
EIF3A_USTMA       ES----DGFTEVKK-NVYRPPGRRA-----------------------------------
F4NW26_BATDJ      ---KNNDGLSVTERLAQRKAAANSRSKN--------------------------------
EIF3A_YARLI       -----REGGSGAGSGGRYIPPSQRN-----------------------------------
EIF3A_ARATH       RGSDDRRSTFGS--------SRPRPTQR--------------------------------
F6I4Q7_VITVI      -GGGSRSSTWSS--------SPRR------------------------------------
C5XM02_SORBI      RYSSNSSSSSSTW-------GRPRN-----------------------------------
A9RFG7_PHYPA      RSFGQRPVIGGRPTEDRPERTEDRPERRDRW-----------------------------
A9SFU3_PHYPA      RTD-RRPVIGGE------REREDRQERRDRW-----------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      DRDGDDRFFGRSQREGSYRAPRAGERDNSSCAGDRDSSSRAPESGRWR------------
H3GEW8_PHYRM      DRDGDDRFFGNSQREGSYRPPRAGDREGSSRE-----NARAPESGRWR------------
Q4UGH6_THEAN      ELKKTTSKLFKSFAVKSVKSTSDDEGNWRT------------------------------
Q4N979_THEPA      DIKKTTSKLFKSFSKKSVKTPSDDEGNWRT------------------------------
A7AQQ1_BABBO      --KSRKYKAFPQRTRESTAKQSDDYDSWRR------------------------------
Q8I5S6_PLAF7      RTKNAWNLKEDDDSKAKHETSEENTKSWRNNNKVIDNEIEKAEKYKDGEKKDGEKNKDEN
Q7RG05_PLAYO      KERNAWNIRNDDGGIESDENKKNNIEGDDNGN------------NLKGNKRDGEKNKD--
B3LCC3_PLAKH      -VKKNHNIHDEDDSVRVEKGKEGHSGNDSDGA-------------NHHHLKEKEKMTN--
A5JZU1_PLAVS      -VRKNHDVGDEDDNGKMEKDKGSNSDNDSDGG-------------NHHHAKEREKMTN--
G4V5Q4_SCHMA      QVFEEMRGGNVKRPFGSSGFPSRISSGLSDDRKY--------------------------
EIF3A_CRYNJ       AEKPALTGSVWRRGMGARRGMPSTRGGA--------------------------------
EIF3A_MONBE       DKPSGDNVWRSSRGAGSERRVNIPSRGDDKN-----------------------------
B7G0T8_PHATC      YGGDRRGGAGSGSYNDRRGPPSDGNSRWR-------------------------------
                                                                              

EIF3A_DICDI       ----------RNQGAQGDQ--NDSWRSDNKKEENKKDADGWQTVGAKKRY----------
F0ZBR6_DICPU      ----------NTRRGDDDRRGGDSWRRGEKKDDKKKDDDGWQTVGPKRGNKF--------
D3BGC0_POLPP      ---------KRDEPRDGQRGGFGPKRDEPKDNKNKVDADGWTTVGGKKK-----------
EIF3A_HUMAN       REKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRER-------
G1P5I7_MYOLU      REKEKAREESWGPPRESKPPEEREWDREKERERDSQDREENDKDPERERDRER-------
G1LTU8_AILME      REKEKAREESWGPPRESRPSEEREWDREKERERENQDRDENDKDPEKERDRERERERERE
EIF3A_MOUSE       REKEKAREESWGPPRESRPSEEREWDRDKEKDRDNQDREENDKDLERDRDRER-------
H0WQ74_OTOGA      REKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENGK--EPERDRER-------
EIF3A_RAT         REKEKAREESWGPPRESRPPEEREWDRDKEKDRDNQDREENDKDLERDRDRER-------
EIF3A_DANRE       REREKAREESWGPPRDSGHDDDG-------GERDGDDQREGERFRERRSAREE-------
H3B4Y5_LATCH      YQNHKRRETHLGKESESRP-TDREHCTTRKKTKKLPCRETEDKWSPRKIFPDAS------
EIF3A_XENTR       FDDDRGPRRGLDEDRGSWRGGDDVPRRGADDDRGPRRGADDDRGPRRGEDRDQ-------
B7Q355_IXOSC      ----------SGGLKDSRGGGGG-------------------------------------
C3YRF7_BRAFL      --------------RDSRPQDDD------------FNWRRGERAPAPDRERWG-------
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       ------RGGFRRADGARRTD-EPQRETGGNWRDAPRHADRETRRPAE-RRDRDVRE----
EIF3A_DROPS       ------RGGFRRNDGPRRNDDAAPRETGGNWRDAPRQSDRDNRRPAGDRRDREVR-----
W5JG72_ANODA      ------GGGPGAPRRDDRQGGGFQR-----RDDARRDDTRREDRGPR-QAGAG-------
EIF3A_ANOGA       ------PAGTGTPRRDDRPGGWFNRDRRDDRRDDRRDDRRDDRRGDD-RGPRG-------
EIF3A_AEDAE       ------GVGMRREGGDRERRDGGDR-----RDFGGNRDRRDDRGGPR-RDDRGDR-----
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ------RNRNGRDSGPPMSWRNKEGPDRGDRDRDWDRDRDRDRDRDRDRERDRDRD----
EIF3A_CAEBR       ---------AGGGDEQPAPQRG--------------------------------------
EIF3A_CAEEL       --------GAGGSEEQSAPARSG-------------------------------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      ------------------------------------------------------------
Q4N979_THEPA      ------------------------------------------------------------
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      SSKNKENDELANGNEENENDEVKKNDDEEASDGG-DFTVFKKKKRNILRFFMKA------
Q7RG05_PLAYO      -----------NENANNDKREEKGDEKGQGSDGGGAFTVFTKKKKNFLRYFTKS------
B3LCC3_PLAKH      ------------GKDITKNEQAK---HEEASDGGGDFTVFKKKKRGFMKFF---------
A5JZU1_PLAVS      ------------GKDITENDQAK---NEEGSDGGGDFTVFKKKKRNFMKFFSKT------
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      ------------------------------------------------------------
                                                                              

EIF3A_DICDI       ------------------------------------------------------------
F0ZBR6_DICPU      ------------------------------------------------------------
D3BGC0_POLPP      ------------------------------------------------------------
EIF3A_HUMAN       -DVDREDRFRRPRDEGGWRRGPAEESSSW---RDSSRRDDRDRD----DRRRERDDRR--
G1P5I7_MYOLU      -DGDREDRFRRPRDEGDWRRGPAEEASSW---RDSGRRDDRDRD----DRPRVRDDRR--
G1LTU8_AILME      RDGDREDRFRRPRDEGGWRRGPAEESSSW---RDSNRREDRDRD----DRRRERDDRR--
EIF3A_MOUSE       -DGDREDRFRRPRDEGGWRRGPAEESSSW---RDSSRRDDRDREDRRRDRD-DRRDLR--
H0WQ74_OTOGA      -DGDREDRFRRPRDEGGWRRGPAEESSSW---RDSSRRDDRDRDRDRDDRRRERDDRR--
EIF3A_RAT         -DGDREDRFRRPRDEGGWRRGPAEESSSW---RDSSRRDDRDRD----DRRRDRDDRRDL
EIF3A_DANRE       -----GSAWRR----GGGGGGGGEEQSSW---RDS-RREDFDRE--------DRRERR--
H3B4Y5_LATCH      -DSVDLRIYFADRDEGVWRRAPVDDSNSW---RDSPRQDDWDREDRRGDRDRSDRDRR--
EIF3A_XENTR       ----TPWKPMAASRPGGWREREKAREDSWGPPRDSQAPEEREWSRQGEDSEKDSERDR--
B7Q355_IXOSC      ---------------GAWRVG---------------------------------------
C3YRF7_BRAFL      ---------------GRDDRAPRPGPDKWR------DRDDRFRD--------DRGPSR--
EIF3A_NEMVE       ------------------------------------------------------------
EIF3A_DROME       ------------------------------------------------------------
EIF3A_DROPS       ------------------------------------------------------------
W5JG72_ANODA      ------------------------------------------------------------
EIF3A_ANOGA       ------------------------------------------------------------
EIF3A_AEDAE       ------------------------------------------------------------
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ------------------------------------------------------------
EIF3A_CAEBR       ------------------------------------------------------------
EIF3A_CAEEL       ------------------------------------------------------------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      ------------------------------------------------------------
Q4N979_THEPA      ------------------------------------------------------------
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      ------------------------------------------------------------
Q7RG05_PLAYO      ------------------------------------------------------------
B3LCC3_PLAKH      ------------------------------------------------------------
A5JZU1_PLAVS      ------------------------------------------------------------
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      ------------------------------------------------------------
                                                                              

EIF3A_DICDI       ------------------------------------------------------------
F0ZBR6_DICPU      ------------------------------------------------------------
D3BGC0_POLPP      ------------------------------------------------------------
EIF3A_HUMAN       -DLRERRDLRDDRDRRGPPLRSEREEVSSWRRADD-RKDDRVEERDPPRRVPPPALSRDR
G1P5I7_MYOLU      -DLRER---RDDRDRRGPPIRSEREEVSSWRRADD-RKDDRAEERDVPRRVPPPALSRDR
G1LTU8_AILME      -DLRER---RDDRDRRGPPLRSEREEASSWRRADD-RKDERAEEREGPRRVPPPALSRDR
EIF3A_MOUSE       -DLRDRRDLRDDRDRRGPPLRSEREEASSWRRTDD-RKDDRTEERDPPRRVPPPALSRDR
H0WQ74_OTOGA      -DLRERRDLRDDRDRRGPPLRSEREEVSSWRRADD-RKDDRAEERDPPRRVPPPALSRDR
EIF3A_RAT         RDLRDRRDLRDDRDRRGPPLRSEREEASSWRRTDD-RKDDRTEERDPPRRVPPPTLSRER
EIF3A_DANRE       -DMRER---RDDRERDIRGPQRDQDEGGSWRRGGEERREERKEERDAP--------PRPR
H3B4Y5_LATCH      -DMRDR---KDDRERRGP-LRTDREETNSWRRNDD-KRDDRREERDVPRRGPPP---RDR
EIF3A_XENTR       RPVREESAWRRGGDNSETPRKPSPGDSD--RKDDSDKKRPPKTDEANPWRRGEDKDSREE
B7Q355_IXOSC      ----------EDRDRRPSPRREERPTGGSWRDKEP-------------------------
C3YRF7_BRAFL      ---------GFDRDNRGPPSRGFDREDRSFPSRGYDRDDRGTPSRGFDRGPPSRGMDRDI
EIF3A_NEMVE       ----------------------------RWRGGDR-------------------------
EIF3A_DROME       ----------TRGDQRGS---APKEAASGG-------VGGNWRTAPATREEKPAAKRDQA
EIF3A_DROPS       -----------GGDLRGPESRAPKEGGPSGGTGTAASGGGNWRTAPGPRDE-PAPKRDQP
W5JG72_ANODA      -----------GGERENVWRRAPARDEG-GAPP--ARAEGNWRTAAPPRQDAA-KPREER
EIF3A_ANOGA       -----------GGERGNTWRRGPADNADDNRRG--PRDEGRQDTWRNTRQDAAPKQKEDR
EIF3A_AEDAE       -----------GGDRDSAWRRPAPRGGD---------DGGNWRTRQDQAKPKD-DRREER
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      ----------RDRDREIGRERDRDRDRDRDRGGERGPMRRDDHMRHDRRDDWRSSARDEP
EIF3A_CAEBR       ------------ANVTSPPDRAPGLRGPPGPGGRDLPPRDLPPRDGPRDIPRRDGPRRDG
EIF3A_CAEEL       -----------NSNVTSPPDRAQGLRGPP-PTGR-------------NSLPRRDGP----
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      ------------------------------------------------------------
Q4N979_THEPA      ------------------------------------------------------------
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      ------------------------------------------------------------
Q7RG05_PLAYO      ------------------------------------------------------------
B3LCC3_PLAKH      ------------------------------------------------------------
A5JZU1_PLAVS      ------------------------------------------------------------
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      ------------------------------------------------------------
                                                                              

EIF3A_DICDI       ------------------------------------------------------------
F0ZBR6_DICPU      ------------------------------------------------------------
D3BGC0_POLPP      ------------------------------------------------------------
EIF3A_HUMAN       ERDRDR----------EREGEKEKASWRAEK--DRESLRRTKNETDEDGWTTVRR-----
G1P5I7_MYOLU      ERDRDR----------EREGEKEKASWRAEK--DKESLRRTKNETDEDGWTTVRR-----
G1LTU8_AILME      ERDRDRDRDR------EREGEKEKSSWRAEK--DRESLRRTKNETDEDGWTTVRR-----
EIF3A_MOUSE       ERERERE------------GEKEKASWRAEK--DRESLRRTKNETDEDGWTTVRR-----
H0WQ74_OTOGA      ERDRDRERDRDRDRDRERDGEKEKASWRAER--DRESLRRTKNETDEDGWTTVRR-----
EIF3A_RAT         ERERDR------------EGEKEKASWRAEK--DRESLRRTKNETDEDGWTTVRR-----
EIF3A_DANRE       ERDRDS---------------GEKSTWRSDK--DKENPRRTKNETDDDGWTTVRR-----
H3B4Y5_LATCH      EREKDS--------------DKERNSWRLEK--DKEAPRRNKNEPDEEGWTTVRR-----
EIF3A_XENTR       ERGTPRR---------APAADREKSAWRTEKKEEKDTPRRIKPETDEDGWTTVRR-----
B7Q355_IXOSC      --------------------------------------SKPREEGDKEGWKTAR------
C3YRF7_BRAFL      RREKSD---------------EPEGGVRKEK-------DKWRSETDDDGWTTVRR-----
EIF3A_NEMVE       ----------------------------------------------RDGMITMS------
EIF3A_DROME       QEKENK-------------------------------------AGDDGEWTSVKRR----
EIF3A_DROPS       QDKENK-------------------------------------AVDDGEWTSVKRR----
W5JG72_ANODA      PQREQR--------------------------AQENVPPR-NTGPDEEGWQDVVKHR---
EIF3A_ANOGA       PQREARP-------------------------AQENVPPRSNAGPDEEGWTDVKHR----
EIF3A_AEDAE       P-KEAR-----------------------------------NTGPDEDGWTDVKHHR---
E9GZK2_DAPPU      ------------------------------------------------------------
E0VV02_PEDHC      RGTPTKS-------------------------RDGGGYKDDSRGMGRDGPRDHSQREEKK
EIF3A_CAEBR       PNRNSG--------------------------------ANNAGNADSANWRR--------
EIF3A_CAEEL       PPRSNN--------------------------------TGNTGNADSGSWRK--------
EIF3A_YEAST       ------------------------------------------------------------
EIF3A_CANGA       ------------------------------------------------------------
EIF3A_VANPO       ------------------------------------------------------------
EIF3A_KLULA       ------------------------------------------------------------
EIF3A_CANAL       ------------------------------------------------------------
EIF3A_EMENI       ------------------------------------------------------------
EIF3A_ASPFU       ------------------------------------------------------------
C0NC78_AJECG      ------------------------------------------------------------
Q0V6S4_PHANO      ------------------------------------------------------------
C7YNL9_NECH7      ------------------------------------------------------------
EIF3A_NEUCR       ------------------------------------------------------------
A7F4P3_SCLS1      ------------------------------------------------------------
D5GPY7_TUBMM      ------------------------------------------------------------
EIF3A_SCHPO       ------------------------------------------------------------
A8P1V9_COPC7      ------------------------------------------------------------
EIF3A_USTMA       ------------------------------------------------------------
F4NW26_BATDJ      ------------------------------------------------------------
EIF3A_YARLI       ------------------------------------------------------------
EIF3A_ARATH       ------------------------------------------------------------
F6I4Q7_VITVI      ------------------------------------------------------------
C5XM02_SORBI      ------------------------------------------------------------
A9RFG7_PHYPA      ------------------------------------------------------------
A9SFU3_PHYPA      ------------------------------------------------------------
A8HRF8_CHLRE      ------------------------------------------------------------
D0P3U0_PHYIT      ------------------------------------------------------------
H3GEW8_PHYRM      ------------------------------------------------------------
Q4UGH6_THEAN      ------------------------------------------------------------
Q4N979_THEPA      ------------------------------------------------------------
A7AQQ1_BABBO      ------------------------------------------------------------
Q8I5S6_PLAF7      ------------------------------------------------------------
Q7RG05_PLAYO      ------------------------------------------------------------
B3LCC3_PLAKH      ------------------------------------------------------------
A5JZU1_PLAVS      ------------------------------------------------------------
G4V5Q4_SCHMA      ------------------------------------------------------------
EIF3A_CRYNJ       ------------------------------------------------------------
EIF3A_MONBE       ------------------------------------------------------------
B7G0T8_PHATC      ------------------------------------------------------------
                                                                              

EIF3A_DICDI       ---
F0ZBR6_DICPU      ---
D3BGC0_POLPP      ---
EIF3A_HUMAN       ---
G1P5I7_MYOLU      ---
G1LTU8_AILME      ---
EIF3A_MOUSE       ---
H0WQ74_OTOGA      ---
EIF3A_RAT         ---
EIF3A_DANRE       ---
H3B4Y5_LATCH      ---
EIF3A_XENTR       ---
B7Q355_IXOSC      ---
C3YRF7_BRAFL      ---
EIF3A_NEMVE       ---
EIF3A_DROME       ---
EIF3A_DROPS       ---
W5JG72_ANODA      ---
EIF3A_ANOGA       ---
EIF3A_AEDAE       ---
E9GZK2_DAPPU      ---
E0VV02_PEDHC      GGE
EIF3A_CAEBR       ---
EIF3A_CAEEL       ---
EIF3A_YEAST       ---
EIF3A_CANGA       ---
EIF3A_VANPO       ---
EIF3A_KLULA       ---
EIF3A_CANAL       ---
EIF3A_EMENI       ---
EIF3A_ASPFU       ---
C0NC78_AJECG      ---
Q0V6S4_PHANO      ---
C7YNL9_NECH7      ---
EIF3A_NEUCR       ---
A7F4P3_SCLS1      ---
D5GPY7_TUBMM      ---
EIF3A_SCHPO       ---
A8P1V9_COPC7      ---
EIF3A_USTMA       ---
F4NW26_BATDJ      ---
EIF3A_YARLI       ---
EIF3A_ARATH       ---
F6I4Q7_VITVI      ---
C5XM02_SORBI      ---
A9RFG7_PHYPA      ---
A9SFU3_PHYPA      ---
A8HRF8_CHLRE      ---
D0P3U0_PHYIT      ---
H3GEW8_PHYRM      ---
Q4UGH6_THEAN      ---
Q4N979_THEPA      ---
A7AQQ1_BABBO      ---
Q8I5S6_PLAF7      ---
Q7RG05_PLAYO      ---
B3LCC3_PLAKH      ---
A5JZU1_PLAVS      ---
G4V5Q4_SCHMA      ---
EIF3A_CRYNJ       ---
EIF3A_MONBE       ---
B7G0T8_PHATC      ---