CLUSTAL format seed alignment for MF_03002

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G1MAG9_AILME          ------------------------------------------------------------
H0X7M1_OTOGA          ------------------------------------------------------------
EIF3C_HUMAN           ------------------------------------------------------------
EIF3C_PONAB           ------------------------------------------------------------
EIF3C_BOVIN           ------------------------------------------------------------
G1PSM2_MYOLU          ------------------------------------------------------------
EIF3C_MOUSE           ------------------------------------------------------------
EIF3C_RAT             ------------------------------------------------------------
EIF3C_XENTR           ------------------------------------------------------------
EIF3C_DANRE           ------------------------------------------------------------
H3DCM5_TETNG          ------------------------------------------------------------
EIF3C_AEDAE           ------------------------------------------------------------
EIF3C_ANOGA           ------------------------------------------------------------
EIF3C_DROME           ------------------------------------------------------------
EIF3C_DROPS           ------------------------------------------------------------
EIF3C_BOMMO           ------------------------------------------------------------
E9HGP7_DAPPU          ------------------------------------------------------------
G4LYI7_SCHMA          ------------------------------------------------------------
B3RYW2_TRIAD          ------------------------------------------------------------
EIF3C_CAEBR           ------------------------------------------------------------
EIF3C_CAEEL           ------------------------------------------------------------
EIF3C_DICDI           ------------------------------------------------------------
F0Z7C0_DICPU          ------------------------------------------------------------
D3BBM5_POLPP          ------------------------------------------------------------
EIF3C_ASHGO           -MSRFFSRG--------------------------YHYDTASSSEDEELLTSSEEE-LMS
EIF3C_KLULA           -MSRFFLKT--------------------------YEYDSTSSGEEEDLLSQSEED-LVS
EIF3C_CANGA           -MSRFFATN--------------------------YNYDETSSSSEEDLLSSSEE--LLS
EIF3C_YEAST           -MSRFFSSN--------------------------YEYDVASSSSEEDLLSSSEEDLLSS
EIF3C_CANAL           -MSRFFVSG--------------------------YTSDSSS--EEEDLLSTSEEELLSS
EIF3C_YARLI           -MSRFFAGG--------------------------SDSDDSS--SDEDLYGSGSESGSDF
EIF3C_EMENI           -MSRFFYGN--------------------------DSDSDSSGSDEEELYSD-EEVEQ--
EIF3C_ASPFU           MSSRFFYGG--------------------------GSDSDSSSSDEEELYSDREEEEK--
C0NXA3_AJECG          -MSRFFHGG--------------------------GSDSDSSSSDEEELYSDREEGQDL-
C7Z9S9_NECH7          -MSRFFRGG--------------------------DDSSTDSSSDEEELYSEEEEEE---
EIF3C_NEUCR           -MSRFFRGG--------------------------DDSSTDSSSEEEEVYTSEEEEEKVQ
EIF3C_SCLS1           -MSRFFRG---------------------------DSSSESSSDEEEDLYSDDEEVQEQP
EIF3C_PHANO           -MSRFFAAS--------------------------DSSSEESS--EEELYSDNEASAQ--
D5G6D6_TUBMM          -MSRFFHGG--------------------------LSDSDTTSS-DEDLYSEEEEEEE--
EIF3C_SCHPO           -MSRFFKGGSSDSDAESVDSSEENRLTSSRLKKQDDSSSEEESSEEESASSSESESSEEE
F4P9G3_BATDJ          ------------------------------------------------------------
EIF3C_USTMA           -MSGFFRKVGD------------------------SDSESDISSSEEELSELESGDEQPK
D6RL89_COPC7          --------MSS------------------------EDE----APKPATTVPRTGMARFMR
EIF3C_CRYNJ           -MSFFAKLQGS------------------------DSESSSGSESEESILSGSEGERQDK
E3KG31_PUCGT          -MSSFFRTVGS------------------------DSESD--SSSDEELLSGASGSEAGQ
EIF3C_ARATH           --------------------------------------------MTSRFFTQ--------
F6HLF0_VITVI          --------------------------------------------MSSRFWTA--------
F4J1N5_ARATH          ------------------------------------------MTTTSRFFAQ--------
A9RFE0_PHYPA          --------------------------------------------MASRFWTQ--------
A9SAG5_PHYPA          --------------------------------------------MASRFWTQ--------
A9SZ44_PHYPA          --------------------------------------------MASKFWG---------
Q4U8V4_THEAN          ------------------------------------------------------------
Q4N1J6_THEPA          ------------------------------------------------------------
A7APB4_BABBO          ------------------------------------------------------------
Q4YU35_PLABA          ------------------------------------------------------------
Q7RR21_PLAYO          ------------------------------------------------------------
A0A077TJQ4_PLACH      ------------------------------------------------------------
Q8I5Y3_PLAF7          ------------------------------------------------------------
B3LB47_PLAKH          ------------------------------------------------------------
A5K0G2_PLAVS          ------------------------------------------------------------
D0MQP5_PHYIT          ------------------------------------------------------------
Q5CQQ0_CRYPI          ------------------------------------------------------------
                                                                                  

G1MAG9_AILME          ------------------------------------------------MSRFFTTGSDSE
H0X7M1_OTOGA          ------------------------------------------------MSRFFTTGSDSE
EIF3C_HUMAN           ------------------------------------------------MSRFFTTGSDSE
EIF3C_PONAB           ------------------------------------------------MSRFFTTGSDSE
EIF3C_BOVIN           ------------------------------------------------MSRFFTTGSDSE
G1PSM2_MYOLU          ------------------------------------------------MSRFFTTGSDSE
EIF3C_MOUSE           ------------------------------------------------MSRFFTTGSDSE
EIF3C_RAT             ------------------------------------------------MSRFFTTGSDSE
EIF3C_XENTR           ------------------------------------------------MSRFFATGSDSE
EIF3C_DANRE           ------------------------------------------------MSRFFATGSDSE
H3DCM5_TETNG          ------------------------------------------------MSRFFATGSDSE
EIF3C_AEDAE           ------------------------------------------------MSRFFAGGG-SD
EIF3C_ANOGA           ------------------------------------------------MSRFFAGG--SD
EIF3C_DROME           ------------------------------------------------MSRFFANG--SE
EIF3C_DROPS           ------------------------------------------------MSRFFANG--SD
EIF3C_BOMMO           ------------------------------------------------MSRFFATG--TD
E9HGP7_DAPPU          ------------------------------------------------MSRFFGTASDSD
G4LYI7_SCHMA          ------------------------------------------------MYADIFSSSDSD
B3RYW2_TRIAD          ------------------------------------------------MSRFFGGS-DSD
EIF3C_CAEBR           ------------------------------------------------MSRFYRRGAS-D
EIF3C_CAEEL           ------------------------------------------------MSRFFHAKEDSD
EIF3C_DICDI           ------------------------------------------------MSRFYRQGSSSE
F0Z7C0_DICPU          ------------------------------------------------MSRFFRQGSSSE
D3BBM5_POLPP          ------------------------------------------------MSRFFVGSSSES
EIF3C_ASHGO           SSEEEVVS---------------------------------------DDSFFNDS-ESES
EIF3C_KLULA           SSSEEELS---------------------------------------DDSFFNDSDESSD
EIF3C_CANGA           SSEEGELS---------------------------------------DDSLFND-ESESE
EIF3C_YEAST           SSSESELDQ------------------------------------ESDDSFFNESESESE
EIF3C_CANAL           SDEGEDNE---------------------------------------SDSSFFGEDDDES
EIF3C_YARLI           SQDEQDGGD------------------------------------DNDDDMSDDSMFADD
EIF3C_EMENI           ----------------------------------------------SEEESS--EEDASS
EIF3C_ASPFU           ----------------------------------------------SEEEESSEEEDETS
C0NXA3_AJECG          ----------------------------------------------SDDDEESSSEEESS
C7Z9S9_NECH7          -------------------------------------------EEQEDSQEESSQEDSDS
EIF3C_NEUCR           A------------------------------------------EDESSSEEESDEEESDE
EIF3C_SCLS1           E------------------------------------------EESEEDDSEEDDDDDDS
EIF3C_PHANO           ----------------------------------------------EDSDKDSDDDDSDD
D5G6D6_TUBMM          ----------------------------------------------ASADESGSEDESDE
EIF3C_SCHPO           SESEESEVEVPKKKAVAASEDSESDSESSEEEEETESEEDSEVSDESESESESESESEEE
F4P9G3_BATDJ          ----------------------------------------------------------MD
EIF3C_USTMA           ------TTQ--------------------------------------PAASRSRFLKGSD
D6RL89_COPC7          GVGS--------------------------------------------SDSSSSE---SS
EIF3C_CRYNJ           KLAAQKKQQ--------------------------------------KSKASMFL---NS
E3KG31_PUCGT          ADGPKKTTA--------------------------------------PLKNRFLKGGSDS
EIF3C_ARATH           ------------------------------------------------VGSE--SEDESD
F6HLF0_VITVI          ------------------------------------------------QGDSDTEEEESD
F4J1N5_ARATH          ------------------------------------------------SGSE--SEDESD
A9RFE0_PHYPA          ------------------------------------------------NSDSESEEE-EV
A9SAG5_PHYPA          ------------------------------------------------NSDSESEEE-EV
A9SZ44_PHYPA          ------------------------------------------------NSDSESDEDSQL
Q4U8V4_THEAN          -----------------------------------------------MQSKFWGDDSDDS
Q4N1J6_THEPA          -----------------------------------------------MQSKFWGDDSDDS
A7APB4_BABBO          -------------------------------------------MASNVQSKFWGEDSDDS
Q4YU35_PLABA          -----------------------------------------------MQSKFWARGADND
Q7RR21_PLAYO          -----------------------------------------------MQSKFWARGADND
A0A077TJQ4_PLACH      -----------------------------------------------MQSKFWARGADND
Q8I5Y3_PLAF7          -----------------------------------------------MQSKFWAKAIDED
B3LB47_PLAKH          -----------------------------------------------MQSKFWAKGADDD
A5K0G2_PLAVS          -----------------------------------------------MQSKFWAKGADDD
D0MQP5_PHYIT          -----------------------------------------------MASRFWAGSSSSE
Q5CQQ0_CRYPI          -----------------------------------------------MQGKFWAEGSESS
                                                                                  

G1MAG9_AILME          SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
H0X7M1_OTOGA          SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_HUMAN           SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_PONAB           SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_BOVIN           SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
G1PSM2_MYOLU          SESSLSGEEL--VTKPVGGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_MOUSE           SESSLSGEEL--VTKPVSGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_RAT             SESSLSGEEL--VTKPVSGNYGKQPLLLS--------------------EDEEDTKRVVR
EIF3C_XENTR           SESSLSGDEI--LPKPVGGTFGKQPIILS--------------------DDEEDTKRVVR
EIF3C_DANRE           SEESSSADEI--TPKAAGTTLRQQALLLS--------------------DDEEDTKRVVR
H3DCM5_TETNG          SEESSSADEI--TPKATGTTFKQ-ALLLS--------------------DDEEDTKRVVR
EIF3C_AEDAE           SDSESSSD------SEVVARPAAPQFTFS--------------------DEEEDVKRVVR
EIF3C_ANOGA           SDSDSSSD------SEPVIRQQVAQFTFS--------------------DEEEDVKRVVR
EIF3C_DROME           SESESSEEE-----IQATNFNKASAFQFS--------------------DDEEEVKRVVR
EIF3C_DROPS           SESESSEEE-----VQAPNFNKASAFQFS--------------------DDEEEVKRVVR
EIF3C_BOMMO           SESESSSE------DEPVVRAPAPVYTFS--------------------DDEEETKRVVR
E9HGP7_DAPPU          TESDVSEE------EVQQRPTAVPTYTFS--------------------DDEEEQKRIVR
G4LYI7_SCHMA          REEE------------PVRRIESRPLHLS--------------------SDEEDIKRIVK
B3RYW2_TRIAD          SESTSSEE------EQAPQRITTNLFAQS--------------------DDEDDVKRVVK
EIF3C_CAEBR           SDTDSSEDEVEELKANKSAKFRDDLDFMA--------------------GPEEDEKRVVR
EIF3C_CAEEL           SDTSSSEDEVEDQKVNKSAKFRDDLDFMA--------------------GPEEDEKRVVR
EIF3C_DICDI           SSSESSSDSD-----VQV-KKPTRYVSSS--------------------EDEIEEKRIVL
F0Z7C0_DICPU          SEGESSSDSD-----VPTQKKTTRYVSSS--------------------EDEVEEKRIVL
D3BBM5_POLPP          ESDSSSSDSD-----VQV-VPKRRVISSS--------------------EDEVDVKRVVR
EIF3C_ASHGO           AESD-DDSDGKPYGPDWFKKPQFRKGGAPGGSGASRFLKGNADSSDE--SDDE-GKKVVK
EIF3C_KLULA           NDED-NDSDSKPYGPDWFKKPEFRKG---GGSGANKFLKSTNYSSDEDSSDEEDGKKVVK
EIF3C_CANGA           SDFDSDDSDAKPYGPDWFKKPEFRK-------GGNKFLKGASYSDSDE-SDEEDGKKVVK
EIF3C_YEAST           ADVDSDDSDAKPYGPDWFKKSEFRKQ----GGGSNKFLKSSNYDSSDEESDEEDGKKVVK
EIF3C_CANAL           EESSSDDEDGRPSGPAYFLK--------------KSFLKGAGGDDSDSDSDDE-GRKVVK
EIF3C_YARLI           SDDDSDDDEDLGGK------------------GASYFLKSSTVADSDD--EEDTGKKTVL
EIF3C_EMENI           EEESSEDEDAGKAGASRFMKDVS--------------------DSEES--EEEDVVKVVK
EIF3C_ASPFU           EEEESDEE----TGARKFLKDVAS-------------------DSEEE--EEEEKVTVVK
C0NXA3_AJECG          DEDSSSDSDGGEGGASKFFKHDAGAA------GD---------DSDES--DDDDRVTIVK
C7Z9S9_NECH7          DDS--DEGGVKKTGASAFLVGQSDS------------------DSDE---SDDEHRGKVK
EIF3C_NEUCR           ESSSDEEEGTKKKGASRFLQSDDES------------------EEEEEEQSDDEATTKVK
EIF3C_SCLS1           DSSS-DDGVGKKTGANAFLKDDSDS------------------DSES---SGDEGVKVVK
EIF3C_PHANO           DDSS---SGSEAGGANRFLK-DADS------------------DSES---EDEDQNKVLK
D5G6D6_TUBMM          ADKDDDDD-----AGLKFLSRGGGG------------------DDSS---DEEDGKRVVK
EIF3C_SCHPO           SESEEESDESERSGPSSFLKKPEKEE------AKPAGLKFLRGESSEESSDEEEGRRVVK
F4P9G3_BATDJ          DDSDGD------------------------------------SVDSDDSD----AKKTIR
EIF3C_USTMA           DDSDSDDDDSDDDDQDSLDSDDDNGERRTDGKKAPTSRFMKGAADSDDSDSEEEVKKVVK
D6RL89_COPC7          DESESDEDDE---------DEDE------------------------DDDDEDEKGIRIL
EIF3C_CRYNJ           EESESEEESS---------DEDEEEMSDSDDERQAVANKFLNDAASSDEESEEEDKIIVL
E3KG31_PUCGT          DDSDSDDDSSDMDGS----DSDDDPKKTTTTGAIKANKFLVGADSDTDSDSEDESRRVVK
EIF3C_ARATH           YEVEVNE-----VQNDDVNNRYLQSG------------------SE-DDDDTD-TKRVVK
F6HLF0_VITVI          YEDGVERGGAAGESAPHAGSRYLQAN------------------AS-DSDDSDGQKRVVR
F4J1N5_ARATH          FEKEEVE---------GNNTRYLADL------------------PDGEICCGMDTKRVVK
A9RFE0_PHYPA          SDFEDDIPIGGGEGGGAAASKYLQA-------------------DSDSDESDDGGPRMVR
A9SAG5_PHYPA          SDLEDDIPLGG-EGGGALPSKYLQG-------------------DSDSDESDDQGPRMVR
A9SZ44_PHYPA          SDHDEDEVIIGGEEAEKIADKYRIGG------------------DSDSDESDDQR-RVVR
Q4U8V4_THEAN          YSDSSEYSSKSDDKDN--RHGVDANKWTL------------------DSSDDEGESRIVK
Q4N1J6_THEPA          YSDSSEYSSKSDDKDN--RRGVDANKWTL------------------DSSDDEGESRIVK
A7APB4_BABBO          YSDSSGYSSEVSERDAQKRPGAAAAWVAS------------------DSSSDDDENRVVK
Q4YU35_PLABA          SGDNVSDSSENEVDEK-PLVSAQAERWAVM-----------------DSSSSEEEERVIK
Q7RR21_PLAYO          SGDNVSDSSENEVDEK-PLVSAQAERWAVM-----------------DSSSSEEEERVIK
A0A077TJQ4_PLACH      SGDNVSDSSENEVDEK-PLVSAQAERWAVM-----------------DSSSSEEEERVIK
Q8I5Y3_PLAF7          SGDNVTESSESEVEEKKPIVSAQAERWAAI-----------------DSSSSEEEERVIK
B3LB47_PLAKH          SGDNITESSDDEVDEKKPLVSAQAERWAAI-----------------DSSSSEEEERVLK
A5K0G2_PLAVS          SGDNVTESSDNEVDDKKPLVSAQAERWAAI-----------------DSSSSEEEERVIK
D0MQP5_PHYIT          EESDVSDVSDVETSQQQAARAASRWAVQSD-------------------SDSDEEVRVVK
Q5CQQ0_CRYPI          SMDSSNSESESSSDSEMEMQAARRRQREMN---------NSRWAIDSDSDSSEDDRRVVR
                                                                                : 

G1MAG9_AILME          SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
H0X7M1_OTOGA          SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_HUMAN           SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_PONAB           SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_BOVIN           SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
G1PSM2_MYOLU          SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_MOUSE           SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_RAT             SAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYG--KAKSIVD-KEG---VPR
EIF3C_XENTR           SAKDKRFEELTNLIKTIRNAMKIRDMTKCLEEFEQLGKAFI--KAKNIVD-KEG---VPR
EIF3C_DANRE           SAKDKRFEELTNLIKTIRNAIKIRGISKCLEEFEQLCRAFV--KSKTIVD-KEG---VPK
H3DCM5_TETNG          SAKDKRFEELTNIIKTIRNAMKIRDMAKCLEEFEQLCRAFL--KSKNIVD-KEG---IPP
EIF3C_AEDAE           STKEKRYEDLSNIIKNIRNYKKIKDMSSMLTSFEELTRAHT--KALPVIT-KVENGVTPR
EIF3C_ANOGA           SKKEKRYEDLSNIIKSIRNHKKIKDMSSVLTSFEEFMRAYT--KALPVVM-KEENGVTPR
EIF3C_DROME           STKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQ--KALPVIS-KEENGITPR
EIF3C_DROPS           STKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYT--KALPVIS-KEENGITPR
EIF3C_BOMMO           SMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYT--RAAPVVQ-KEENGVAPR
E9HGP7_DAPPU          SAKEKRFEELKEIIRLIKNYKKNKDLSKMLSSFEDLTKAYQ--KALPVIT-KEEKGVTPR
G4LYI7_SCHMA          SGRNKRCEEMQSIIKNLNNHKKIKDMSNIIIDFQNLVKVYE--KSVQMND-FDG---VPP
B3RYW2_TRIAD          SHKDKRLGYDCDCLLHAFN-------------FELLGKIYQ--KAKNIID-KTG---IPK
EIF3C_CAEBR           AQKDKKFDELKSLIKQNRDAKSNKDLNKLLTGFDTLAKAYD--KSKTIFQ-RQN-VTNPR
EIF3C_CAEEL           AQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYD--KSKTVFQ-RQN-VANPR
EIF3C_DICDI           SAKDKIWQQFDESLKKVRNALKTNDWVSTTSEFDNMTKLITNGKTTRIIE-KEG---FPP
F0Z7C0_DICPU          SAKDKLWSQYDEILRKVKNALKTNDWVTVSSEFDIITKLITNNKNIRIIE-KDG---FPP
D3BBM5_POLPP          SAKDKLWIQLEEILQATKQQIAANEWANVQTGFETMMKSVD--KSTALIK-KEG---VPP
EIF3C_ASHGO           SARDKLLDELNNTYNKIDAAEMTQDWTTILSEFESATKLLVKAQQQ-------NMG-TPN
EIF3C_KLULA           SAKEKLLDEMKSIYQKIDSAEAQQDWESLLNHLETILKLYTKAQQQ-------NYG-TPN
EIF3C_CANGA           SAREKLLDEMQAVYDKIETAEMSDDWMTILNEFDSITRLLVRAQQQ-------NFG-IPK
EIF3C_YEAST           SAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQ-------NWG-TPN
EIF3C_CANAL           SAKDKLLDDMKSSIEIINSNKYNNNWSIVLGEFDKFGRFLIRCNQT-------NLG-TPK
EIF3C_YARLI           SAKDKLLAELANCSKLIDNGKRINDWVLIQGEFDKLNKAMERFTKQ-------RHGLPPK
EIF3C_EMENI           SAKNKRLEELESTIKLIDNAQKINDWAVISSEFDKMNRQVVKVLQ---------SGPVPK
EIF3C_ASPFU           SAKDKRLDELENTIKLIENAKKINDWAVISTEFDKLNRQVAKITQ---------SGPTPK
C0NXA3_AJECG          SAKDKRLEELEQTIRLIENAEKINDWAVISTEFDKLNRQIVKIVQ---------SGSTPK
C7Z9S9_NECH7          SAKDKRLDELEASIKQIENGQKNGDWTLISAEYDKLNRQVTKLP----------GSKPPK
EIF3C_NEUCR           SAKDKRFDELESTISQIQNGQKINDWSLIANEFDKLNRQVVKLQD---------GSKAPK
EIF3C_SCLS1           SAKNKRFEELEATAKAIENGEKINDWGSISAEFDKLNRQVAKLLQ---------SGTTPK
EIF3C_PHANO           SAKDKRFDELEATIRLIENAQRINDWAVISDQFDKLNRQAPTLMKQ-------NDGKVPK
D5G6D6_TUBMM          SAKDKRVEEIEGSIKLIENGEKINDWVVISVEFDKLNKIILKSPE------------IPG
EIF3C_SCHPO           SAKDKRYEEFISCMETIKNAMSSNNWIVVSNEFDHLNKVSQKCKE---------AGRNPP
F4P9G3_BATDJ          SARDKKFGEMRSAVAAMHSAKKSSDWISIQNEFDRLIKAIIKSN------AIIQQEGLPR
EIF3C_USTMA           SAKDKRIDDMQTIVNHIESAQKSSDWTSINKDFDNLMRSIERQR------TLNEQ--IPA
D6RL89_COPC7          SAQEKRLKEMEATGKAIENGLKINDWVAISNEFDKLGRMVHRQQ--------NMSEPAAP
EIF3C_CRYNJ           SAKDKRFAEMEAAIHSIQNAVKNTDWVLASSELDKLFRFIARHLVTIVASPIPAEGHIPP
E3KG31_PUCGT          SAKSKRQDEIDGSVKIMENGAKINDWVVISAEFDKLVRLITRQA--------NAADPLPV
EIF3C_ARATH           PAKDKRFEEMTYTVDQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEAV------KPPT
F6HLF0_VITVI          SAKDKRFEEMSATVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVTESD------KVPT
F4J1N5_ARATH          PKKDKRFEEMANTIENMKHAMNINDCVYLQETFEKLNKQ------ISKSV------KTPT
A9RFE0_PHYPA          SAKDKRFDELAHTTEQMKNYMNINDWVQLQESFERLNKQLEKVNRVMESV------TAPR
A9SAG5_PHYPA          SAKDKRFDELVQTTEQMKNYMKINDWVQLQESFERLNKQLEKVNRVTESV------TAPR
A9SZ44_PHYPA          SAKDKRFDELAQTTVQIQNQININDWVQLQESFERLNKQLEKVNRLTESQ------VAPR
Q4U8V4_THEAN          SAKAKALETIQNHVKTIEHLKKINDYSELLKDYDILAKFVEKQYSST---------RLPK
Q4N1J6_THEPA          SAKAKALETIQNHVKTIEHLRKINDYSELLKDYDILAKFVDKQYSST---------RLPK
A7APB4_BABBO          SARAKALEAIQNIGKALDHHKTISDYSEVLKDYDNLARLVEKQYSRG---------RIPK
Q4YU35_PLABA          SSEGKRLDFYENIEDNLNESMENDDFNQLLKEYENLYKFMVKEDSD----------RIPN
Q7RR21_PLAYO          SHEGKRLDFYENIEDNLNDSMENDDFSQLLKEYDNLYKFMVKEDPD----------SIPN
A0A077TJQ4_PLACH      SSEGKRLHFYETIEDNLNDSMENDDFNQLLKEYENLYKFMAKEGAD----------RIPN
Q8I5Y3_PLAF7          TYEGKRLHFYETTGNSLNENMYNNDFNLLLKDYENLYKFMIKESAD----------CIPN
B3LB47_PLAKH          SYEGKRIDFYKNIGSSLNESMESSDFNQMLKDYESLYKFMVKESSE----------RIPN
A5K0G2_PLAVS          SYEGKRIDFYKNIGNSLNESMGSSDFNQLLKDYESVYKFMVKESSE----------RIPN
D0MQP5_PHYIT          SAKDKALENMERNCSSIKNHMKINDWTQIQTEFDELAKQLERAKKTVSTL--------PV
Q5CQQ0_CRYPI          GAKEKFHDELRMIIRRVNNHVKVSDFSSLSDEYDKLLKCMQKSQNAIKNY------GIPK
                        . *                            :   :                    . 

G1MAG9_AILME          FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITNYKQ
H0X7M1_OTOGA          FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITSYKQ
EIF3C_HUMAN           FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITSYKQ
EIF3C_PONAB           FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITSYKQ
EIF3C_BOVIN           FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITNYKQ
G1PSM2_MYOLU          FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITNYKQ
EIF3C_MOUSE           FYIRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITNYKQ
EIF3C_RAT             FYVRILADLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FESHITNYKQ
EIF3C_XENTR           FYIRLLSDLEDYLNELWEDKEGKKKMNKN-NAKALSTLRQKLRKYNRD--FEAPIAAYKQ
EIF3C_DANRE           FYIRLLADLEDYLNQLWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--FETEIASYKE
H3DCM5_TETNG          FYIRLLADLEDYLNQLWEDKEGKKKMNKN-NAKALSTLRQKIRKYNRD--YENEITSYKE
EIF3C_AEDAE           FIIRALAELEDFINMVWEDKEGRKNLSKN-NSKSLGTLRQKFRKYIKD--FDSDLKKFRE
EIF3C_ANOGA           IVVRALAELEDFVNESWDDKESRKNLSKN-NNKALGTLRQKFRKYIKD--FESDMKRFRA
EIF3C_DROME           FYIRCLAELEDFINEVWEDREGRKNLSKN-NSKSLGTLRQKVRKYIKD--FEDDLSRFRE
EIF3C_DROPS           FYIRCLAELEDFINEIWEDREGRRNLSKN-NTKSLGTLRQKVRKYIKD--FEEDLSRFRE
EIF3C_BOMMO           FFIRALVELDDWVVGAWNEREARKALSKG-NSKALTSLRQKLRKYTKD--FEAEISXFRE
E9HGP7_DAPPU          FFVQCLVEVETFLNELWEDRDGRKNLSKN-NSKSLSTLRQKMRKYVKD--FESDVAKFKE
G4LYI7_SCHMA          FYVRCIAELEDFVNDSWEKK---KEMNKG-AVKSLATLKQRVKKYTRL--FEANIRDFRE
B3RYW2_TRIAD          FYVKYLVELEDYIKEIWDDKDTKKKLSKI-NAKALGALRQKMKKYVRD--FENDMAAYRE
EIF3C_CAEBR           FYIRFLVEIEDYVNKLWEDKEAKAALSKN-NTKALSPLRQKLKKYIKDHGLTDLVSDYRA
EIF3C_CAEEL           FYIRSLVEIEDYVNKLWDDKDAKSALSKN-NAKALPPLRQKLKKYIKDQQLQDLVTDYRV
EIF3C_DICDI           SFIKALFIIQTSHRDLTTEQ--KKKLHAN-NNKSYNSIKQKLKKTCDL--YAKELKPYHD
F0Z7C0_DICPU          SFVKVLFLIQVSHRDLSAEQ--KKKLHAN-NNKAYNSIKQKLKKTCDL--YSKELKPYHD
D3BBM5_POLPP          ALVKTLYLIE-SGLAIDEAI--RKKLSQR-NSKAHTFLKQKIKKTTPP--YEAQIKPYRE
EIF3C_ASHGO           VFVRVVAQVEDLVAETSQAE-----IKNKIVAKAYNTVKQRVRKIARE--NEELLAKFRQ
EIF3C_KLULA           IFVKSLARFEDAVSATSQDE-----IKNKAVARAYNTTKQRVKKLIRE--NETSVKAYRE
EIF3C_CANGA           IFVKVVAQVEDLVSNSEQTE-----IKNKAVSKAFNTTKQRVKKIARE--NEALLAKFRE
EIF3C_YEAST           IFIKVVAQVEDAVNNTQQAD-----LKNKAVARAYNTTKQRVKKVSRE--NEDSMAKFRN
EIF3C_CANAL           FYIKLLTSLDNSITETSNNERD-DKTLKADEARAFNTLRQRIKKQIRE--FQVYYDLYKE
EIF3C_YARLI           VYIQCIVELEEFLNTQLEDKAG-IKKMNASNSRAFNTVKQRVRKNNKE--YEAAIAKYSS
EIF3C_EMENI           IYVKTVADLEDFVNETVAKQKSSNKKMNASNAKGFNAIKQKIKKNNKE--YAAQIEKYRA
EIF3C_ASPFU           IYIKAVADLEDFVNETVAKQKSGDKKLNASQAKGFNAAKQRIKKNNKD--YGNLIDKYRK
C0NXA3_AJECG          IYIKAIADLEDFMNETITEQKSSTKKMNASNAKGFNAVKQRIKKNNKE--YAAEIDKYRA
C7Z9S9_NECH7          PYIRILAELEDFMNESLAKAKVTPKKMNATQARALNAVKQKIKKTNKE--YQSQIDSYRE
EIF3C_NEUCR           SYIKAIADLEDFMNETLAKQKVTPKKMNATNARGLNAVKQRIRKNNKE--YQTQIDAYRK
EIF3C_SCLS1           VYIKALAELEDFMNETLAKQKVTPKKMNATNSRGLNAVKQKLKKTSKE--HQKDIDSFRA
EIF3C_PHANO           LYIQAIADLETVVLETHEKQKVTPKKMNAVNTRGFNAVRQKVKKHNRE--FQKDIDLYRE
D5G6D6_TUBMM          VYIKAIADLEDFMNETL-KDKATAKRMNATNARALNTIKQRVKRNNRS--YESQVEAYRK
EIF3C_SCHPO           PYIEFLSALDQ---KLESADKAFIKSLDAANGRAFNALKQRVRKNNRQ--FQSDIDRYRK
F4P9G3_BATDJ          FVSRSLVQIDDFIKNSLS-SKESTKKMNATIAKALNAMKQKIKKTTKT--YEQQIAEFRA
EIF3C_USTMA           FFYKAISQLDQYLNESAAKEKDAKKKMKAPVAKAMNGMKQKLKKVIKE--NDETIARYRS
D6RL89_COPC7          LYLKSLINLESSINTTVSKEKEAKKKMNATNAKALTAMKQKIKKALKE--FEDDVSKYQK
EIF3C_CRYNJ           RFLETLVSLEADVAKTLAAEKSAPKKMAPAKAKAVNGIRQTLKKKSKE--FDGVLKTYNE
E3KG31_PUCGT          SFIKVILSLEES-QTAVNENAAVKKKMNATNAKALNTMKQKLKKTIRE--NEAIIEKYKA
EIF3C_ARATH           LYIKTLVMLEDFLNEALANKEAKKKMSTS-NSKALNSMKQKLKKNNKL--YEDDINKYRE
F6HLF0_VITVI          LYIKALVMLEDFLSQALANKDAKKKMSSS-NAKALNSMKQKLKKNNKQ--YEDLINKYRE
F4J1N5_ARATH          LYIKTLVMLEDFLNED--NMKTKEKMSTS-NSKALNAMRQKLKKNNLQ--YQEDIKRFRE
A9RFE0_PHYPA          IYIKALVMLEDFLNTTLLNKDVKKKMSPS-NAKSLNYMKQKLKKNNKL--YEVDIEKFRA
A9SAG5_PHYPA          IYIKALVMLEDFLNATLVNKDAKKKMSPS-NAKSLNYMKQKLKKNNKL--FEADIEKFRA
A9SZ44_PHYPA          VYIKGLVLLEDYLNQTLLNKEAKKKMSPS-NAKALNFMKQKLKKNNQL--YQADIEKFRA
Q4U8V4_THEAN          LVVKLIVELSQFMEAQQKDKESYKKLSKA-KTISFNTLRSRLRKFNEQ--HSEIIEEYNK
Q4N1J6_THEPA          LVVKMIVELSQFMEAQQKDKESYKKLSKA-KTISFNTLRSRLRKFNEQ--HADIIEEYNK
A7APB4_BABBO          LIVQIIVELQEFIDEKQKDKDSLKKMSKA-RSISFNTLKSRLRKFNEQ--YAAVVDEYNK
Q4YU35_PLABA          FVIIYLDKLTKYVDTTFQNNVEKKNLSKN-KAQTLNKLRAKIRKCSEL--YQNKLNQYLE
Q7RR21_PLAYO          FVIIYLDKLTKYVDTTFQNNVEKKNLSKN-KAQTLNKLRAKIRKCSEL--YQNKLNQYLE
A0A077TJQ4_PLACH      FVIIYLDKLTKYVDTTFQNNVEKKELSKN-KAQTLNKLRAKIRKCSEL--YQNKLNQYHE
Q8I5Y3_PLAF7          FAIIYLDKLSKYVEKTFQNNVEKKNLSKN-KAQTLNKLRAKIRKCSEF--YQEKLNLYNE
B3LB47_PLAKH          FAIVYLDKLSKYVDTTFQNNVEKKVLSKS-KAQTLNKLKAKIRKCSAY--YQSKLDLYHE
A5K0G2_PLAVS          FAIVYLDKLTKYVETTFQNNVEKKVLSKN-KAQTLNKLKAKIRKCSEF--YQNKLNLYHE
D0MQP5_PHYIT          FYLRTMVALEDFLAEKVKNKAEQKKMSKE-NSKALIRMKGKLKKQLEP--MRKQIDDFRA
Q5CQQ0_CRYPI          FFISVLVELEAFLDEKFRDKEAIKKLSKA-KATSFNTLRAKFRKSVEE--YRDQMDDCKN
                           :  .                             :  .::                

G1MAG9_AILME          NPEQSADEDAEKN--EEDSEGSSDEDEDEDGVSAAAFLKK--------------------
H0X7M1_OTOGA          NAEQSADEDAEKN--EEDSEGSSDEDEDEDGVSAAAFLKK--------------------
EIF3C_HUMAN           NPEQSADEDAEKN--EEDSEGSSDEDEDEDGVSAATFLKK--------------------
EIF3C_PONAB           NPEQSADEDAEKN--EEDSEGSSDEDEDEDGVSAATFLKK--------------------
EIF3C_BOVIN           NPEQSADEDAEKN--EEDSEGSSDEDEDDDGVTAAAFLKK--------------------
G1PSM2_MYOLU          NPEQSADEDAEKN--EEDSEGSSDGDE--DGVSAAAFLKK--------------------
EIF3C_MOUSE           NPEQSADEDAEKN--EEDSEGSSDEDEDEDGVGNTTFLKK--------------------
EIF3C_RAT             NPEQSADEDAEKN--EEDSEGSSDEDEDDDGVSGTAFLKK--------------------
EIF3C_XENTR           NPEESADEDQEKD--EDSEASSSSDDDSDEGMSASKFLKK--------------------
EIF3C_DANRE           NPEQSADEEEEKD--DIGSGSSESDDDDDDDITAKSFMKK--------------------
H3DCM5_TETNG          NPQESADEEEERDGGDSGSSSDSEDEGKDEGLSAKSFLKK--------------------
EIF3C_AEDAE           SPDAADDDEEEEEKKEE---SESEDEQHVAPAAAKAVSFK--------------------
EIF3C_ANOGA           APEDFAEEEEDDEREDEKG-SDEEEEKVVVQVEPKAVSFK--------------------
EIF3C_DROME           APDQESEAEDEVVALESDG-GDAGDDSDAGVKPTEAV--P--------------------
EIF3C_DROPS           APDQESEAEDEE-AHVSDA-GEAADDSYAGFKKEASVTAP--------------------
EIF3C_BOMMO           DPDLPDDNERKDSSSSD----ESEDEEKPIKEKPKPEPLL--------------------
E9HGP7_DAPPU          NPGEEEEDEEAEEKSEDGSDEESGAEGPAAFRKSESETRH--------------------
G4LYI7_SCHMA          NSENYVDEEPGISDIEADEQEAAPSPIKVSGTLPTSTVKK--------------------
B3RYW2_TRIAD          NPD--VDEDSNVSGEEEDESDEDMDDGDVMDFTKKPENTT--------------------
EIF3C_CAEBR           NPDEDGYETPEDEN-------DEDDFEEVPEA----SPGR--------------------
EIF3C_CAEEL           NPDEDGYETPEDE--------DDDDFGEVSESKAEKSPGK--------------------
EIF3C_DICDI           NPALVNEQENKANSDDDDDDLSESESEESESSDDDKGKGK--------------------
F0Z7C0_DICPU          NPALANDSADTKGNNSEDD---ESE-EESE------------------------------
D3BBM5_POLPP          NPELLASDATATKKPANDDSESEDDDESSDDDTPKK------------------------
EIF3C_ASHGO           HPEAFEKDSTVEFGQ-ARDFDASDLTLMGRKVA---------------------------
EIF3C_KLULA           NPEDFDKEPVLDADIDSRDVSATPFSLSGKKNL---------------------------
EIF3C_CANGA           DPQSFDKEDTVEPELPPLNEENKVFT---GKGV---------------------------
EIF3C_YEAST           DPESFDKEPTADLDISAN-----------GFTI---------------------------
EIF3C_CANAL           NPEEFDEN--EDEPLESVQAGLNDNVKNEADNS---------------------------
EIF3C_YARLI           GGDVAEEEEEENKEDKPKPRAKDEFVLTAPSQA---------------------------
EIF3C_EMENI           DKDSYMESDEEEEKKPAIAAPRLSKLERVEAPVA--------------------------
EIF3C_ASPFU           DKEDFMESDDEE-AIPVIAAPRITKLERIEAPAA--------------------------
C0NXA3_AJECG          NKKDYMVEEEEEEVVEKKDKPRALRPEDLLGG----------------------------
C7Z9S9_NECH7          DKDGFMESSEEEVVAPVK-AKKVSLQVEAAPTE---------------------------
EIF3C_NEUCR           DADAFMES-DDEVAAPKV-VSKVRFEAPVVSAEQ--------------------------
EIF3C_SCLS1           DKDAYMESEDEEVVAPK--PKKAKSSAAAQNLVI--------------------------
EIF3C_PHANO           NKDEFMRETEEVEAAPKE-KKKKSKIPQLGTEIV--------------------------
D5G6D6_TUBMM          DKEGFMVEEREE-VVPTPRAPRSQELGVSFED----------------------------
EIF3C_SCHPO           DPEGFMKPAELNEIPKPAGKAGQDEVIVDGVA----------------------------
F4P9G3_BATDJ          APVDEEESEAEAEEAIKSTLKARDARRIEKEAEGKGEP----------------------
EIF3C_USTMA           DPEGFEAAAEAALSAAAAPADAETAIAKGKKERLAAAL----------------------
D6RL89_COPC7          DPEAFEREYLAHISQATQTPATRGPAAAAAPA----------------------------
EIF3C_CRYNJ           DPEAYTAAY-EKANAAPAAPKPKKAAVTTPGE----------------------------
E3KG31_PUCGT          DPEAFEQEAAAVDAPVPAAKKSKKSKTHDSEEE---------------------------
EIF3C_ARATH           APEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGS--------------------
F6HLF0_VITVI          HPESEEEGD-EDEEMEEDEDSGSEFEEDPSKIAMRSDSEE--------------------
F4J1N5_ARATH          SPEIEDDDEYEEEVVEDSADNVS-------------------------------------
A9RFE0_PHYPA          NPESEVEEEVD-DDEDAESADGFSDDDIVERTMNSDEEDE--------------------
A9SAG5_PHYPA          NPESEVEDEIDEDDEDAESADGFSDDDIVERTMNSDEEDE--------------------
A9SZ44_PHYPA          NPVSDVESDSDDGENADDVFSDDDDDDLPEDRPEDLSDDA--------------------
Q4U8V4_THEAN          DPDNFYDVLQQSEDE------------EEESTESSYSEWD--------------------
Q4N1J6_THEPA          DPDNFYDVLQQSEDE------------DEESTESSYSEWD--------------------
A7APB4_BABBO          DPSSYVDILKESSDEDYDSDDMDDSDDDDEDTEESSEESS--------------------
Q4YU35_PLABA          NPEKFKDDLGRRKKDED--EEDEED-EEDEEDEEDE------------------------
Q7RR21_PLAYO          NPDKFKDDLGRRRKDEDDDEDDDDD-DDDEEDEEDEDEED--------------------
A0A077TJQ4_PLACH      NPDKFKENLERRKKDEDDDEDDEDDDEEDEEDDEEE------------------------
Q8I5Y3_PLAF7          NPDDFKDDRKKDMDDDEDDEDNEEDDEEEEEDEEEQEDQDDDNEDEKDQDDDEDGKGKKK
B3LB47_PLAKH          NPEEFKLAMEDDLDDDDDEDEDDQTDEEEEDDEEPAD-----------------------
A5K0G2_PLAVS          NPEEFKAAMQDEEEDEEEEEEEDDEEEEEADEEEADE-----------------------
D0MQP5_PHYIT          NPMDSSEEEDSDSSSESSSDESESDSSSASSEGSSDASAS--------------------
Q5CQQ0_CRYPI          NPLAYQDDNLSDDDSDSNSYSDSDSDSDSDSDSSSSSSGS--------------------
                                                                                  

G1MAG9_AILME          ------------------------KSEAPSGESR---KFLKKMEDDDEDSEDSEDDEDWD
H0X7M1_OTOGA          ------------------------KSEAPPGENR---KFLKKMEDEDEDSEDSEDDEDWD
EIF3C_HUMAN           ------------------------KSEAPSGESR---KFLKKMDDEDEDSEDSEDDEDWD
EIF3C_PONAB           ------------------------KSEAPSGESR---KFLKKMDDEDEDSEDSEDDEDWD
EIF3C_BOVIN           ------------------------KSEAPSGDSR---KFLKK-EDEDEDSEESEDSEAWD
G1PSM2_MYOLU          ------------------------KSEAPSGESR---KFLKKMEDEDEDSEDSEEDEEWD
EIF3C_MOUSE           ------------------------KQES-SGESR---KFHKKMEDDDEDSEDSED-EEWD
EIF3C_RAT             ------------------------KPDS-SGESR---KFHKKMEDDDEDSEDSED-EEWD
EIF3C_XENTR           ------------------------ADSAPPESRS---KFLKKEEAEDEES--SSDDEDWG
EIF3C_DANRE           ------------------------KPQEEEKKAPEASKFLKGAADEESESDDDEDSEDWA
H3DCM5_TETNG          ------------------------KP-EPASEASKFLKSAKGSGDESSSSDEDEDEEDWS
EIF3C_AEDAE           ------------------------KEVKQVKVEK--------------DDDESDDSIDWD
EIF3C_ANOGA           ------------------------KEPEKAKPVK--------------PVADSD-SSDWG
EIF3C_DROME           ------------------------KAVKSAPAKAA-----------PADDDDSDDSIDWD
EIF3C_DROPS           ------------------------KIAKSAPAKSV-----------PADDEDSDDSIDWD
EIF3C_BOMMO           ------------------------RPPP--------------------EDDESSDSMDWA
E9HGP7_DAPPU          ------------------------KPAPKVKPIA--------------PEGDESDDSYWD
G4LYI7_SCHMA          ------------------------STRKSIASDS----------EDDDDDMDDSDSDDFS
B3RYW2_TRIAD          ------------------------GRSQFLKSGS---------------SESESDGDDWS
EIF3C_CAEBR           ------------------------QAERAADSES-------------ESDSDDDDSFNWS
EIF3C_CAEEL           ------------------------PSEKAAVSDS-------------DSDSDDDDSSNWS
EIF3C_DICDI           ------------------------GKAAFGKKPAT-------KAVVAKKPLTKKGDDDSE
F0Z7C0_DICPU          --------------------------------------------------------EESE
D3BBM5_POLPP          -------------------------PTPAASKKAA-------PAKKPAGGWFKKGSDDSD
EIF3C_ASHGO           ------------------------------------------------------------
EIF3C_KLULA           ------------------------------------------------------------
EIF3C_CANGA           ------------------------------------------------------------
EIF3C_YEAST           ------------------------------------------------------------
EIF3C_CANAL           ------------------------------------------------------------
EIF3C_YARLI           ------------------------------------------------------------
EIF3C_EMENI           ------------------------------------------------------------
EIF3C_ASPFU           ------------------------------------------------------------
C0NXA3_AJECG          ------------------------------------------------------------
C7Z9S9_NECH7          ------------------------------------------------------------
EIF3C_NEUCR           ------------------------------------------------------------
EIF3C_SCLS1           ------------------------------------------------------------
EIF3C_PHANO           ------------------------------------------------------------
D5G6D6_TUBMM          ------------------------------------------------------------
EIF3C_SCHPO           ------------------------------------------------------------
F4P9G3_BATDJ          ------------------------------------------------------------
EIF3C_USTMA           ------------------------------------------------------------
D6RL89_COPC7          ------------------------------------------------------------
EIF3C_CRYNJ           ------------------------------------------------------------
E3KG31_PUCGT          ------------------------------------------------------------
EIF3C_ARATH           ------------------------DVDEPTDNLT--------------------------
F6HLF0_VITVI          ------------------------DEEDGEDREDSA------------------------
F4J1N5_ARATH          ------------------------------------------------------------
A9RFE0_PHYPA          ------------------------DQEDDGGG----------------------------
A9SAG5_PHYPA          ------------------------EQEDDGGG----------------------------
A9SZ44_PHYPA          ------------------------DNPDDGGD----------------------------
Q4U8V4_THEAN          ---------------------EDEEEE-EEEVEAA-----------EEKSPRSGDTSGWS
Q4N1J6_THEPA          ---------------------EDEEEEAEEEAEAP-----------EEKSPKSGDTSGWS
A7APB4_BABBO          ---------------------VEEESASEDESEQASAVDAEDDDGGDEDSEEDSDYSDWS
Q4YU35_PLABA          ---------------------EDEEKDKINKEDGD-------------EED------DWS
Q7RR21_PLAYO          ---------------------EDEKKDKTNKEDGD-------------EEDERDEEDDWS
A0A077TJQ4_PLACH      ---------------------DDGKKKKTNKDDED-------------EDEE-DDDDDWS
Q8I5Y3_PLAF7          LSSKTKSKKGKEKKEEKEDYDDDNDEEKEDEADDD-------------NDDDDDDSDDWS
B3LB47_PLAKH          ---------------------QEEEKKEK--AKDE-------------KTPGEEDSDDWS
A5K0G2_PLAVS          ---------------------GDEADEEEGGKKKE-------------KTPGEEDSDDWS
D0MQP5_PHYIT          ------------------------ESEEESSDDDK------------SDDDSDDSDGSWP
Q5CQQ0_CRYPI          ------------------------DSRSVSGSDSDGNGSGSDESSSDSDSSSSSSSSEWS
                                                                                  

G1MAG9_AILME          TGSTSSDSDSEEE-EGKQTVLASRFLKKAPTTEEDKK--------AAEKKREDKAKKKHD
H0X7M1_OTOGA          TGSTSSDSDSEEE-EGKQTALASRFLKKAPTTEEDKK--------AAEKKREDKAKKKHD
EIF3C_HUMAN           TGSTSSDSDSEEE-EGKQTALASRFLKKAPTTDEDKK--------AAEKKREDKAKKKHD
EIF3C_PONAB           TGSTSSDSDSEEE-EGKQTALASRFLKKAPTTDEDKK--------AAEKKREDKAKKKHD
EIF3C_BOVIN           TSSTSSDSDSEEE-EGKQTVLASRFLKKAPTTEEDKK--------AAEKKREDKAKKKHD
G1PSM2_MYOLU          TGSASSDSDSEEE-EGKQTVLASKFLKKAPATEEEKK--------AAEKKREDKAKKKHD
EIF3C_MOUSE           TSSTSSDSDSEEE-EGKQTVLASKFLKKAPTTEEDKK--------AAEKKREDKAKKKHD
EIF3C_RAT             TSSTSSDSDSEEE-EGKQTVLASKFLKKAPTTEEDKK--------AAEKKREDKAKKKHD
EIF3C_XENTR           SDSDESDSDESDD-ENKYTSMASRFLKKTVN-EGDRQ--------AAEKKKEEKAKKKQH
EIF3C_DANRE           SDSVGSDSESEDN-DGTAASLAVVFLKKDVGEKASDR--------KKDDRR--RRHKKKE
H3DCM5_TETNG          SDTVDSSSESSDEGEEKSTSLAVVFLK-NLGIGHNSR--------SKCTKA--ANGSKHF
EIF3C_AEDAE           MDS-DSDESSSDE-ETQYTSIRERFLKKAEKDDGE----------DAENKKEKKKLQKDS
EIF3C_ANOGA           SDS-DSDSTSSDE-DAKYTSIRDRFLKKPEKGTEEIASAPSGVSGDDAFKKEKKKKTGEA
EIF3C_DROME           SDS-ESETESSDD-ENQYQNMRERFLKRTTEKEEK----------DDDKRKDKRK---EQ
EIF3C_DROPS           SDS-ESETESSED-ENQYQNMRERFLKRSTEKGEDK--------GDDDKRKDKRK---EQ
EIF3C_BOMMO           SSSSDSSFSSDDE-ERGTSNIREQFIKKVTKKEDDE--------EKIKLKLKKREERRER
E9HGP7_DAPPU          SDG-EDETSSSDD-DSKYANLKEKFLKVAGGDEDKK-----------KEKKDRKDKEKAQ
G4LYI7_SCHMA          DDDDSSSTSSIDINLDRCKDPSVYFLKSTSDDKKDK------------TKIKKIAKDRST
B3RYW2_TRIAD          ASEDEDDGSDKEGGGGSKATGPSIFLKSTAGTVARDS----------KRRKGKGSKQVAP
EIF3C_CAEBR           SEPDTNSSDDEEN-VTKMEQLRRYFLKKEFREESKDD------------KKDKRKRVIKV
EIF3C_CAEEL           SEPESNSSDDEDS-VTKMEQLRRYFLKKEFRVESKDD------------KKEKKKRVIRV
EIF3C_DICDI           SESEESESESEELISESWSSDSDDDSDSDSDDDSGDN--------KWMIKDDKKVVAKAS
F0Z7C0_DICPU          TESEESDSEDE--------------------------------------KPKKKPVKPTP
D3BBM5_POLPP          S-GFSSDSEDE--------TSSDDSSYSDSDEDTGSK--------WWVKDTGAKATTQTT
EIF3C_ASHGO           ------------------------------------------------------------
EIF3C_KLULA           ------------------------------------------------------------
EIF3C_CANGA           ------------------------------------------------------------
EIF3C_YEAST           ------------------------------------------------------------
EIF3C_CANAL           ------------------------------------------------------------
EIF3C_YARLI           ------------------------------------------------------------
EIF3C_EMENI           ------------------------------------------------------------
EIF3C_ASPFU           ------------------------------------------------------------
C0NXA3_AJECG          ------------------------------------------------------------
C7Z9S9_NECH7          ------------------------------------------------------------
EIF3C_NEUCR           ------------------------------------------------------------
EIF3C_SCLS1           ------------------------------------------------------------
EIF3C_PHANO           ------------------------------------------------------------
D5G6D6_TUBMM          ------------------------------------------------------------
EIF3C_SCHPO           ------------------------------------------------------------
F4P9G3_BATDJ          ------------------------------------------------------------
EIF3C_USTMA           ------------------------------------------------------------
D6RL89_COPC7          ------------------------------------------------------------
EIF3C_CRYNJ           ------------------------------------------------------------
E3KG31_PUCGT          ------------------------------------------------------------
EIF3C_ARATH           ------------------------------------------------------------
F6HLF0_VITVI          ------------------------------------------------------------
F4J1N5_ARATH          ------------------------------------------------------------
A9RFE0_PHYPA          ------------------------------------------------------------
A9SAG5_PHYPA          ------------------------------------------------------------
A9SZ44_PHYPA          ------------------------------------------------------------
Q4U8V4_THEAN          DSGSHPASEAEDGDKHNKAMDKWGVKKSEPRAEMAE---KTKKTKSKTKKREVLEKPTPI
Q4N1J6_THEPA          DSGSHPTSEAEDGDKHNKAMDKWGVKKAEARPEMVE---KPKKTKTKAKKREVLEKQTPI
A7APB4_BABBO          DSDASSISDADAGDKHKSALAKWGVKKVDSAPKVQKPKVASKKPKGKVVKK-KEERPVVP
Q4YU35_PLABA          YSEDAEYASDEEDDKTKKAMSKWGLKTIEKVDSKKKVAKIKKSKKEGTKKKDDKGS----
Q7RR21_PLAYO          YSEDAEYASDEEDDKTKKAMSKWGLKTSEKVDSKKKVAKVKKSKKEGTKKKDDKGS----
A0A077TJQ4_PLACH      YSDDAEYASDEEDDKTKKAMSKWGLKTSEKVESKKKVAKVKKTKKEGTKKKDEKGT----
Q8I5Y3_PLAF7          YSEDDNYASDEEDDKTKNAMSKWGLKTSTKVE-KKKTVKQKKVKKESTKKEEKANR----
B3LB47_PLAKH          NSEEEEYVSDDGDDKTKSAMSKWGLKTSEKVE-KKKVVKTK-VKKEGTKKEE-KVV----
A5K0G2_PLAVS          NSEEEGYVSDDADDKTKSAMSKWGLKTSEKVE-KKKAVKTKKVKKEGTKKEE-KAT----
D0MQP5_PHYIT          SGSASSSSSSEDDDNMPKGRARWLKQTPVVTKAKKVK-----------------------
Q5CQQ0_CRYPI          SYEDEYEDRHASALAKWGTRTKSVKKKESGKKANRQK-----------------------
                                                                                  

G1MAG9_AILME          RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
H0X7M1_OTOGA          RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_HUMAN           RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_PONAB           RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_BOVIN           RKSRRPDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
G1PSM2_MYOLU          RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_MOUSE           RKSKRLDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_RAT             RKSKRMDEE------EEDNEGG-EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEI
EIF3C_XENTR           RKVKRKDEEGE--EEEDDNEGGGEWEKVKGGVPLVKEKPKMFAKGTEITPPIVVKKLNEI
EIF3C_DANRE           RIEEEAEEE------GEAEEGG--WEKVKGGVPLVKEKPKMFAKGTEINTGVVVKKLSEI
H3DCM5_TETNG          PRSVQMSDF------RTHEAEK--LDK-KPGAPLVKEKPKMFAKGTEINVPVVVKKLNEI
EIF3C_AEDAE           KDRLKKKR-------AEDDDEG--WEVVNGNRSTSAEQPKMFAKDAEIDVNVVINKLNEV
EIF3C_ANOGA           LSKKKKPKQDEMFDENEEEEEG--WKVVNGTRSGASEQPKMFAKDAEIDTKLVVNKLNEV
EIF3C_DROME           KTKIRKRAE-------DDEDGE--WETV--VKGHVVEKPKMFEKDAEIDVPLVLAKLLEI
EIF3C_DROPS           KLKIRKRAE-------DDEDGE--WETV--VKGHVVEKPKMFEKDAEIDIPLVLAKLVEI
EIF3C_BOMMO           SGKINKRDV-------ADDGGE--WETVR-KGAATSDKPKMFAKDSDIDAALVVKKLGEI
E9HGP7_DAPPU          RRKDREEEE-------ELEMEG--GDGWQVQGKATQAKPKMFAKDADINTGVVLKKLFEI
G4LYI7_SCHMA          KKQLRASSD--------IEDGT--WTTIDSYGRPE-IQVQAFEKGQEINFDVVVKKMTEI
B3RYW2_TRIAD          KDDNELSAE-------EAKVSK-----------DKSPDKALFGKDAEITNESVLVKVQEI
EIF3C_CAEBR           KEVVEEDDD--------------DWTPVS-----REKSVVHFDPNEEVTHDVMIKKLNEV
EIF3C_CAEEL           KEAVEEDDDA-------------DWTPVN-----REKSVVHFDPKEEVTHDVMIKKLNEV
EIF3C_DICDI           VTTVRKTDKD--------KLDRRNAVVSPLSGSGSAVPTAGEGEGEKLTQDQIMKKVKEV
F0Z7C0_DICPU          ASTKKS---------------------SFFKKTAAADSSESEESDKKLTQEQVMKKVKEV
D3BBM5_POLPP          KKDKKKEPK-------------KVVTPQVESTTTAATAGAAPAVQRQLTQEEITKKLKEI
EIF3C_ASHGO           --------------------------------DRS-------AIVSSPS--DFFSALRIV
EIF3C_KLULA           --------------------------------DLA-------SVANNISELDFFKTLNII
EIF3C_CANGA           --------------------------------NLS-------SLASASSEFSFMASLQIV
EIF3C_YEAST           --------------------------------SSS-------QGNDQAVQEDFFTRLQTI
EIF3C_CANAL           --------------------------------NVG-------ALASNRVLSPIFHTLKTI
EIF3C_YARLI           --------------------------------SNEEFTTVGKAGKALVSPTDMFKTLKTV
EIF3C_EMENI           ----------------------------VAGDDDGFETVVRG-KTLQYTPESILKHLRVI
EIF3C_ASPFU           ----------------------------AI-DDDGFATVGRGGKTLQYTPESILKHLRVI
C0NXA3_AJECG          -------------------------------DEEGFAIVGRGGRTLQYTPESILKHLRLI
C7Z9S9_NECH7          -----------------------------EADDEGFATVGKGGRTLQYTPESIFKHLRTI
EIF3C_NEUCR           ----------------------------QEEDDKGFSTVDSRGKVVQYTPESILKHLRAI
EIF3C_SCLS1           ----------------------------DGDDDEGWGTVGKGGRTLQFTPESILKHLRTI
EIF3C_PHANO           ----------------------------DEATDDGFITVGAGGKAVQYTPEGILKHLRAI
D5G6D6_TUBMM          -------------------------------DDEGFSLVGRGGRAMVYTPESIFKHLRVI
EIF3C_SCHPO           -------------------------------TRGIVAPTEGLGKPEEITPADIFKYLRAI
F4P9G3_BATDJ          ----------------------------TGSGNESFTLVGKGGKLIDLSPEGLFTKLTEV
EIF3C_USTMA           ----------------------------DSDANDDFQTVGRGGRTETFTSEGLFKSLTAI
D6RL89_COPC7          ------------------------------TDADEFTTVGKGGRAQQYTSETIFKHLQAV
EIF3C_CRYNJ           ------------------------------GEDDEFMTIGKGGKTLNLTADGVFKTLREI
E3KG31_PUCGT          -----------------------------PDDDDDFTMVGKGGKSFSFSPDSIFKTLQSV
EIF3C_ARATH           -------------------------WEKMLSKKDKLLEKLMNKDPKEITWDWVNKKFKEI
F6HLF0_VITVI          -------------------AEAGGGWEKKMSKKDKLMDKQFMKDPSEITWDTVNKKFKEI
F4J1N5_ARATH          ------------------------------------WEMLFSLDHEEITWNMVNKKFKEI
A9RFE0_PHYPA          ----------------------------WTSAEKKPKEMFPKLDPGQISWEMVDKKLKEV
A9SAG5_PHYPA          ----------------------------WTSAEKKPKEMFPKMDPGQISWEMVDKKLKEI
A9SZ44_PHYPA          ----------------------------WTSAQKKPKEMFPKLDPGQISWEMVDKKLKEI
Q4U8V4_THEAN          TSISKFSAVTAASDALVEYFKEVKLGNDDNPFSVMIPEVQEMLNTVHLSEEALRLFVKSI
Q4N1J6_THEPA          TSITKFSAVTAASDALVEYFKEVKLGNDDNPFAVMIPEVQEMLDTVHLSEEALRLFVKSI
A7APB4_BABBO          SGVGIMHTVSQVADVIVPILEKADLGAADNPFSLSTPEINAVISQVMVSADSVRSYVKSI
Q4YU35_PLABA          --------------------------HIDDNQSSKKKTYAELLNTKNLSEDVIRNRVKSV
Q7RR21_PLAYO          --------------------------HIDDNQSSKKKTYAELLNTKNLSEDVIRNRVKSV
A0A077TJQ4_PLACH      --------------------------HADDNQSSKKKTYAELLNTKNLSEDVIRNRVKSV
Q8I5Y3_PLAF7          --------------------------VVEDSQSAKNKGYAELLSTKNLTEDVIRERVKLV
B3LB47_PLAKH          --------------------------HVDENQSAKNKAYAELLSTKNLSEEVIRNRVKFV
A5K0G2_PLAVS          --------------------------HVDENQSAKNKAYAELLSTKNLSEEVIRNRVKFV
D0MQP5_PHYIT          -------------------GPKVVKQREARRGSEDDVKKVVVEEELKLTPSQFDRRVKEV
Q5CQQ0_CRYPI          -----------------QVKKDLQDTTVSGGANNNIPSGDLLSFEGEVTVDMIVEKVGEI
                                                                          .   .  :

G1MAG9_AILME          LQARG-KKGTDRAAQ---IELLQLLVQIASENNLGEGVIVKIKFNIIASLYDYNPNL-AT
H0X7M1_OTOGA          LQARG-KKGTDRASQ---IELLQLLVQIASENNLGEGVIVKIKFNIIASLYDYNPNL-AT
EIF3C_HUMAN           LQARG-KKGTDRAAQ---IELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNL-AT
EIF3C_PONAB           LQARG-KKGTDRAAQ---IELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNL-AT
EIF3C_BOVIN           LQARG-KKGTDRAAQ---IELLQLLVQIASENNLGEGVIVKIKFNIIASLYDYNPNL-AT
G1PSM2_MYOLU          LQARG-KKGTDRASQ---IELLQLLVQIASENNLGEGVAIKIKFNIIASLYDYNPNL-AT
EIF3C_MOUSE           LQVRG-KKGTDRATQ---IELLQLLVQIAAENNLGVGVIVKIKFNIIASLYDYNPNL-AT
EIF3C_RAT             LQVRG-KKGTDRATQ---IELLQLLVQIASENNLGVGVIVKIKFNIIASLYDYNPNL-AT
EIF3C_XENTR           LQARG-KKGTDRAAQ---IDLLHLLAGIAEENNLGQGIAVKIKFNIVASLYDYNTNL-AT
EIF3C_DANRE           LQARG-KKGTDRAAQ---IELLHALAGIAAENNLGEGILVKIKFNIIASLYDYNPNL-AA
H3DCM5_TETNG          LQARG-KKGTDRAAQ---IELLHALAAIANENNLGQGVLVKIKFNIIASLYDYNPNL-AA
EIF3C_AEDAE           MAARG-KKRTDRKLQ---IEFLRELRTIADTHNLGDAVAAKIRFNIVSAIFDYNPKV-SE
EIF3C_ANOGA           MAARG-KKRTDRKMQ---IEFLRELRTVAETNNLGPAVAVKIRFNIVSAIFDYNPKV-SG
EIF3C_DROME           MSARG-KKRTDRRLQ---IDLLFELRDISDQHNLGTAVSVKIHFNIISAIYDYNQKI-SE
EIF3C_DROPS           MSARG-KKRTDRRLQ---IDLLFELRDISDQHNLGVPVSVKIHFNIISAIFDYNQKI-SE
EIF3C_BOMMO           SAARG-RKRTDRRAQ---LELLHELRTVALQHNLGDALQLKLRSAIVAALFDYNPKV-SD
E9HGP7_DAPPU          LAARG-KKGTDRREQ---VEMLHELYTVAEANNLGVGIAVKVKFTIISAIFDYNPKI-CD
G4LYI7_SCHMA          LASRG-KKGASTSDQ---IVLLMQVEEKIKECDLSRGLHVKVLFAFISVLFDYDKK--HD
B3RYW2_TRIAD          VAVRG-KKSTDRREV---INTFKELLQITSRENLSTALSVKILVGLISAIYDSAVAVLVN
EIF3C_CAEBR           MSARG-KRTTDRNQH---VANLQKLLEVAEEKQLGLGISVKISFCIISALFELNAKI-SD
EIF3C_CAEEL           MSARG-KRTTDRNQH---VANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKI-SD
EIF3C_DICDI           ISNRG-KLKTDPMKQ---IQQLEYFYSLIQ----GDKETFIVLYELIAAQFD-TASV-KV
F0Z7C0_DICPU          IAARG-KLKTDPVKQ---IQQLEYLYSLIQ----GEKETFVVLYQLIAAQFD-TASV-KV
D3BBM5_POLPP          LSSRG-KKGTSPSKQ---VEDLEFLLTQVK----TEKETFDILYNLINAQFDLSPNL-QT
EIF3C_ASHGO           IDSRG-KKGTDIQAQ---IKTMEELVSISKS----PYESIIAYLNLIPIRFDACA--NLA
EIF3C_KLULA           IDSRG-KKNTDHTEQ---IKTTEELLKIAKT----PYEKICTYLNLIPIRFDASV--SLS
EIF3C_CANGA           NDSRG-KKNSNQAEL---IKTLEELLNIAKT----PYERILAYLTLIPTRLEEST--NLS
EIF3C_YEAST           IDSRG-KKTVNQQSL---ISTLEELLTVAEK----PYEFIMAYLTLIPSRFDASA--NLS
EIF3C_CANAL           SESRG-KKNIDKLEQ---IATLEKLLEANVSKS-SPFELISIYQMLLSVRFDASS--NQA
EIF3C_YARLI           LESRG-KKNTDREDQ---VRQLENLLPSAST----VYQKISVYTMLVSTRLDLSS--ASA
EIF3C_EMENI           VESRG-KKNTDRLEQ---IKTMEKLLEVAQ----TPYQRIRVYLTLISTRFDLSTTSTAA
EIF3C_ASPFU           VESRG-KKNTDRMEQ---IRTMEKLLEVAQ----TPYQRIRVYLTLISTRFDLTSTSSAN
C0NXA3_AJECG          VESRG-KKNTDRLEQ---IKIMERLQEVAT----TPYQSIRVLLTLISTRFDLTSSSTAN
C7Z9S9_NECH7          MESRG-KKNTDRAEQ---IKVMEKLHEIAN----TPYQKIRLLLTLVSARFDLSS-SGAT
EIF3C_NEUCR           IESRG-KKNTDRLEQ---IKVMETLNKVVPI---TPYQKIRVLQTLISARFDLGA-GGAA
EIF3C_SCLS1           LESRG-KKNTDRNEQ---IKIMEKLYEVAA----TPYQRIRVLLTLISTRFDMTT-GTQT
EIF3C_PHANO           VEQRG-RKNSDKLEH---IRTLEKLFDVSV----NDYQRIRVLLTLISTRFDLTS-GTAS
D5G6D6_TUBMM          IEARG-KKNTDKGEQ---IKVMEKLYEVAH----TPYQRIKVLLALVSTRFDLTT-GALS
EIF3C_SCHPO           FEARG-KKSTDRSEQ---IRLLEKLSTIAV----TDYQRLRVKVALLAVRFDINT-GSGQ
F4P9G3_BATDJ          LEARG-KKSTDKLAQ---VETLMQLLEIAVT----PYQKIRVLTALIPARFDY-VPISGF
EIF3C_USTMA           MEARG-KKSTDKNEQ---IRKLHDLSGVADS----PYKKIRVILALVAARFDYNASATAY
D6RL89_COPC7          QEARG-KKNTDRAEQ---IRILEKLLEVSVT----PYQRIRVLLALISYRFDYNSALSTH
EIF3C_CRYNJ           FEARG-RKNTDRAET---IKILTKLLEVSET----TYQKIRVLLALVPARLDYSQHLVS-
E3KG31_PUCGT          LEARG-KKNTDRQEQ---LMILDKLLSISTT----TYQRIRILLALISSQFDYNPAITTH
EIF3C_ARATH           VAARG-KKGTARFEL------VDQLTHLTKIAK-TPAQKLEILFSVISAQFDVNPG-LSG
F6HLF0_VITVI          VAVRG-RKGTGRIEQ------VEQLTFLTRVAK-TPAQKLEILFSVVSAQFDVNPS-LSG
F4J1N5_ARATH          RAARWSKRRSSSLKLKPGETHAQKHMDLTKIAK-TPAQKVEILFSVISAEFNVNSGGLSG
A9RFE0_PHYPA          ILARG-RKGTDRAEQ------VEQLSYLARCAK-TPAQKLEVMVHVVSAQFDVNPS-LNS
A9SAG5_PHYPA          IVARG-RKGTDRAEQ------VEQLSYLARCAK-TPAQKLEVMVHVVSAQFDVNPS-LNT
A9SZ44_PHYPA          IVARG-RKGTDRAEQ------VEQLSYLARCAK-TPAQKLEVMVHVVSAQFDVNPS-LST
Q4U8V4_THEAN          IEKRG-KRGTNNFEN---LKILQSLPYIAKT--ISQSLYLEVLETLVHVLFDTYSHA-YG
Q4N1J6_THEPA          VEKRG-KRGTNNFEN---LKILQSLPYIAKT--ISQSLYLEVLETLVHVLFDNYSHA-YG
A7APB4_BABBO          VERRG-KRGGNTAET---IRHLKVLPYIAKG--ISHSLYIFVVETLLHIEFDSYSNA-YG
Q4YU35_PLABA          IEKRG-RKGLDKHEH---INILSKLCEIAKT--ISTQSYIEVLEHLINLEFDVVSSV-YT
Q7RR21_PLAYO          IEKRG-RKGLDKHEH---INILSKLCEIAKT--ISTQSYIEVLEHLINLEFDVVSSV-YT
A0A077TJQ4_PLACH      IEKRG-RKGLDKHEH---INILSKLCELAKT--ISTQSYIEVLEHLINLEFDVVSSV-YT
Q8I5Y3_PLAF7          IEKRG-RKGLDKHEH---INILSKLCEIAKT--ISTQSYIEVLEHLINLEFDVVSSV-YT
B3LB47_PLAKH          IEKRG-RKGLDKHEH---INILSKLCELAKT--VSTQSYIEVLEQLINLEFDVVSSL-YT
A5K0G2_PLAVS          IEKRG-RKGLDKHEH---INILSKLCELAKT--ISTQSYIEVLEQMINLEFDVVSSV-YT
D0MQP5_PHYIT          IAMRG-KKGMDLSGQ---LTLLRKLANYARR--LGPARQIVATMYLVGTSVFDTSSKIDR
Q5CQQ0_CRYPI          VAARG-KKGTDRQEQ---IRLLKKAAEISRP--LSLQAYADVLTHLISAQFDTITGA-FH
                         *  :                                      .:             

G1MAG9_AILME          YMKPEMWQKCLDCINELMDILFANP----------NIFVGENILEESE-NLHNVD-----
H0X7M1_OTOGA          YMKPEMWQKCLECINELMDILFANP----------NIFVGENIMEESE-NLQNVD-----
EIF3C_HUMAN           YMKPEMWGKCLDCINELMDILFANP----------NIFVGENILEESE-NLHNAD-----
EIF3C_PONAB           YMKPEMWGKCLDCINELMDILFANP----------NIFVGENILEESE-NLHNAD-----
EIF3C_BOVIN           YMKPEMWQKCLDCINELMDILFANP----------NIFVGENILEESE-NLHNAD-----
G1PSM2_MYOLU          YMKPEMWQKCLDCINELMDILFANP----------NIFVGENILEESE-NLHNVD-----
EIF3C_MOUSE           YMKPEMWQMCLDCINELMDTLVAHS----------NIFVGENILEESE-NLHNFD-----
EIF3C_RAT             YMKPEMWQMCLDCINELMDTLVAHS----------NIFVGENILEESE-NLHNFD-----
EIF3C_XENTR           YMKADMWKKCLDSIHDLLDILFANS----------NMFIGEHISEDSE-NLSNTD-----
EIF3C_DANRE           FMKADMWKKCLDCIDELLDILFNNN----------NIFIGENIAEDSE-NLAISD-----
H3DCM5_TETNG          FMKPDMWKKCLDCIEELQTILFEHS----------NIFIGENIAEDSE-NLANTD-----
EIF3C_AEDAE           PMKLEHWSKLLEEIQALIKLLLAND----------DIVLSETILEEN---EEYET-----
EIF3C_ANOGA           AMKLEHWSKLLEEIQELLKLLLAHE----------DVHLSESILDEY---EEYDT-----
EIF3C_DROME           PMKLEHWALLLEVMQSMMKLLLANA----------DIIMSESVAEEH---EEYAT-----
EIF3C_DROPS           PMKMEHWALLLEVMQSMMKLLLANA----------DISISESVAEEH---EEYIT-----
EIF3C_BOMMO           AMKPEYWSKLVENIDHMVTLLLAHE----------DMVLSETILEEN---EQLVT-----
E9HGP7_DAPPU          AMKPEHWEKLLQCIAELLTLLNSRT----------DIVMGEHVSAEYDAEEDPTR-----
G4LYI7_SCHMA          CMNSNLFDRTLNAFDRLFDLLNEIN----------IQLIALDSNDDES----FEH-----
B3RYW2_TRIAD          SMKQEYWKMCTEFIVTLVDMLLDHP----------EITTGMNIPEESE-NIIDPN-----
EIF3C_CAEBR           YMEYETFMNTLRTVNTLLDLLITTD----------RVKLSVTYAEEDE-NLKDEN-----
EIF3C_CAEEL           HMEYETFMTTLQTVNSLLDLLIGTD----------RVKLSVTYAEEDE-NLKDDT-----
EIF3C_DICDI           ALSIPVWQKVADGIKKLLEILETNT----------NFVLVLEHQEPTI-----SK-----
F0Z7C0_DICPU          ALAIPTWTKVAEGIKKLLEILRKNP----------NFVLALEHQEPEV-----QK-----
D3BBM5_POLPP          SLALPVWKSCSDNILRLLDMLNTNK----------HFILCSDNEEPKL-----KE-----
EIF3C_ASHGO           YQPLEQWKASHNNVTSLLELLEANI----ESYHVTELAPRNEFIEEEPQPNENG------
EIF3C_KLULA           YQPLEQWKASKDNLDGLLEVLEQEI----DHYQVTEFAPRNDFIEDEPEANEHG------
EIF3C_CANGA           YQPIDQWKSTHDDLNKLFDILDENI----SSYQVTELAARNDDLETEPEPNANG------
EIF3C_YEAST           YQPIDQWKSSFNDISKLLSILDQTI----DTYQVNEFADPIDFIEDEPKEDSDG------
EIF3C_CANAL           FMPLEQWQKNEQDLGKLLDLLEANV----DTYQVSELGSTTDDIDIEPVANAQG------
EIF3C_YARLI           ALAPENWLKVVGDLNDLLSILEENI----DTYHVIETAPEIEDVEKGPVAREDG------
EIF3C_EMENI           YMSVEQWKAAEQELSTLLSVLEKER----NYVVSEGAEEWEDDEKQPQVAAGET------
EIF3C_ASPFU           YMAVDQWKSAEQDFSSLLSVLENNR----DHVVFEGAEEWEDDEKQPTIAPGET------
C0NXA3_AJECG          YMSTEQWKLAVQELETLISTLEEYP----EFIVTEGAEEWEDDEKQPQLAPGET------
C7Z9S9_NECH7          AMPLEHWKAAEKELSSLLQVLEENR----DYVVVENAEEWDDDEKPPTLQAGEKH-----
EIF3C_NEUCR           QMPLDQWKAAERDLASLLEILEKEK----DHVVVEGAEEWDDDDKLPTIPEGEKY-----
EIF3C_SCLS1           FMSQEQWKAAEKEFATLLSVVETNR----EFVVVETAEPWEDDEKLPTVADGEK------
EIF3C_PHANO           HMHQDQWKLADQEFGKLLEILENTK----EIVVIENAEEWEDDDKLPPIEEGQI------
D5G6D6_TUBMM          YMATDQWKSAEQEFNTLLEVLEANP----DYVVIETAEEWDDDEKPPQPAPGEI------
EIF3C_SCHPO           YMPIDQWNAALTELHSILDIFDANP----KIVIVEQVEDENEEEEEAIAAAENNN-----
F4P9G3_BATDJ          MSSSM-WNKALEEIKDLVRLLDENPHITLSLNVIEEDPDQDTVPEHIRDRHITAG-----
EIF3C_USTMA           MPVEM-WDSARKEINEIVALLGKN----RSYVVREETEDYDDEVERVPGQN-GEK-----
D6RL89_COPC7          MPAEL-WLAAQREVDQLLSIVTTDT----NYSVQEITDDYDELVERSPETEGGV------
EIF3C_CRYNJ           IPQES-WVTALQEFDQLISILIAEP----DYLVQETVGEYDDLVERTPEVVDGKK-----
E3KG31_PUCGT          LPTEA-WKSARVRLDELLNLLSTET----QFVVQEETVDYDDQEERAPDSDPTK------
EIF3C_ARATH           HMPINVWKKCVLNMLTILDILVKYS-------NIVVDDTVEPD-ENETSKPTDYD-----
F6HLF0_VITVI          HMPINVWKKCVQNMLVILDILVQHS-------NILVDDVVEPE-ENETQKGADYK-----
F4J1N5_ARATH          YMPIDVWKKCVVNMLTILDILVKYY-------NIVVDDTVEPD-EKETSKPAAYD-----
A9RFE0_PHYPA          HMPIAVWKKCVQNVLVILDILAQYP-------NIVMDESSEPEVENETEKGADHD-----
A9SAG5_PHYPA          HMPIAVWKKCVQNVLVILDILAQYP-------NIKMDETSEPEAENETEKGADYE-----
A9SZ44_PHYPA          HMPIAVWKKCVQNILVILDILAQYP-------NIVMDETSEPEVENETEKGADHE-----
Q4U8V4_THEAN          AMTPTEWINTYRIASHLVSELISNP-----KSYLSSEMVNSAQNNTMDEAEKVN------
Q4N1J6_THEPA          AMTPTEWINTYRIASHLVSELISNP-----KSYLSSEMVNSAQNNLMDDLDKANLDKLSA
A7APB4_BABBO          AMTPKQWIDSYRIVSHLIDELRRHP-----HALLSSETIESDDPNGAESPNERD------
Q4YU35_PLABA          YMSFNIWNKTFKYIELILDLLIQNE-----HFYLVSINITEEIAEVTEESNEKE------
Q7RR21_PLAYO          YMSFNIWNKTFKYIELILDLLIQNE-----HFYLVSINITEEIAEVTEESNEKE------
A0A077TJQ4_PLACH      YMSFNVWNKTFKYIELILDLLIQND-----HFYLVSINITEEIAEPTDETNEKE------
Q8I5Y3_PLAF7          YMSFNIWNKVFKYVELILDILIQNE-----NFYLVSINIAEEITEET--TNEKE------
B3LB47_PLAKH          YMSFNIWNKAFKYIEIILDLLIQNE-----SFYLVSINITEEITEEV--INEKE------
A5K0G2_PLAVS          YMSFNIWNKAFKYIELILDLLIQNE-----NFYLVSINITEEITEEV--INEKE------
D0MQP5_PHYIT          VMSVRHWKLVQSNVCTILSLLEKNPDFSLAPLTSEDQADIVRAGREKVTAAQIAAAAAED
Q5CQQ0_CRYPI          CITSGIWSEICDNINILLDLVLLNNKDKRVYISGFQSFISSKDKKKKASGDSSGAGANSG
                            :         :   .                                       

G1MAG9_AILME          -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
H0X7M1_OTOGA          -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_HUMAN           -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_PONAB           -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_BOVIN           -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
G1PSM2_MYOLU          -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_MOUSE           -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_RAT             -----------------------------QPLRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_XENTR           -----------------------------QPLRVRGCILTLIERMDEEFTKIMQNTDPH-
EIF3C_DANRE           -----------------------------QPFRVRGCILTLVERMDEEFTKIMQNTDPH-
H3DCM5_TETNG          -----------------------------QPFRVRGCILTLVERMDEEFTKIMQNTDPH-
EIF3C_AEDAE           -----------------------------APYKIRGCILTAVERLDDEFTKLLKECDPH-
EIF3C_ANOGA           -----------------------------APFKIRGCMLTAVERLDDEFTKLLKECDPH-
EIF3C_DROME           -----------------------------SPFYVRGCPLAAVERLDDEFVKLLKECDPH-
EIF3C_DROPS           -----------------------------APYYIRGCPLAAVERLDDEFTKLLKECDPH-
EIF3C_BOMMO           -----------------------------PPYQVRGCLLTYLERLDDEFTKLLKECDPH-
E9HGP7_DAPPU          -----------------------------RFFSVRGCMLTTVERMDEEFVKILKECDAH-
G4LYI7_SCHMA          -----------------------------EPYRIKASILTVVGLLDVECFKVLQNANGH-
B3RYW2_TRIAD          -----------------------------LPYQVRGCVVTLVERMDDEFTKILQSCDAH-
EIF3C_CAEBR           -----------------------------EEYRIQGSILIAVQRLDGELAKILQNADCH-
EIF3C_CAEEL           -----------------------------QEYRIQGSILIAVQRLDGELAKILQNADCH-
EIF3C_DICDI           -----------------------------GQVAVTGNLLALFEMLDDEFSKSLQSINYP-
F0Z7C0_DICPU          -----------------------------GQVVVHGNLLALFEMLDDEFSKSLQSINYP-
D3BBM5_POLPP          -----------------------------GEVVIRGNLLSLFERLDDEFTKSLQHLHFP-
EIF3C_ASHGO           ------------------------------VRMILGSVFTFVERLDDEFNKSLLNTDPH-
EIF3C_KLULA           ------------------------------VKEILGSIFSMVERLDDEFSKSLLNIDTR-
EIF3C_CANGA           ------------------------------IREILGSLLSFTERLDDEFKKSLLNIDPH-
EIF3C_YEAST           ------------------------------VKRILGSIFSFVERLDDEFMKSLLNIDPH-
EIF3C_CANAL           ------------------------------VKVIFGSITSSIDRLDDELTKSLQHTDPH-
EIF3C_YARLI           ------------------------------VKLIPGSVASLVERVDDEFTKALQFMDPH-
EIF3C_EMENI           -------------------------------FYIPGSIVSYVERLDDELTRSLQHIDPH-
EIF3C_ASPFU           -------------------------------LYIPGSIVSFAERLDDELTRSLQHIDPH-
C0NXA3_AJECG          -------------------------------LKVPGSVVSFVERLDDELTRSLQHIDPH-
C7Z9S9_NECH7          -------------------------------IKVPGSIVSYIERLDDELVRSLQSIDPH-
EIF3C_NEUCR           -------------------------------LKVPGSVVSLIERLDDELTRSLQAIDPH-
EIF3C_SCLS1           -------------------------------FKIPGSIVSFVERLDDELTRSLQHIDPH-
EIF3C_PHANO           -------------------------------FRIPGSVVSFVERLDDELTRSLQHIDPH-
D5G6D6_TUBMM          -------------------------------LKIPGSIVSFVDRLDDELTRSLQHIDPH-
EIF3C_SCHPO           -----------------------------GVIQVQGSVVSFLERLDDEFTRSLQMIDPH-
F4P9G3_BATDJ          -----------------------------QSVVLPGHITSFVDRLDDEFTKSLQSIDPH-
EIF3C_USTMA           -----------------------------DVVAVRGSIISFVDRLDDEFTKSLQNIDPH-
D6RL89_COPC7          -------------------------------VKIRGSIISFVDRLDDEFTRSLQNIDPH-
EIF3C_CRYNJ           -----------------------------QKVLIAGSLISLLESLDSELTKTLQHTDAHE
E3KG31_PUCGT          ------------------------------KLQVRGSISSLLDRLDDEFTKSLQNIDPH-
EIF3C_ARATH           -----------------------------GKIRVWGNLVAFLERVDTEFFKSLQCIDPH-
F6HLF0_VITVI          -----------------------------GTIRVWGNLVAFLERIDVEFFKSLQCIDPH-
F4J1N5_ARATH          -----------------------------GTIRVSGNLVAFLEKIETEFFKSLQCIDPH-
A9RFE0_PHYPA          -----------------------------GPIHVWGNVVALLERIDDELFKSLQCIDPH-
A9SAG5_PHYPA          -----------------------------GSIHVWGNMVAFLERIDDELFKSLQCIDPH-
A9SZ44_PHYPA          -----------------------------GPIHVWGNVVAFLERCDDELFKSLQCIDPH-
Q4U8V4_THEAN          -----NDKVKAFDD---------------RVKTSLGVLSTIVQKLNDELYKGLLYTEVH-
Q4N1J6_THEPA          EKLNNVDKVKMMDD---------------RVKTSLTVLSTIVQKLNDELYKGLLYTEVH-
A7APB4_BABBO          ----PANAGVSREE---------------RIQRSMTILESVVRKLNDELYKGLLYIEVG-
Q4YU35_PLABA          -----------------------------KISKSCKTLISFLAKLDDELLKALLYIDVQ-
Q7RR21_PLAYO          -----------------------------KISKSCKTLISFLAKLDDELLKALLYIDVQ-
A0A077TJQ4_PLACH      -----------------------------KITKSCKTLISFLAKLDDELLKALLYIDVQ-
Q8I5Y3_PLAF7          -----------------------------KIIKSCKTLISFLAKLDDELLKALLYIDVQ-
B3LB47_PLAKH          -----------------------------KISRSCKTLISFLAKLDDELLKALIYIDAQ-
A5K0G2_PLAVS          -----------------------------KISRSCKTLISFLAKLDDELLKALLYIDAQ-
D0MQP5_PHYIT          AEEDLNFVDTLPQAGKK------------GTIKVSGDLAAFVERLSEEYTKALQQTDPH-
Q5CQQ0_CRYPI          MDAHGNSLDGENANTDENSSLGDIVDLKEQDKSTVTFLVSFIERLDGESLKALQLTDVH-
                                                                   . *  : :   .   

G1MAG9_AILME          -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEICRVYLRRILHTYYKFDYK
H0X7M1_OTOGA          -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEICRIYLRRILHTYYKFDYK
EIF3C_HUMAN           -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEVCRIYLLRILHTYYKFDYK
EIF3C_PONAB           -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEVCRIYLLRILHTYYKFDYK
EIF3C_BOVIN           -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEVCRIYLRRILHTYYKFDYK
G1PSM2_MYOLU          -SQEYVEHLKDEAQVCAIIERVQHYLEEK-------GTTEEICRVYLRRILHTYYKFDYK
EIF3C_MOUSE           -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEICQIYLRRILHTYYKFDYK
EIF3C_RAT             -SQEYVEHLKDEAQVCAIIERVQRYLEEK-------GTTEEICQIYLRRILHTYYKFDYK
EIF3C_XENTR           -SQEYVDNLKDEARVCEVIERAQKYLQEK-------GSTEEVCRVYLRRIMHTYYKFDYK
EIF3C_DANRE           -SQEYVDNLKDEGRVCGIIDRLLQYLETK-------GSTEEVCRVYLRRIMHTYYKFDYK
H3DCM5_TETNG          -SQEYVDNLKDEGRVCSIVDRLLSYLENK-------GSTEEICRIYLRRIMHTYYKFDYK
EIF3C_AEDAE           -SNDYVDRLKDEVTVSSVIEQVVKYIERL-------GNDTETCRVYLRKIDHLYYKFDPN
EIF3C_ANOGA           -SNEYVDRLKDEVPVTNIIEQVVTYVERL-------GNEMEICRIYLRKIDHLYYKFDPD
EIF3C_DROME           -SNDYVSRLKDEVNVVKTIELVLQYFERS-------GTNNERCRIYLRKIEHLYYKFDPE
EIF3C_DROPS           -SNDYVSRLKDEMNVVKTIELVLQYFEQC-------GNPNERCRIYLRKIEHLYYKFDPE
EIF3C_BOMMO           -SNEYVERLKDEVRVSALIDRVCQVVERD-------GTPQEICRAYLRKIDHLYYKFDPR
E9HGP7_DAPPU          -SNEYVERLKDETRVTAIIDSLQSYIERQ-------SLPAELCRLYMRKIEHMYYKFDPN
G4LYI7_SCHMA          -ESEYVDRLRDERRVCNIIDRLCVYLEKKE------YPPDALCAAYLHKLEHMYYKFDFE
B3RYW2_TRIAD          -SLEYVQRLKDESIVTAIIKRTQKLVEKNN------FPASDTCKVYLRRIEHMYYKYDTL
EIF3C_CAEBR           -SNDYIEKLKAEKDMCQLIEKAENYVELRNH--LGIFDKHEVCKVYMMRIEHTYYKYQ--
EIF3C_CAEEL           -SNDYIEKLKAEKDMCSLIEKAEKYVELRND--SGIFDKHEVCKVYMMRIEHAYYKYQ--
EIF3C_DICDI           -TKEYLDRLQDEQIILDLGESLQKYYESAG-------NNGAAAKIAIRRIEHIYYKSSNL
F0Z7C0_DICPU          -TKEYLDRLQDEQVILDLGSELQQYYEQAK-------NTESAAKIAIRRIEHIYYKSSNL
D3BBM5_POLPP          -SAEYTARLADEPVLLKIGESVQDYLEQHD-------TSAKSSRAAIRRLEHLYHRA---
EIF3C_ASHGO           -SSDYLDRLRDEQSVYNLILRSQLYLEKVLP-EDTA--SKHLCRSFVRRLDHIYYKTSKL
EIF3C_KLULA           -SSEYMERLRDEQSIYNLIIRSQLYFERVTA-EEHR--DRLLARVFNRRLEHIYYKSDKL
EIF3C_CANGA           -SSDYLERLRDEQNMYNLLLRTQLYMEATIP-EERQ--EQLLARAFVRRLDHIYYKSNKL
EIF3C_YEAST           -SSDYLIRLRDEQSIYNLILRTQLYFEATLK-DEHDL-ERALTRPFVKRLDHIYYKSENL
EIF3C_CANAL           -STEYVERLKDESTIYNLIVRGQAYVESITP-EDVKYKSEQLARIVLRRLEHIYYKPKQL
EIF3C_YARLI           -TTEYVDRLRDETKLYQTLLRVQMYIEHVSD-EKDTL---GLARILVRRVDHLYFKPNNV
EIF3C_EMENI           -TAEYIERLSDEKQLYTNLVRTQIYVEGLTKLEKTELRQDSLNRVVMRRLEHIYFKPSQV
EIF3C_ASPFU           -TAEYIERLSDEKLLYTDLVRAQAYVEGLNEVEKTDPRQDSVNRVVMRRLEHVYFKPSQV
C0NXA3_AJECG          -TAEYIERLSDEQSLYNNIVRTLLYVEVLNKAEKTEARQESVNRVLMRRLEHVYFKPSQV
C7Z9S9_NECH7          -TSEYIERLQDEGALYNIIFRGLLYYEYIRKDDSLETPQDSVNRIVMRRLEHVYFKPAQV
EIF3C_NEUCR           -TSEYIDRLTDEGSLYNTIFRGLLYYEHLRKDASLEVPQESLNRIIQRRLDHVYYKPAQV
EIF3C_SCLS1           -TAEYIERLSDESDLYNNIVRTMLYQEEISKDESLTEPQRSLNRVVMRRLEHVYFKPSAV
EIF3C_PHANO           -TAEYVERLTDEALLYAQLVRALIYVESLKKNASLELPQESLNRVVMRRLEHVYFKPSQV
D5G6D6_TUBMM          -TTEYIDRLSDEGALYTTILRSQLYLERLQRNHNI-PTDESLNRVIMRRLEHLYFKPGQV
EIF3C_SCHPO           -TPEYIDRLKDETSLYTLLVRSQGYLERIG-------VVENTARLIMRRLDRVYYKPEQV
F4P9G3_BATDJ          -STEYIDRLRDETTLYASIVCAVKYAEVTKASS------ENIDLMTMRRVEHLYNKPDVV
EIF3C_USTMA           -TTEYVDRLCDEKKLYETIVLAQGYFE-SQSET------EALSRCTMRRLDHVYAKQDVI
D6RL89_COPC7          -GTEYVDRLKDEKVLYTTICRSQAFYE-KTDPK------DPLARVIMRRLEHIYSKPNAV
EIF3C_CRYNJ           KGDEYIDRLKHEAPLYTTIVKAQTLFE-REQLS------DNIARTVIRRLEHIYAKPDII
E3KG31_PUCGT          -TSEYIERLKDEKELYCTIVRAQSYFE-AVELT------SAVAKAVTRRLEHVYCKPDAV
EIF3C_ARATH           -TREYVERLRDEPMFLALAQNIQDYFERMGD-------FKAAAKVALRRVEAIYYKPQEV
F6HLF0_VITVI          -TREYVERLRDEPLFLVLAQNVQDYLERVGD-------FKAASKVALRRVELIYYKPQEV
F4J1N5_ARATH          -TNDYVERLKDEPMFLALAQSIQDYLERTGD-------SKAASKVAFILVESIYYKPQEV
A9RFE0_PHYPA          -TKDYVERLRDEPLFMTLAQNVQAYVERLGD-------MKAAARVALRRVEHVYYKPQEV
A9SAG5_PHYPA          -TKDYVERLRDEPLFMTLAQNVQAYVERLGD-------MRAAARVALRRVEHVYYKPQEV
A9SZ44_PHYPA          -TKDYVERLRDEPLFMTLAQNVQQYVERLGD-------MRAAARVALRRVEHVYYKPQEV
Q4U8V4_THEAN          -NPDYKTMLAYTIDMLYLLHRTLVYYLKFEK------GNEFAASTALMILDHCHYKDDEI
Q4N1J6_THEPA          -NPDYKTMLAYTIDMLYLLHRTLVYYLKFEK------GNEFAATTALMILDHCHYKDDEI
A7APB4_BABBO          -SDDYNTMLVYNVNMLYLLHKTLLYCLSKGKE-----TITHAANIAIIMLEHLHYKDDVV
Q4YU35_PLABA          -AEEYRKRLGKTVHMISLLYKGYKYVKYTKN------LPDLAIYISTRILDHLYYKPELP
Q7RR21_PLAYO          -TEEYRKRLGKTVHMISLLYKGYKYVKYTKN------LPDLAIYISTRILDHLYYKPELP
A0A077TJQ4_PLACH      -TEEYRKRLGKTVHMISLLYKGYKYVKHTKN------LPDLAIYISTRILDHLYYKPELP
Q8I5Y3_PLAF7          -TEEYRKRLGKTIHMIGLLKKGYNYVKCLKN------MPDLAIHISSRILEHMYYKPEML
B3LB47_PLAKH          -TEEYRRRLGKTIHMIALLYKGYNYVKFTKK------MPELAIFISTRILEHMYYKPEAL
A5K0G2_PLAVS          -TEEYRRRLGKTVHMIGLLYKGYNYVKFAKK------MPDLAIFISTRILEHMYYKPEAL
D0MQP5_PHYIT          -TSDYVSRLYDENLLIEVAERVQTFYARKKD-------FQRAATMALVRAELIYYKHDSV
Q5CQQ0_CRYPI          -SSEYKDRLVQSLHLLALLWRCYKICEERG-------YYDLVSSLSVHLINQLHFKNDSL
                         :*   *     .                                      : :    

G1MAG9_AILME          AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
H0X7M1_OTOGA          AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
EIF3C_HUMAN           AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
EIF3C_PONAB           AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
EIF3C_BOVIN           AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
G1PSM2_MYOLU          AHQRQLTLPEGSSKSDQDQAENEGE-----------------------------------
EIF3C_MOUSE           AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
EIF3C_RAT             AHQRQLTPPEGSSKSEQDQAENEGE-----------------------------------
EIF3C_XENTR           AHQRQLSTGQ-ESKSEQDQAENEAE-----------------------------------
EIF3C_DANRE           AHRRSLGLQG-ETKSEQDQEESEGD-----------------------------------
H3DCM5_TETNG          AHRRSLGLQG-ESKSEQDQEEAEGE-----------------------------------
EIF3C_AEDAE           VLKKK-----------KKELPASTL-----------------------------------
EIF3C_ANOGA           VLKKR-----------KGQLPANTI-----------------------------------
EIF3C_DROME           VLKKK-----------RGELPATTS-----------------------------------
EIF3C_DROPS           VLKKK-----------RGELPATTA-----------------------------------
EIF3C_BOMMO           AVRK--------------DLPPTEE-----------------------------------
E9HGP7_DAPPU          TIKLL-----------NDETKIEKD-----------------------------------
G4LYI7_SCHMA          WGRKV---------EASSMEEVGLH-----------------------------------
B3RYW2_TRIAD          LAKTTSKSENNDDDEEKSEPKEEEEGTN--------------------------------
EIF3C_CAEBR           -------------------DQNVGE-----------------------------------
EIF3C_CAEEL           -------------------DQNEED-----------------------------------
EIF3C_DICDI           KNNII-----------PSTMPLSEQ-----------------------------------
F0Z7C0_DICPU          KNTIV-----------PNTMSLDEQ-----------------------------------
D3BBM5_POLPP          -----------------DPTEFEQN-----------------------------------
EIF3C_ASHGO           VDIVE----------RAAWASVPANS----------------------------------
EIF3C_KLULA           ISIME----------TVAWKQIREGT----------------------------------
EIF3C_CANGA           ISIIE----------NSAWKAVPSSY----------------------------------
EIF3C_YEAST           IKIME----------TAAWNIIPAQF----------------------------------
EIF3C_CANAL           IKANE----------EEAWRNIEYNS----------------------------------
EIF3C_YARLI           INMTE----------QIAWGGVKGDS----------------------------------
EIF3C_EMENI           ITILE----------EGTDKALPSEL----------------------------------
EIF3C_ASPFU           ITILE----------DATWKSLPSEL----------------------------------
C0NXA3_AJECG          VNILE----------ENTWTTLPAKL----------------------------------
C7Z9S9_NECH7          VKTFE----------ENCWKTVGDSV----------------------------------
EIF3C_NEUCR           VKILE----------ENAWKQVSAEA----------------------------------
EIF3C_SCLS1           IKILD----------ENCWKAIPAEL----------------------------------
EIF3C_PHANO           VTIME----------ANSWKAVPETL----------------------------------
D5G6D6_TUBMM          IITVE----------ENAWKLIPTEL----------------------------------
EIF3C_SCHPO           IRANE----------EVAWRSFPPTF----------------------------------
F4P9G3_BATDJ          IKTVE----------DSV------------------------------------------
EIF3C_USTMA           IKALE----------STLGEAAKTFE----------------------------------
D6RL89_COPC7          VQALE----------SAA--ASDVQV----------------------------------
EIF3C_CRYNJ           IEHFE----------SKATQAAAGLK----------------------------------
E3KG31_PUCGT          IQPLE----------AAVPELPSKIF----------------------------------
EIF3C_ARATH           YDAMR----------KLAELVEEEE----------------------------ETEEAKE
F6HLF0_VITVI          YDAMK----------NLAEQTEDTEN--------------------------GESEAGEE
F4J1N5_ARATH          FDAMS----------KLADEEIEEAN--------------------------EESGSSSS
A9RFE0_PHYPA          YEAMR----------KLSELQGR-------------------------------------
A9SAG5_PHYPA          YEAMR----------KLSELQSRD-------------------------------GEAVM
A9SZ44_PHYPA          YEAMR----------KLSELQSRSGAAAEAGVEGE-----------------EEDGDVAM
Q4U8V4_THEAN          SAKIW----------ELVRNKIK-------------------------------------
Q4N1J6_THEPA          STKIW----------ELVRNKIK-------------------------------------
A7APB4_BABBO          SGKIW----------ELVRQKVT-------------------------------------
Q4YU35_PLABA          FKQIW----------GFVKQGKE------------------------YVEKQQTGTKEVD
Q7RR21_PLAYO          FKQIW----------GFVKNGKE------------------------YVEKQQTGTKE--
A0A077TJQ4_PLACH      FKQIW----------GFVKHGKE------------------------YVEKEGDNQKK--
Q8I5Y3_PLAF7          FKQIW----------TYLMNGKE------------------------MLSDSLNNSNNIA
B3LB47_PLAKH          FMQVW----------KFVTNGKE--------------NNSLSMNAENSGNNNVNGKVEHS
A5K0G2_PLAVS          FMQIW----------NFVTSGKDGSTPLVDAVGGSSPSGSGAANQSDHTNQNGDAKTDQD
D0MQP5_PHYIT          AAALYEAQAKRAKYGDPVFLHPACSSGN-------------------------------S
Q5CQQ0_CRYPI          AIKVWEFVRQILEKTVNSSLSSEELSAN--------------------------------
                                                                                  

G1MAG9_AILME          ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
H0X7M1_OTOGA          ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_HUMAN           ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_PONAB           ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_BOVIN           ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
G1PSM2_MYOLU          ---------------------------DSALLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_MOUSE           ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_RAT             ---------------------------DSAVLMERLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_XENTR           ---------------------------DSAILMDRLCKYIYAK--DRTDRIRTCAILCHI
EIF3C_DANRE           ---------------------------DSAIIMDRLCKFIYAK--DRTDRIRTCAILCHI
H3DCM5_TETNG          ---------------------------DSAVIMDRVCKFIYAK--DRAGGIRTCAILCHI
EIF3C_AEDAE           ---------------------------TSVDEMDRLCRFVYAK--DQTDRLRTRAILSHI
EIF3C_ANOGA           ---------------------------TSVEEMDKLCRYIYAK--DQTDRLRTRAILSHI
EIF3C_DROME           ---------------------------TSVDVMDKLCKFIYAK--DDTDRIRTRAILAHI
EIF3C_DROPS           ---------------------------TSVDVMDKLCKFIYAK--DDTDRIRTRAILAHI
EIF3C_BOMMO           ---------------------------TTIKKMERYCKYIYAH--DETDRLRTRAILSHI
E9HGP7_DAPPU          ---------------------------TTLTVMDRLCRYIYVN--DKEERIRPRAMLCHI
G4LYI7_SCHMA          ---------------------------PNTLVIQKLCEYIYLN--DRTDRLRTRAILCHI
B3RYW2_TRIAD          ---------------------------NSKEEMARLCNYIYKR--DQTERIRTRAMLCQT
EIF3C_CAEBR           ----------------------------VAKTMDYLCNKIYTL--DDEKRLRQRAMLCHV
EIF3C_CAEEL           ----------------------------AGKLMDYLCNKIYTL--DDEKRLRQRAMLCHV
EIF3C_DICDI           -----------------------------ITLMSKLSSFVYKF--GD-ERLNARTILCNI
F0Z7C0_DICPU          -----------------------------TQLMSKLSSFIYKF--GD-ERLNARTILCNI
D3BBM5_POLPP          -----------------------------DKLIKRLSSYIYQH--GD-ERLNARTILCNI
EIF3C_ASHGO           --------SS---KYITYSD----DPDYNFKLVNTLCTVVS----SEQEMLKRRATLYQI
EIF3C_KLULA           --------ASLESSFVRLNESDSADADYNFKVISELSDFLIKQ-KSNNVFNYRKGTLYKT
EIF3C_CANGA           --------KS---KYIPFSG--NADEEYCSQLVEGLSKSLA---NQDNVFLQKRATLSHI
EIF3C_YEAST           --------KS---KFTSKDQ--LDSADYVDNLIDGLSTILS---KQNNIAVQKRAILYNI
EIF3C_CANAL           --------SIVS------------KGSSVDEVIDQLTEFLQK--QQKNKTYGKHAILFSI
EIF3C_YARLI           --------KATP----RPTEKDLTSSTYPTTLISNMCSVLYK---QSNTVFRTKAMLAHV
EIF3C_EMENI           --------ETSITTR--------GNS-DAQTLVQTLCNYLFRN-SDG--ILRARAMLAQI
EIF3C_ASPFU           --------DSSITPR--------ASSGNVENLVLSLCNYLFKY-SDG--IIRARAMLCQI
C0NXA3_AJECG          --------DSNITPRK-------NGSTDVPALVQTLCNYLFAH-SDG--IIRARAMLCQI
C7Z9S9_NECH7          --------ESVITPR--------DQAQNAGNLVNVLCNYLFSN-SDG--IIRARAMLCQV
EIF3C_NEUCR           --------DSEITPR--------SQSGDAGKLINILSNYLFEN-SEG--IIRARAMLCQI
EIF3C_SCLS1           --------DSTITPR--------GSVQDAKTLVNILCNYLYIN-TEGEGLTKARAMLCQI
EIF3C_PHANO           --------DSEVTPR--------AISNDTTSLVQTLSTYLFQN-SEG--IIRARAMLCQI
D5G6D6_TUBMM          --------NSVISPRT-------IANTDATDLLHTLATYLYKH-DAT--VIRTRAMLYHI
EIF3C_SCHPO           --------DLTITPR--------ATTTTPDILIHSLCVYLYNN-GVS--LLRTRAMLCHI
F4P9G3_BATDJ          --------RKVYPELVKILES-------PVDLVSVLCRGLYKS---SIGRIRTRALLCHV
EIF3C_USTMA           --------SKLFPSAVRVAEQD-----GPAVLVRALCTYLYQARGVQAERPRTRAVLCHI
D6RL89_COPC7          --------KPTMSLEIQGDTT-------A--LIHALCAHLYKS---GNSLLRTRAMLSHI
EIF3C_CRYNJ           --------SEITPFDVKRDAS-------G--VIHDLAVFIYQS---DAPVLRARAILYHI
E3KG31_PUCGT          --------TPTSSPADSASYS-------SSELIHALCAYLYKT---DNSLLQTRAALCQI
EIF3C_ARATH           ----ESGPPTSFIVVPEVVPRKPTFPESSRAMMDILVSLIYRN---GDERTKARAMLCDI
F6HLF0_VITVI          PRVEESRGPPAFVVTPEVVPRKPTFPENSRTLMDILVSLIYNH---GDERTKARAMLCDI
F4J1N5_ARATH          ----------SFIVVAEIVPRKPTFAKSSRAMMDTLVSFIYKN---GDERTKARAMLCDI
A9RFE0_PHYPA          -SVTEAKGPVSFVITPEIVPRRPSFPSVNRKLMDQLVTLIYKH---GDERTKARAMLCDI
A9SAG5_PHYPA          KASTETKGPAPFVLTPEIVPRRPSFPSVNRKLMDQLVTLIYKH---GDERTRARAMLCDI
A9SZ44_PHYPA          KGVTETKGPASFVVTPEIVPRRASFPSVNRKLMDQLVTLIYKY---GDERTKARAMLCDI
Q4U8V4_THEAN          ----------------DKKQTEKFFPNENKKPSDLVTELVNFVFVYGTQRDKIRACLHLA
Q4N1J6_THEPA          ----------------DKKQTERFFPNENKKPSDLVTELVNFVFVYGTQREKIRACLHLA
A7APB4_BABBO          ----------------DEEQFKVYFPDDNKKASDIVEELAYFVFEHGSPREKIRACLYLA
Q4YU35_PLABA          NTNQSDNQKK--------EESNEST-DSDESPKDVVEKFVCEIFEHGTKQQRLRALLQLS
Q7RR21_PLAYO          -------------------ESNEST-DSDESPKDVVEKFVCEIFEHGTKQQRLRALLQLS
A0A077TJQ4_PLACH      ------------------EETNEST-DADESPKDVIEKFVCEVFEHGTKQQKLRALLQLS
Q8I5Y3_PLAF7          SKEDGQGKKKKRIDNDLFDEKLINN-DSINPPK-IIEEYVYEIFEFGTKQQKVKALLQLS
B3LB47_PLAKH          AKTNGDSDKQPNGDATNDAEKMPTKGEDQISPKQIVEKYVYEIFEHGTKQQKVKALLQLS
A5K0G2_PLAVS          LQTNGDCDKQPSGGAPNGAEKEPAKGDDHISPKQIVEKYVYEIFEHGTKQQKVKALLQLS
D0MQP5_PHYIT          IKTKEFDVSIVHPASIMGQPTVDVTPVDAEKLLRDVCRFVFQH---GDIRAKTRAMLCRI
Q5CQQ0_CRYPI          ---------SDSSNTDCAGKIPDIPVPKKFKPSELITELVGNVYKYGDSKDKLRVLIQHV
                                                                              :   

G1MAG9_AILME          YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
H0X7M1_OTOGA          YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
EIF3C_HUMAN           YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
EIF3C_PONAB           YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTMDAHNAL
EIF3C_BOVIN           YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
G1PSM2_MYOLU          YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
EIF3C_MOUSE           YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
EIF3C_RAT             YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNAL
EIF3C_XENTR           YHHALHNRWFQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIRDAHNAL
EIF3C_DANRE           YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNAL
H3DCM5_TETNG          YHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNAL
EIF3C_AEDAE           FHHALHDNWFQARDLVLMSHLQETIHHSDPPTQILYNRTMANLGLCAFRHGNVKDAHQCL
EIF3C_ANOGA           FHHALHDNWFQARDLVLMSHLQETIHHSDPATQILYNRMMANLGLCAFRHGNIKDAHLCL
EIF3C_DROME           YHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQGNVKDAHHCL
EIF3C_DROPS           YHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQENVKDAHHCL
EIF3C_BOMMO           YHHALHDNWFQARDLLLMSHLQETVQHSDPSTQILYNRTMANLGLCAFRRGNVKEAHGCL
E9HGP7_DAPPU          YHHALHDEWYKARDLMLMSHLQETVHLLDPSTQILYNRTMVQLGLCAFRHGHIKEAHHAL
G4LYI7_SCHMA          YHLALYNQWFKARDLMLMSDLQMSIEHADQSTMILYNRAMVQLGLCAFRQSHIRDAHNAL
B3RYW2_TRIAD          YHHAIHDRWTDARDLMLMSHLQESIQFSDIPTQVLYNRTMVQLGLCAFRHGIIKNAHNCL
EIF3C_CAEBR           YFLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGL
EIF3C_CAEEL           YYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGL
EIF3C_DICDI           YFNAINNKFHEARDMMLMSHLQDNPTLMDVSTQILFNRAMVQLGLCAFRCGYIQEAQNCV
F0Z7C0_DICPU          YFSAINNKFHEARDLMLMSHLQDNPTLMDVSTQILFNRAMVQLGLCAFRSGHIAEAQQCV
D3BBM5_POLPP          YFNAIHNRFHEARDMMLMSHLQDNPTVMDILTQILFNRAMVQLGLCAFRKGYIQEAQQCL
EIF3C_ASHGO           YYYALNNQFSKAKEMLVQSNVRNSINSQDPTIQILFNRVVVQLGLAAFKLCLVEDCHQIL
EIF3C_KLULA           YYIALNQEYAPAKKIMLSSDIAKFISGSDAALQILYNRCVIQLGLAAFKAGLINECHQVL
EIF3C_CANGA           YYTALNGEFEVAKELLLKTKVQSNINKSDPSLQILFNRVVVQLGLSAFKLCKIEECHQIL
EIF3C_YEAST           YYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQIL
EIF3C_CANAL           YYYAVNSQYEKAKELFLRSQFYSNINSAESSLQVQYNRALVQLGLSAFRAGSIEESHKIL
EIF3C_YARLI           YHYALNDEYYKARDMFLMSHLQSSIASAEPQLQVLFNRTLVQLGLCAFRSGLIAEAQQSL
EIF3C_EMENI           YFLALHDQYYRARDLMLMSHLSENIANFDVSSQILFNRTLVQIGLCAFRAGLIYEAQNTL
EIF3C_ASPFU           YFLALHDQYYRSRDLMLMSHLTENISNFDVSTQILFNRTLVQIGLCAFRSGLIYEAQNTL
C0NXA3_AJECG          YFLALHDKYHRARDLMLMSHLTENISNFDVSTQILFNRTLVQIGLCAFRAGLIYEAQNTL
C7Z9S9_NECH7          YFLALHGEYYKARDMMLMSHLQENIPNFDVQSQILYNRTLVQVGLCAFRKGLVYDAQNTL
EIF3C_NEUCR           YFLALHDEYYKSRDLMLTSHLQETIANFDIATQILYNRTLVQVGLCAFRKGLVYDAQNTL
EIF3C_SCLS1           YFEALHDNYYKARDMMLMSHLQETINSFDVHSQILFNRTLVQVGLCAFRAGLVYEAQTTL
EIF3C_PHANO           YFLALHDQYYKARDMMLMSHLQETISNFDVNTQILFNRALVQVGLCAFRAGLVYESQNSL
D5G6D6_TUBMM          YYYALHNQFYKARDMLLMSHLQENIHVADVGTQILYNRTLVQVGLCAFRAGLIYEAQTSL
EIF3C_SCHPO           YHEALQNRFYKARDMLLMSHLQDSVHAADIATQILHNRTMVQIGLCAFRNGMVQETQYAL
F4P9G3_BATDJ          YHLALHDHYHEARDMILMSHVQETISQTDIHMQVLFNRTMVQIGLCAFRAGLFRDAATAL
EIF3C_USTMA           YFHALHADYHVARDMFLMSHLQDAIQLADVATQILYNRVVVQIGICAFRNGLIKESQVAL
D6RL89_COPC7          YHHALYNNFYTARDMLLMSHLQESIHSADVATQILYNRTVVQLGLCAFRLGLIKEAQSTL
EIF3C_CRYNJ           FNQALHGRYHQARDLLLMSHLQDTISHADVTTQILYNRAVMQVGLAAFRLGFIPECQTIL
E3KG31_PUCGT          FNYGLHDEYYRARDLLLMLHLQETVHGADVGTQIMYNRTVVQLGLSAFRLGLIKESQSIL
EIF3C_ARATH           NHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGLCAFRAGMITESHSCL
F6HLF0_VITVI          YHHAILDEFSTARDLLLMSHLQDNVQHMDISTQILFNRAMAQLGLCAFRVGLIAEGHGCL
F4J1N5_ARATH          YQHALMDNFVTARDLLLMSHLQENIQHMDISTQILFNRTMAQLGLCAFRVGMITESHSCL
A9RFE0_PHYPA          YQHAISDEFYTARDLLLMSHLQESVMNMDISTQILFNRTMAQLGLCAFRQSLVTEAHNCL
A9SAG5_PHYPA          YQHAISDEFYTARDLLLMSHLQESVMNMDISTQILFNRAMAQLGLCAFRESLVTEAHNCL
A9SZ44_PHYPA          YQHAISDEYYTARDLLLMSHLQDSVMNMDISTQLLFNRAMAQLGLCAFRESLVMEAHNCL
Q4U8V4_THEAN          YNKSLHGHYYEAKDLLAASNLTEVASETDISTQILVNRNLAQLGICAFRAGLISEAHSYL
Q4N1J6_THEPA          YNKSLHGHYYEAKDLLAASNLTDVASETDISTQILVNRNLAQLGICAFRAGLISEAHSYL
A7APB4_BABBO          FNKSLHGLYYEAKDLLLTPNIHDLAMETSITTQILLNRNIAQLGICAFRKGLISEAHSYL
Q4YU35_PLABA          YNKSLYDEFLEAREILNVGNIHELAISSDVQTQILYNRNLIQLGLCAFRHGRIYEAHCCL
Q7RR21_PLAYO          YNKSLYDEFLEARELLNVGNIHELAISSDVQTQILYNRNLIQLGLCAFRHGRIYEAHCCL
A0A077TJQ4_PLACH      YNKSLYDEFLEAREILNVGNVHELAISSDVQTQILYNRNLIQLGLCAFRHGRIYEAHCCL
Q8I5Y3_PLAF7          YNKSLYDEYLEAKELLNVANVHELAMNSDIQTQILYNRNLIQLGLCAFRHGKIYEAHCCL
B3LB47_PLAKH          FHRSLHDEFLEAKELLNVSNVHELALSSDTQTQILYNRNLIQLGLCAFRHGKIFEAHCCL
A5K0G2_PLAVS          FHRSLHDEFLEAKELLNVANVHELALSSDMQTQILYNRNLIQLGLCAFRHGKIFEAHCCL
D0MQP5_PHYIT          YHHALHDRFHEARDLLLMSHIQDNITDADIPTQILFNRMMAQLGLCAFRCGLIWEAHACL
Q5CQQ0_CRYPI          YNMALHDNYNEAVTLFQSIGVYDMALGSDVNIQILYNRSLVQLGLSAFRLGQISEAQQLL
                         .:   :  :  :.    .       .    :  ** : ::*:.**:     :    :

G1MAG9_AILME          LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
H0X7M1_OTOGA          LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_HUMAN           LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_PONAB           LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_BOVIN           LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
G1PSM2_MYOLU          LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_MOUSE           LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_RAT             LDIQSSGRAKELLGQGLLLRSLQE-RNQEQEKVERRRQVPFHLHINLELLECVYLVSAML
EIF3C_XENTR           LDIQSSGRAKELLGQGLLMRTMQE-RNQEQEKIEKRRQIPFHMHINLELLECVYLVSAML
EIF3C_DANRE           LDIQSSGRAKELLGQGLLMRNMQE-RNAEQEKIEKRRQVPFHMHINLELLECVYLVSAML
H3DCM5_TETNG          LDIQSSGRAKELLGQGLLMRNMQE-RNAEQEKIEKRRQVPFHMHINLELLECVYLVSAML
EIF3C_AEDAE           VDLMMTGKPKELLAQGLVPQRQNE-RSLEQEKVEKQRQMPFHMHINLELLECVYLVSAML
EIF3C_ANOGA           VDLMMTGKPKELLAQGLVPQRQHE-RSLEQEKIEKQRQMPFHMHINLELLECVYLVSAML
EIF3C_DROME           VDLMVTGKPKELLAQGLLPQRQHE-RSAEQEKIEKQRQMPFHMHINLELLECVYLVSAML
EIF3C_DROPS           VDLMVTGKPKELLAQGLLPQRQHE-RSAEQEKIEKQRQMPFHMHINLELLECVYLVSAML
EIF3C_BOMMO           AELMMTGKPKELLAQGLLPQRQHE-RSKEQEKIEKQRQMPFHMHINLELLECVYLVSAML
E9HGP7_DAPPU          LDIQSSGRAKELLAQGLLLQRQHE-RTSEQEKIEKQRQMPFHMHINLELLECVYLVSAML
G4LYI7_SCHMA          ADMIGSNRIRELLAQGLHTQSRYE-KTTEEEKREQALQMPYHMYINIDLIECVYLVSAML
B3RYW2_TRIAD          VELQVTNRVRELLAQGFS-QRQSD-KTKDQEKLERQRQIPFHMHINTELIECCYLTSAML
EIF3C_CAEBR           SEIQNTQRAKELLAQAVG-TRPHE-KTAEQEKIDRSRQVPYHMHINVELMECVYLICSML
EIF3C_CAEEL           SEIQNTQRAKELLAQAVG-TRQHE-KTAEQEKIDRSRQVPYHMHINVELMECVYLICSML
EIF3C_DICDI           VEF--SGLRKDLLAQGLSVQSKTAEKDTVREVEETTRILPAHMWIPIDLIETVNLISGML
F0Z7C0_DICPU          VEF--SGLRKDLLAQGLSVQSKTVEKDTVRELEETTRMLPAHMWIPIDLIETVNLISGML
D3BBM5_POLPP          AEF--SGLRKELLAQGASMHPKYQEKDPLKEIEEKQRILPGHLHIAIDVIETVNLLSGML
EIF3C_ASHGO           NEVSTASHLRDIMGQQSLQRVSNNISSNGTVTPTEMLCLPFHQHINLDLIDAVFMTCSLL
EIF3C_KLULA           NGLCINPHLREILGQQSLQRANAN-SNVVQGAPVEQLCLPFHQHINLDLIDTVYMTCSLL
EIF3C_CANGA           NELLASSHLREILGQQSLQRIASNSSSSSSSEDREKQCLPYHQHINLDLVDLVFMTSSLL
EIF3C_YEAST           NDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQHINLDLIDVVFLTCSLL
EIF3C_CANAL           NEIVNSQRSKELLGQGFNSKFPNQATVLER-----QKLLPFHQHINLELLECVFMTCSLL
EIF3C_YARLI           QEVCSSPRLKELLGQGLAKYAQAGVVDKQR-------VLPFHTHINLELLECVFLCSSLL
EIF3C_EMENI           SEICGSGRQKELLAQGIILQRYSTVSPEQERLER-QRQLPFHMHINLELLECIYLTSSMF
EIF3C_ASPFU           SEVCGSGRQKELLAQGIIMQRYSTVSPEQERLER-QRQLPFHMHINLELLECIYLTSSMF
C0NXA3_AJECG          SEVCGSGRQKELLAQGIIMQRYSSVSPEQEKLER-QRQLPFHMHINLELLECIYLTSSMF
C7Z9S9_NECH7          QEICGSGRQKELLAQGVMMQRYNQVSPEQERLEK-QRQLPFHMHINLELLECVYLTCSML
EIF3C_NEUCR           QEICGSGRQKELLAQGVMIQRYSQVTPEQERLEK-QRQLPFHMHINLELLECVYLTCSML
EIF3C_SCLS1           QEICGSGRQKELLAQGVMIQRYNQVTPDQERLEK-QRQLPFHMHINLELLECVYLTCSML
EIF3C_PHANO           QEICGSNRQKELLAQGLQMQRYSQISPEQERLER-QRQLPFHMHINLELLECVYLTCSML
D5G6D6_TUBMM          QEICGTGRLKELLAQGVQIQRYSQVTPEQERLER-QRQLPFHQHINLELLECAYLTCSML
EIF3C_SCHPO           QDISTTGRVKELLGQGIQAPKFGQFTPDQDRLDK-QLVLPFHMHINLELLECVYLTCSML
F4P9G3_BATDJ          QDIASSGKTRELLAQGIQQPKYAAEKTAEQERMERQRQLPFHMHVNLELLECVYLVSSML
EIF3C_USTMA           QEIFATGRVKELLAQGVQKQNQFSTVTPEQEKLERQRQLPFHMHINLELLECIYLISSML
D6RL89_COPC7          LEIFTTQRVKELLAQGVHQQ-RFQTLTPEQEKAEKQRQLPFHMHINTELLEAAFLVSSML
EIF3C_CRYNJ           SEMFSTLRQKELLAQSVQRY-NIQ-LSPEQELLEKRRLLPFHMHLNVELLEAAYLTSCML
E3KG31_PUCGT          QDIFASQRVKELLAQGVQAQ-RYSQLTPEQDKIERQRQLPYHMHINLELLECAYLVSSML
EIF3C_ARATH           SELYSGQRVRELLAQGVSQSRYHEKTPEQERMER-RRQMPYHMHLNLELLEAVHLICAML
F6HLF0_VITVI          SELYSGGRVKELLAQGVSQSRYHEKTPEQERIER-RRQMPYHMHINLELLEGVHLICAML
F4J1N5_ARATH          SELYSGNRVRELLGQGVSQSRDHEKTTEQMLMER-RTQIPYHMNINLELLEAVYLTCAML
A9RFE0_PHYPA          SELYAGGRVKELLAQGVQQSRYHEKNPEQEKLER-RRQMPFHMHINLELLEAVHLITAML
A9SAG5_PHYPA          SELYAGGRVKELLAQGVSQSRYHEKNPEQEKLER-RRQMPFHMHINLELLEAVHLITAML
A9SZ44_PHYPA          SELYAGGRVKELLAQGVQQSRWHEKNPEQEKLER-RRQMPFHMHINLELLEAVHLVTAML
Q4U8V4_THEAN          MDMCLQNRHKELLAQGLSNVKNME-KTPEQERAEKRRLLPYHMHISIELIESVNYICALL
Q4N1J6_THEPA          MDMCVQNRHKELLAQGVSNLKNVE-KTPEQERAEKRRLLPYHMHISIELIESVNYICALL
A7APB4_BABBO          MDLCSQNRHKELLAQGLSMVKGHE-KPPEQERAEKRRLLPYHMHLNIELIETVNNICACL
Q4YU35_PLABA          VEICSQNKHRELIAQGISTLKNQE-KTIEQERTEKRRLLSFHMHISIELIECVNNICAML
Q7RR21_PLAYO          VEICSQNKHRELIAQGISTLKNQE-KTIEQERTEKRRLLSFHMHISIELIECVNNICAML
A0A077TJQ4_PLACH      VEICSQNKHRELIAQGISTLKNQE-KTIEQERTEKRRLLSFHMHISIELIECVNNICAML
Q8I5Y3_PLAF7          MEICSQNKHKELIAQGISNLKNQE-KTLEQERAEKRRLLSYHMHISIELIECVNNICAML
B3LB47_PLAKH          GEICSQNKHRELIAQGVSNLKNQE-KTLEQERAEKRRLLSFHMHISIELIECVNNICAML
A5K0G2_PLAVS          GEICSQNKHRELIAQGVSNLKNQE-KTLEQERAEKRRLLSFHMHISIELIECVNNICAML
D0MQP5_PHYIT          SEICTGSRTKELLAQGLQSFRYGE-RDLEQERLERRRQVPYHMHINLDLLETCHLVSAML
Q5CQQ0_CRYPI          SEICMPNRNRELLAQGMSNMKSQE-RTPEQERAEKRRLLPYHMHLSLEVIDCIYLICSML
                        .      ::::.*                       :. *  :  ::::        :

G1MAG9_AILME          LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
H0X7M1_OTOGA          LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_HUMAN           LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_PONAB           LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_BOVIN           LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
G1PSM2_MYOLU          LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_MOUSE           LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_RAT             LEIPYMAAHESDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_XENTR           LEIPYMAAHEFDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_DANRE           LEIPYMAAHEFDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
H3DCM5_TETNG          LEIPYMAAHEFDA----------RRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASK
EIF3C_AEDAE           LEIPYMAAHEFDA----------RRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAK
EIF3C_ANOGA           LEIPYMAAHEFDA----------RRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAK
EIF3C_DROME           LEIPYIAAHEFDA----------RRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAK
EIF3C_DROPS           LEIPYIAAHEFDA----------RRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAK
EIF3C_BOMMO           IEIPYMAAHEFDA----------RRRMISKTFYQNLRASERQALVGPPESMREHAVAAAR
E9HGP7_DAPPU          IEIPYMAAHESDA----------RRRMISKSFHHQLKVSERQAVTGPPESMREHVVAASK
G4LYI7_SCHMA          LEIPNLAAHETDL----------RWRPISKPFHLALRVHDRAALVGPPETPRDHVLAAAK
B3RYW2_TRIAD          LEIPYMAAHEYN-----------RRRLISKNFHFQLRNSERQTLVGPPENMREQVIAAAH
EIF3C_CAEBR           LEIPHMASCEFEM----------RRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASK
EIF3C_CAEEL           LEIPHMASCEFEM----------RRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASK
EIF3C_DICDI           IAVPQNAYRPFDN----------KFKT-CKFYQRHMDSVDRQIFIAPSETSKDIIYQASK
F0Z7C0_DICPU          IAVPQNAYRPFDN----------KFKT-CKFYQRHMDSVDRQIFIAPSETSKDIIYQASK
D3BBM5_POLPP          IAVPQTAARPFDS----------KLKT-CKFFQRHMDHLDKQVFVPPPESFKDVIYASSK
EIF3C_ASHGO           IEIPHMAAFYSGIK-------VKRIPYSQKSIRRALEHYEKSSFQGPPETLRDHVIHAAK
EIF3C_KLULA           LDVPHMAAYYSGIK-------VKRIPVFQKSIRRILESSEKAIFHGPPETLRDHILYAAK
EIF3C_CANGA           IEIPQMTAYLTGIK-------TKKVPVYQKSVRRLVESFDKSFFHGPPESIKEHVLYAAK
EIF3C_YEAST           IEIPRMTAFYSGIK-------VKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAK
EIF3C_CANAL           IEIPTLAAIANNHKD------SKRKNASLKSFKSKLDFHDRQFFTGPPESIKDHIVHASI
EIF3C_YARLI           MEIPFMAAHNTSID--------AKKKVISKLFRRMLDYHERQVFCGPPENTRDHIMQAAK
EIF3C_EMENI           LEVPLMAQTSSSP--------EMKRRVISKTFRRMLDYNERQVFTGPAENTRDGVIMSAK
EIF3C_ASPFU           LEVPLMAQTSSSP--------EMKRRVISKTFRRMLDYNERQVFTGPPENTRDGVIMSAK
C0NXA3_AJECG          LEVPLMAQTSSSP--------ELKRRIISKTFRRMLDYNERQVFNGPPENTRDGVIMSAK
C7Z9S9_NECH7          LEIPLLAQTGSSP--------DVKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQASK
EIF3C_NEUCR           LEIPLLAQTGSSP--------DVKKRIISKTYRRMLEYHERQIFTGPPENTRDHVMQASK
EIF3C_SCLS1           LEIPLFAQTGSSP--------DIKKRIISKTYRRMLEYHERQIFTGPPENTRDHVMQASK
EIF3C_PHANO           LEIPLLAQLGSSP--------DLRKRVISKTYRRLLEYHERQIFTGPPENTRDHVMQASK
D5G6D6_TUBMM          LEIPALAASGSSP--------DMKKRVISKTFRRMLEYHERQIFTGPPENTRDHVMQSAK
EIF3C_SCHPO           MEIPAMAAASSTAS-------DSRKRVISRPFRRMLEYIDRQLFVGPPENTREYIMQASK
F4P9G3_BATDJ          LEVPNMALHAHES----------RRKVTSKAFRRMLDFNDRQIFIGPPENVRDHIMAAAK
EIF3C_USTMA           LEVPNMALAGNDPE--------LRKRVISRPFRRMLDYTDRQVFSGPPENTRDHIMQACK
D6RL89_COPC7          VEIPLLASIDSE-E--------QRRKTISKPFRRLLDFADRQVFTGPPESTRDHIMQASK
EIF3C_CRYNJ           VEIPLLASVDTE-E--------QRRRVTSKTFKRLLDMADRQAFMGPPENTRDHIIKASQ
E3KG31_PUCGT          LEIPNLAQAGNDAE--------LKKRQISRTFRRMFDYAERQVFTGPPENKRDHIMQASK
EIF3C_ARATH           LEVPNMAANSHDAK----------RRVISKNFRRLLEISERQAFTAPPENVRDHVMAATR
F6HLF0_VITVI          LEVPNMAANTHDAK----------RKVISKTFRRLLEVSERQTFTGPPENVRDHVMAATR
F4J1N5_ARATH          LEVPNMAANSHDSK----------HKPISKNIQRLLEKSEKQAFTAPPENVRVHVIAATR
A9RFE0_PHYPA          LEVPNMASSMHDMK----------RKVISKPFRRLLDINDKQMFTGPPENVRDHVMAATR
A9SAG5_PHYPA          LEVPNMASSVHDMK----------RKMISKPFRRLLDINEKQMFTGPPENVRDHVMAATR
A9SZ44_PHYPA          LEVPNMASSMHDMK----------RKVISKPFRRLLDINEKQTFTGPPENVRDHVMAATQ
Q4U8V4_THEAN          LESANYARYPLKAK-----------EVISRQFRRMYDAYERQVFVGPPESNREVILTAFK
Q4N1J6_THEPA          LESANYVRYPLKAK-----------EVISRQFRRMYDLYERQVFVGPPESNREVILNAFK
A7APB4_BABBO          LESANLAKSSLNSR-----------EIISRQFRRMYEMHEKQVFMGPPENNRDVVMSTFR
Q4YU35_PLABA          LEVPNLAKHSYESKK----------DIISRQFRRFLDIYDKQIFNSPPENNREIIILATK
Q7RR21_PLAYO          LEVPNLAKHSYESKK----------DIISRQFRRFLDIYDKQIFNSPPENNREIIILATK
A0A077TJQ4_PLACH      LEVPNLAKHSYESKK----------DIISRQFRRFLDIYDKQIFNSPPENNREIIILATK
Q8I5Y3_PLAF7          LEVPNLAKNTYESKK----------DIISRQFRRFLDIYDKQIFNNPPENNKEIIILATK
B3LB47_PLAKH          LEVPNLARHSFESKK----------DIISRQFRRFLDIYDKQVFNSPPENNKEIILLATK
A5K0G2_PLAVS          LEVPNLARHTYESKK----------DIISRQFRRFLDIYDKQIFNSPPENNKEIILLATK
D0MQP5_PHYIT          LEVPNMVNARLSDR----------KRMVSKAFRKLLEFHERLVFEGPPENPRDHVVAAAK
Q5CQQ0_CRYPI          LEVPYLAYHKSLIMQNEASNSHIKLRPISKQFRRLLEQYERQAITGPPESLRDTIIAATR
                      :  .  .                      :         ::  .  *.*. :     :  

G1MAG9_AILME          AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
H0X7M1_OTOGA          AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_HUMAN           AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_PONAB           AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_BOVIN           AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
G1PSM2_MYOLU          AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_MOUSE           AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_RAT             AMKMGDWKTCHSFIINEKMNGKVWDLFP---EADKVRTMLVRKIQEESLRTYLFTYSSV-
EIF3C_XENTR           AMKMGDWKTCKNFIINEKMNGKVWDLFP---EAERVRSMLIRKIQEESLRTYLFTYSSV-
EIF3C_DANRE           AMKMGDWRTCHSFIINEKMNSKVWDLFP---EAKCVREMLVRKIQEESLRTYLFTYSSV-
H3DCM5_TETNG          AMKMGDWRTCHSFIINEKMNSKVWDLFP---ETQRVQEMLVRKIQEESLRTYLFTYSSV-
EIF3C_AEDAE           AMRHGNWNACSTFIVNKKMNVKVWDLFY---EADRVREMLIKFIKEESLRTYLFTYSNV-
EIF3C_ANOGA           AMRHGDWNACANFIVNKKMNVKVWDLFY---EANRVREMMIKFIKEESLRTYLFTYSNV-
EIF3C_DROME           AMRCGNWQACANFIVNKKMNTKVWDLFY---ESDRVREMLTKFIKEESLRTYLFTYSNV-
EIF3C_DROPS           AMRCGNWQACANFIVNKKMNTKVWDLFY---ESDRVREMLVKFIKEESLRTYLFTYSNV-
EIF3C_BOMMO           AMRRGDWRACLNYIVNEKMNAKVWDLMV---GADNVRAMLGRLIREESLRTYLFTYAHV-
E9HGP7_DAPPU          AMRNGLWKQAHNFIINEKMNAKVWDLFY---QADRVRTMLVRKIQEESLRTYLFTHSSV-
G4LYI7_SCHMA          AMRYGNWKACTNFIINPKMDAKIWDLLF---ESNKVKQNLEVKIKEESLRSFLFTFSAI-
B3RYW2_TRIAD          AMRTGDWKACSDYI----LRIKVWDLFT---EPETVKAMLLKKIREESLRTYLFTYGGV-
EIF3C_CAEBR           AMLNGDWKKCKDYIVNEKMNQKVWNLFH---NADQVKDMVVRRIQEESLRTYLLTYSTV-
EIF3C_CAEEL           AMLNGDWKKCQDYIVNDKMNQKVWNLFH---NAETVKGMVVRRIQEESLRTYLLTYSTV-
EIF3C_DICDI           ALSAGDWQQCLEHV----NTLRFWSLIP---DIDSVREKLTRIVQEVSLKTFLFTYSTS-
F0Z7C0_DICPU          ALSAGDWQQCVEHV----NTLRFWSSIP---EPELVREKLTRIIQEVSLKTFLFTYSTS-
D3BBM5_POLPP          ALATGDYRTTIDLL----AGLKLWTVIQ---DAEAVRERLNRIIQEVSLKTFLFTYSAY-
EIF3C_ASHGO           AMQRGNWAQCINYL----RSISTWTLLGD--KMEKVLEQLAERIQIESLKTYIFTYKRF-
EIF3C_KLULA           SMQKGDYLQSIEYL----RKISVWSLLS---KSDDIINQLSEKVQIETLKTYIFTYKRF-
EIF3C_CANGA           SMQKGDWKGCLEYL----KSVKTWNLLP---NSVEVLDNLTERIQIETMKTYVFTYRRF-
EIF3C_YEAST           SMQKGNWRDSVKYL----REIKSWALLP---NMETVLNSLTERVQVESLKTYFFSFKRF-
EIF3C_CANAL           ALQKGDWLKSYNLL----SSIKIWKLFP---DNDKLLAMMKNQLQIEGLRTYIFTYKSV-
EIF3C_YARLI           ALQRGDWEAARDLV----CAIKIWSLLP---NPEAIKAMLTDKLQIEGLRTYLFTYWNH-
EIF3C_EMENI           FLAAGDWKKAAEML----NSIKIWDLMP---QPEKIKEMLSQQIQEEGLRTYLFTYAPF-
EIF3C_ASPFU           FLAAGDWKKAAEML----NSIKIWDLMP---QPDKIKEMLSQQIQEEGLRTYLFTYAPF-
C0NXA3_AJECG          ALAAGDWKKAAATL----NSIKIWDLMA---QPDKIKTMLGEQIQEEGLRTYLFTYAPY-
C7Z9S9_NECH7          ALAAGEWKKSITFI----HSIKIWDLMP---SAEEIKTMLSKQIQEEGLRTYLFTYAPF-
EIF3C_NEUCR           ALAAGEWKKATDFI----HSIKIWDLMP---NTEGIKTMLAKQIQEEGLRTYLFTYAPF-
EIF3C_SCLS1           ALAQGEWKKATDYI----HSIKIWELMS---KPEEIKAMLSAQIQEEGLRTYLFTYAPY-
EIF3C_PHANO           ALSAGEWKKAAEFI----NSIKIWELVA---DSEKIKEMLSAQIQEEGLRTYLFTYAPY-
D5G6D6_TUBMM          ALAAGEWKRSSELI----HAIKIWDLLP---EPQKIKEMLSEKIQEEGLRTYLFTYAPF-
EIF3C_SCHPO           ALADGEWRRCEEFI----HAIKIWSLMP---DADKIKQMLSEKIREEGLRTYLLAYAAF-
F4P9G3_BATDJ          SMAAGDWKSCRDYI----NHIKIWDLLS---NAEKAKETLAKSIQEESLRTYIFTYAPY-
EIF3C_USTMA           ALQNGDCKACIELI----SDIKIWKLMP---GSQEVKLMLAKRIQEVGLRTYLFSYSAY-
D6RL89_COPC7          ALQDGEWEKCRDLI----QSIKIWSLMP---ECASVKEMLAKRIQEQGLKTYLFTYAPH-
EIF3C_CRYNJ           ALQAGEWEKARDLI----VSIKVWSLLD---NAAEVKDILAKKIQEEGLRTSLFTYAAY-
E3KG31_PUCGT          ALQTGDWQKCIELI----NGIKIWALMP---RQDALKEMLTRKIQEEALRTYLFTYSSY-
EIF3C_ARATH           ALTKGDFQKAFEVL----NSLEVWRLLK---NRDSILDMVKDRIKEEALRTYLFTYSSS-
F6HLF0_VITVI          ALSKGDFQKAFDVI----KSLDFWKLLR---NREDVLEMLRAKIKEEALRTYLFTYSLS-
F4J1N5_ARATH          ALIKGNFQEAFSVL----NSLDIWRLFK---NRDSILDMVKASISEVALRTYLFTYSSSC
A9RFE0_PHYPA          SLSKGEWRKAVAVI----QSMDVWKLLG---QREAIMEMLQCKMQEESLRTYIFTYSPY-
A9SAG5_PHYPA          ALSKGDWKKAVEVI----QSMDVWRLLG---QRESIMEMLQEKLQEEALRTYIFTYSPY-
A9SZ44_PHYPA          ALSKGDWEKAVEVI----QSMDVWKLLG---KREAILQMLRGKMQEEALRTYIFTYSPY-
Q4U8V4_THEAN          HLQNGDWKKCYNFI----LSLNTWNNMP---DREKVQETLKELIKVEGFRTYIFKYVNI-
Q4N1J6_THEPA          HLQNGDWKQCFNFI----LSLNTWNNMP---DREKVQETLKELIKVEGFRTYIFKYVNI-
A7APB4_BABBO          HLQNGNWKECYDLL----AGLTIWNRLP---DREEVLQILKDRIKVEAFNTYIFKYVPV-
Q4YU35_PLABA          YLQKGNWKMCCEKI----FSLSIWPKFT---DK-KVQAILKEKIKQEAMRTYIFRYISV-
Q7RR21_PLAYO          YLQKGNWKMCCEKI----FSLSIWPKFT---DKEKVQAILKEKIKQEAMRTYIFRYISV-
A0A077TJQ4_PLACH      YLQKGNWKMCCEKI----FSLSIWPKFT---DKEKVQAILTEKIKQEAMRTYIFRYISV-
Q8I5Y3_PLAF7          HLQKGNWKLCCEKI----FSLSIWPKFP---DKEKVQNILKEKIKQEAMRTYIFRYISI-
B3LB47_PLAKH          YLQKGNWKMCCEKI----FSLSIWSKFN---DTEKVQNILREKIKQEAMRTYIFRYISI-
A5K0G2_PLAVS          YLQKGNWKLCCEKI----FSLSIWSKFN---EREKVQNILQEKIKQEAMRTYIFRYISI-
D0MQP5_PHYIT          LLAQGSWRKSAELL----VGLPVWDLFPGASVTQRVKAMVQHKIQVEALRTYLLAFSAE-
Q5CQQ0_CRYPI          SLQLGKWRECRDYV----FSLSIWDYNQE--DLQQTQERLELNIKQEALRTYLFTYGHL-
                       :  *        :         *               :   :    :.: .: .    

G1MAG9_AILME          YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
H0X7M1_OTOGA          YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_HUMAN           YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_PONAB           YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_BOVIN           YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
G1PSM2_MYOLU          YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_MOUSE           YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_RAT             YDSISMETLSDMFELDLPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTAQQ
EIF3C_XENTR           YDSIRMGILGDMFQLEIPTVHSIISKMIINEELM-ASLDQPTQTVVMHGT----EPSSLQ
EIF3C_DANRE           YDSISMETLSEMFELELPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTSLQ
H3DCM5_TETNG          YDSISMETLSEMFQLEIPTVHSIISKMIINEELM-ASLDQPTQTVVMHRT----EPTSLQ
EIF3C_AEDAE           YASISVPYLAEMFELPKSKVHSLISKMIINEELM-ASLDDPTETVVLHRS----EPSRLQ
EIF3C_ANOGA           FASISVPHLADMFKLPKSKVHSLISKMIINEELM-ASLDDPTETIVMHRS----EPSRLQ
EIF3C_DROME           YTSISIPSLAQMYELPVPKVHSIISKMIINEELM-ASLDDPSETVGMHRS----EPSRLQ
EIF3C_DROPS           YTSISIPSLAQMYELPVPKVHSIISKMIINEELM-ASLDDPSETVVMHRS----EPSRLQ
EIF3C_BOMMO           YASLSLRSLADMFELPRQRVHSLVSKMIINEELL-ASLDDPSECAILHRS----EPTRMQ
E9HGP7_DAPPU          YDSLSMATLSKMFELEQPTVHAIISKMVMNEELM-ASLDEPTQSVVMHRT----EPSRLQ
G4LYI7_SCHMA          HDSMTLDRLSMCFELPKSVIYSVICRMIINQELA-ASLEVPSDALIMHKT----ERSRLQ
B3RYW2_TRIAD          YSSLSLSSLSEMFGMESSDVYRTISKMIMNDELQ-ASWDEPTETLMMHKC----EPTKLQ
EIF3C_CAEBR           YSTVSLKKLASLFDLSKKDVHSIISKMIIQEELS-ATLDEPTDCLIMHRV----EPSRLQ
EIF3C_CAEEL           YATVSLKKLADLFELSKKDVHSIISKMIIQEELS-ATLDEPTDCLIMHRV----EPSRLQ
EIF3C_DICDI           YDSILLSELADRFHLPKSQVHSIVAKMMNNHEIS-ASMEHSTESITF-RA----EQTKLQ
F0Z7C0_DICPU          YDSILIAELADRFQLPKAHVHSIVAKMMVNHEIS-ASMEHSTESITF-RA----EQTKFQ
D3BBM5_POLPP          YDTMLLSELADRFQLPKNHVHSIVSKMMANHEIS-ASWEHSTETITFHRS----EQTKLQ
EIF3C_ASHGO           YTKLSVQKLSELFSLPTEQVISVIQTLENTINIK-GSLNEAKEMLIFDKG---DE--ITK
EIF3C_KLULA           YSKISISKLSKLFDLDIEKVLAVAQNIINDYEVK-AKLDENNEYIIFERG---EE--ITK
EIF3C_CANGA           YEKISIKKFSELFSLPEDKIVTTMEKVIADLELN-IKLDDNKTYIVIEKG---DE--VSK
EIF3C_YEAST           YSSFSVAKLAELFDLPENKVVEVLQSVIAELEIP-AKLNDEKTIFVVEKG---DE--ITK
EIF3C_CANAL           FKKLSIEKLQQIFQLSKDEVVSILEKMITTGNVS-GGEIIDNKFISFTST---TEPQRSK
EIF3C_YARLI           YSTLSLSTLADMFQLPVKDVAAIVAKMIAQEELP-GSLDQKTNSVVFTQA---VQ--QTK
EIF3C_EMENI           YDSLSISTLSTMFELSEKKIAAIISRMISHEELG-AALDQVNDAIVFRKG---VELSRLQ
EIF3C_ASPFU           YDSLSIATLSNMFELSEKKISAIISRMISHEELA-AALDQVNNAIVFRKG---VELSRLQ
C0NXA3_AJECG          YDSLSISTLADMFELSPKKIAAIVSRMISHEELA-AALDQVNDAIIFRKG---VELSRLQ
C7Z9S9_NECH7          YDTLSIETLSAMFELDLTKISAVVSKMISHEELS-ASLDQVTSTIIFRKG---VELSRLQ
EIF3C_NEUCR           YDTLAIATLSSMFELDSRKVSAVVSKMISHEELA-AALDQVTETVIFRKG---VELSRLQ
EIF3C_SCLS1           YDTLSVNRLSSMFELPDRKVAAIVSKMISHEELA-AALDQVNSSIIFRKG---VELSRLQ
EIF3C_PHANO           YDTLAVSTLASMFELSERKVSAVVSKMISHEELA-AALDQVNSAIIFRKG---VELSRLQ
D5G6D6_TUBMM          YDTLSLSRLVEMFDLSERKVSALVSKMIAHEEIA-AALDQVNNAIIFRKG---VELSRLQ
EIF3C_SCHPO           YDSVSLEFLATTFDLPVQRVTVIVSRLLSKREIH-AALDQVHGAIIFER----VEINKLE
F4P9G3_BATDJ          YESMGLSSLAELFELEVSRVNAIVSKMTTSEELH-ASLDPQSGHIIFHRPAPGIEMSRLE
EIF3C_USTMA           YESVSLSHLAATFDVEETVVKAMVSKMIYNDELA-ASLDPSANVVSFHR----LELTKVQ
D6RL89_COPC7          YSSCSLSLLSRTFALPLRTVSSIVSKMIWNEELS-ASLDQSAGVVVFHR----MELSRQQ
EIF3C_CRYNJ           YDSLSLSHLASTFNLPVGRITSIISRMIYTDELA-ASLDQIDGVVIFHR----VEQSEVQ
E3KG31_PUCGT          YSTVSIEYLATSFQLSESEVTSIVSRMIWNEELGGASLDQIDKVVVLSK----QELTKLQ
EIF3C_ARATH           YESLSLDQLAKMFDVSEPQVHSIVSKMMINEELH-ASWDQPTRCIVFHEV----QHSRLQ
F6HLF0_VITVI          YNTLSLDQLTKMFDLSETLTHSIISKMMVMEELH-ASWDQPTRCIVFHDV----EHTRLQ
F4J1N5_ARATH          YKSLSLAELAKMFDISESHVYSIVSKMMINKELN-ATWDQPTQCIVFHEV----QHNRAQ
A9RFE0_PHYPA          FDSFSLDQLMVIFGLSEAQVHSIVSKMIIAEELH-ASWDQPTRCIVTHNV----EPTRLQ
A9SAG5_PHYPA          FESLSLDQLMVMFGLPEAQVHSIVSKMMIAEELH-ASWDQPTRCVVTHNM----EPTRLQ
A9SZ44_PHYPA          FDSLSLDQLMTMFGLPEAQVHSIVSKMMIAEELH-ASWDQPTRCIVTHNV----EPTRLQ
Q4U8V4_THEAN          YDSFSVEQLSSMFSLDENVVHSLISKMIVNGEIL-GSWDYSSKCCLINHS----EPTELQ
Q4N1J6_THEPA          YDSFSVEQLSSMFSLDENVVHSLISKMIVNGEIL-GSWDYSSKCCLINHS----EPTELQ
A7APB4_BABBO          YDSFSVDQLSSMFDLDNNVIHSLLSKMIITGDIH-ATWDDSSKYCLINHT----EPTDLQ
Q4YU35_PLABA          YDSFSIDQLCVMFDLPQNTVHSILSKMMVNHEIP-ACWNESSKYILISTI----KPTPLQ
Q7RR21_PLAYO          YDSFSIDQLCVMFDLPQNTVHSILSKMMVNHEIP-ACWNESSKYILINTI----NPTPLQ
A0A077TJQ4_PLACH      YDSFSIDQLCVMFDLPQNTVHSILSKMMVNHEIP-ACWNESSKYILINKV----NPTPLQ
Q8I5Y3_PLAF7          YESFSIDQLCVMFDLNQNVVHSILSKMMINQEIP-AFWNESSKFILISKV----NPTTLQ
B3LB47_PLAKH          YDSFSVDQLCIMFDLNQNVVHSILSKMMINHEIP-ACWNESSSHILINKV----NPTALQ
A5K0G2_PLAVS          YDSFSVEQLCIMFDLNQNVVHSILSKMMINHEIP-ACWNESSSHILINKV----NPTALQ
D0MQP5_PHYIT          YDSVSLARLMEMFELDDKTVHSVVSKMMINEELQ-GAWDQSSQAIVLYKT----ERSTLQ
Q5CQQ0_CRYPI          YSSYSVNNLIEMFQLPREKIHSLLSKMMLKNELQ-ALWDQTGEFVLLNHK----QASKIQ
                      . .  :  :   : :           :    ::                     :    :

G1MAG9_AILME          NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
H0X7M1_OTOGA          NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_HUMAN           NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_PONAB           NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_BOVIN           NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
G1PSM2_MYOLU          NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_MOUSE           NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_RAT             NLALQLAEKLGSLVENNERVFDHKQGTYGGYF-------RDQKDGYRKNEG-YMR-----
EIF3C_XENTR           NTALQLAEKLGNLVENNERIFDHKQGSYGGYFNRGDRGDRDQKDQYQRKEGGYMR-----
EIF3C_DANRE           NMALQLAEKLGGLVENNERVFDLKQGVYGGYFN------RDQKGGYQQKQG-YQRGDQKG
H3DCM5_TETNG          NMALQLAEKLGSLVENNERVFDLKQGVYGGYFN------RDQKGGYQQKQS-YQR-DQKS
EIF3C_AEDAE           ALSMQLSDKVTNLVDSNERIFEMKQGNF-FQRGG-NQGYNRDRQNYRNQN-QNQNWSGNR
EIF3C_ANOGA           ALSMQLADKVTNLVDANERIFEMKQGNF-FQRGG-NQGYNRDRQNYRNQN-QNQNWNNNR
EIF3C_DROME           ALAMQFVDKVTNLVDVNEKVFDMKQGNF-FQRG--NMGNRGDRGYNRNQNNQGGNWLGQR
EIF3C_DROPS           ALAMQFVDKVTNLVDVNEKVFDMKQGNF-FQRG--NMGNRGDRGYNRNQNNQGGNWGGQR
EIF3C_BOMMO           ALALQLADKVGNLVDSNERIFE-KQGSF-FQRG------GAQRGEGRQRERPREGWNRRT
E9HGP7_DAPPU          SMSLQLADKLANLVDNNERILKIRQGPFGFSRGN-QNVRFGDRPQYGNRQGQQGGGGNWQ
G4LYI7_SCHMA          ALALQLSDKVNSIVEMNDKLIESRTGGLSGLKG---------SQSYQGTRR---------
B3RYW2_TRIAD          NLAIQIADKIYALADTNEKILHERHGYQINKGRVIVSDWREQSRDRRRVQQSQNDENWSG
EIF3C_CAEBR           MLALNLSDKLQTLAENNEQILEPRTGRGGYQGPGSWFPGRNERQGDKQKGSGGFQGERRG
EIF3C_CAEEL           MLALNLSDKLQTLAENNEQILEPRTGRGGYQGPGSWFPGRNERQGDKQKGSGGYQGERRG
EIF3C_DICDI           YLALHYSESLVDFVEQNERIYDVKFGTSYRKKGDNDHLPIAGGQHHGHQHHGHQHHGHHH
F0Z7C0_DICPU          YLALHYSESLVDFVEQNERIYDVKFGTSYRKKGDNEHLQMGHQQHHGHHHY---HHGQQH
D3BBM5_POLPP          YLALNYSDSLINFVEQNERIYDIKFGSYRNKKFDDVSAGAAQGQVTG---------GQQH
EIF3C_ASHGO           LEEVAIKLTKETKYQSERLNNVSQRQ----------------------------------
EIF3C_KLULA           LEEVAIKLVKETKYHSERLRQ---------------------------------------
EIF3C_CANGA           LEEVAVKLNKEIRATRERLNPSHHNHR---------------------------------
EIF3C_YEAST           LEEAMVKLNKEYKIAKERLNPPSNRR----------------------------------
EIF3C_CANAL           LQELAIVLNEKIQLLTEKNEKTQSNGYGKKQQNKDQQNQQQQNQNQNQQQQQNQQQQQQQ
EIF3C_YARLI           LQQLAVALSDKVIQLAERNERLVAGGYQFDKMTQPQKRKTQRAR----------------
EIF3C_EMENI           SQIVTLADKSMNLLEANEKTLEQRTQGMA--NAFQRDQGAGARGGRGPRGGGQARGGPR-
EIF3C_ASPFU           SQIVTLADKSMNLLEANEKTLEQRTQGMA--NAFQRDQGAGARGGRGSGRGGQARGGPR-
C0NXA3_AJECG          NQIVTLADKSMSLLEANEKTLEQRTQGMA--NAFQRDSGHGGRGARSGGRGGRGGAGRGG
C7Z9S9_NECH7          SLALALSDKASALIETNERTLEQRTQGTS--NAFERQGGRGRGGRRTGGQ---GRGGAR-
EIF3C_NEUCR           SLALTLSDKASSLIETNERTLEQKTQGSA--NAFSRKDNRG-GGQRGGGQRG-GRGGAR-
EIF3C_SCLS1           SLALSLSDKASGLIESNERTLETRTQGTA--NAFERQGGRGGRGGNRGGRGG-NRGGRG-
EIF3C_PHANO           TLALSLSDKASGLIESNEKTLEQRTQGTA--NAFERQGGRG---GRGGGR---GRGGGR-
D5G6D6_TUBMM          TLALALSDKASGLMEQNERVLEQKTQGQGGFEGGQQRGGGGGRGGRGGQRGD-HSGGRGG
EIF3C_SCHPO           SLTVSLSEKTAQLNEANEKLYEQKTQHTN--PQENRRRDKGGSVKRRNER----------
F4P9G3_BATDJ          FMAGVYADKVASLVDSNEKLLEARSVTLGLQEQREYMQHREQQGGHRGGRVGG-----SG
EIF3C_USTMA           QLAATLAEKANSMLEQNERLLDAKLGEGKEQRSGAGGERGDREGGQPGGRRE--------
D6RL89_COPC7          QLAQTIADKLGVLVDQNEKTLDVKMGGSVGWNER-GGDKGAKGGEQAQERRGR--GERTR
EIF3C_CRYNJ           RLAQQLAERTASMLEQNEKTLDVKLGNQGQGQDRDTRAVGGEGGRQQGERRG---GRGTY
E3KG31_PUCGT          QLTIGLVDKVSGMAETNERYLESKIGAGADRDGANRAGTGGAERKDGEPQRGPRRGGGAK
EIF3C_ARATH           SLAFQLTEKLSILAESNERAMESRTGGGGLDLSSRRRDNNQDYAGAASG--GGGYWQDKA
F6HLF0_VITVI          ALSFQLTDKLTILAENNERAYEAKIGGGGLDLPLRRRDG-QDYAGAASV--GG-KWQDNF
F4J1N5_ARATH          SLAFQITEKLATLAESNESAMESKTGGVGLDMTSRRRENSQDYAAAA-------------
A9RFE0_PHYPA          ALASQFAEKLHVLVESNEKAFDARTGGGGLESMGRRNKDGQDYADAVGGRRGGDFGGGRG
A9SAG5_PHYPA          ALASQFAEKLNVLVESNEKAFDARTGGGGLEGLGRRNKEGQDYADAAGGRRGGDFGGNRS
A9SZ44_PHYPA          ALASQFAEKLNVLVESNEKAFDARTGGGGLEGMGRRNRDTQDYADAAGGRRGGDFGGGRG
Q4U8V4_THEAN          KLAVKLAENLSTAVEQNELTLNMKNSKFALSQDRRFQQRDTRYNYGSRHDDGRISTFNFN
Q4N1J6_THEPA          KLAVKLAENLSTAVEQNELTLNMKNSKFALSQDRRFQQRDTRYSYGSRHDDGRMSTFNFN
A7APB4_BABBO          KCAIKLAENLTTAVEQNEMTLNMKNPKFALSQDRRFQTRENKFSYGRSRDDRHHAAPTFN
Q4YU35_PLABA          TMALKLAENINEVMEQNELALNMKNPKFMLMQERKTHMKDDKSNWNSKKGDGKYGKNYNR
Q7RR21_PLAYO          TMALKLAENINEVMEQNELALNMKNPKFMLMQERKTHMKDDKSNWNNKKGDGKYGKNYNR
A0A077TJQ4_PLACH      TMALKLAENINEVMEQNELALNMKNPKFMLMQERKTQMKDDKSNWNHKKGDGKYGKNYNR
Q8I5Y3_PLAF7          NLALKLAENVNEVMEQNELALNMKNPKFMFMQERRTQMKEEKSNWTQKKGDQKYQKNYNQ
B3LB47_PLAKH          TVAIKLAENINEIMEQNELTLNMRNPKFMFMQEKRTQMKDDKSNWSHKKGDGKYGKGYHQ
A5K0G2_PLAVS          TVAIKLAENINEIMEQNELTLNMRNPKFMFMQERRTQMKDEKSNWSHKKGEGKYGKGYHQ
D0MQP5_PHYIT          TMAVQYSDKLSQIVENNERMMDLRSGTNKEEWGNRRGGTDGRRGGGGRIGFSTGGSRRGD
Q5CQQ0_CRYPI          NDSLIVADKLLQFVDCNESMISSKGNASGGKNPNVINNRNSAGVGNPNNQGGIGPGSVQG
                                      :                                           

G1MAG9_AILME          ------------------------------------------------------------
H0X7M1_OTOGA          ------------------------------------------------------------
EIF3C_HUMAN           ------------------------------------------------------------
EIF3C_PONAB           ------------------------------------------------------------
EIF3C_BOVIN           ------------------------------------------------------------
G1PSM2_MYOLU          ------------------------------------------------------------
EIF3C_MOUSE           ------------------------------------------------------------
EIF3C_RAT             ------------------------------------------------------------
EIF3C_XENTR           ------------------------------------------------------------
EIF3C_DANRE           GYQQ--------------------------------------------------------
H3DCM5_TETNG          GYQQN-------------------------------------------------------
EIF3C_AEDAE           RQ----------------------------------------------------------
EIF3C_ANOGA           RQ----------------------------------------------------------
EIF3C_DROME           RD----------------------------------------------------------
EIF3C_DROPS           RDN---------------------------------------------------------
EIF3C_BOMMO           RN----------------------------------------------------------
E9HGP7_DAPPU          RR----------------------------------------------------------
G4LYI7_SCHMA          ------------------------------------------------------------
B3RYW2_TRIAD          NKGNQ-------------------------------------------------------
EIF3C_CAEBR           GPGG--------------------------------------------------------
EIF3C_CAEEL           GQG---------------------------------------------------------
EIF3C_DICDI           HNQQQ-------------------------------------------------------
F0Z7C0_DICPU          HNQQH-------------------------------------------------------
D3BBM5_POLPP          HNQQR-------------------------------------------------------
EIF3C_ASHGO           ------------------------------------------------------------
EIF3C_KLULA           ------------------------------------------------------------
EIF3C_CANGA           ------------------------------------------------------------
EIF3C_YEAST           ------------------------------------------------------------
EIF3C_CANAL           ------------------------------------------------------------
EIF3C_YARLI           ------------------------------------------------------------
EIF3C_EMENI           ------------------------------------------------------------
EIF3C_ASPFU           ------------------------------------------------------------
C0NXA3_AJECG          ------------------------------------------------------------
C7Z9S9_NECH7          ------------------------------------------------------------
EIF3C_NEUCR           ------------------------------------------------------------
EIF3C_SCLS1           ------------------------------------------------------------
EIF3C_PHANO           ------------------------------------------------------------
D5G6D6_TUBMM          ------------------------------------------------------------
EIF3C_SCHPO           ------------------------------------------------------------
F4P9G3_BATDJ          ------------------------------------------------------------
EIF3C_USTMA           ------------------------------------------------------------
D6RL89_COPC7          ------------------------------------------------------------
EIF3C_CRYNJ           ------------------------------------------------------------
E3KG31_PUCGT          ------------------------------------------------------------
EIF3C_ARATH           NYGQGRQG-NRSGYG-GGRSSGQN---GQWS----GQNRG-GGYAG--------------
F6HLF0_VITVI          SFSQGRQGGVRTGYGVGGRPLGPGSSAGTFSRDRGGQSRGTGGYSGGYQSTRYQDAAYG-
F4J1N5_ARATH          ------------------------------------------------------------
A9RFE0_PHYPA          SFRSSRGGR--RDNQGGGRGGRDN-QGGYSNYNRGP------------------------
A9SAG5_PHYPA          GFRNNRGGRGGRDNQAGGRGARDN-QGGFNNYNRGNQGRSGY------------------
A9SZ44_PHYPA          GNKGGRGGRGGRDNFGGGRGGRDNNQGGYNNYNRGGQGGGGRGYSSGYQSTRYQDAYSSV
Q4U8V4_THEAN          ------------------------------------------------------------
Q4N1J6_THEPA          ------------------------------------------------------------
A7APB4_BABBO          ------------------------------------------------------------
Q4YU35_PLABA          ------------------------------------------------------------
Q7RR21_PLAYO          ------------------------------------------------------------
A0A077TJQ4_PLACH      ------------------------------------------------------------
Q8I5Y3_PLAF7          ------------------------------------------------------------
B3LB47_PLAKH          ------------------------------------------------------------
A5K0G2_PLAVS          ------------------------------------------------------------
D0MQP5_PHYIT          ------------------------------------------------------------
Q5CQQ0_CRYPI          GGPNN-------------------------------------------------------
                                                                                  

G1MAG9_AILME          -----------RGGYRQQQSQTAY------------------------------------
H0X7M1_OTOGA          -----------RGGYRQQQSQTAY------------------------------------
EIF3C_HUMAN           -----------RGGYRQQQSQTAY------------------------------------
EIF3C_PONAB           -----------RGGYRQQQSQTAY------------------------------------
EIF3C_BOVIN           -----------RGGYRQQQSQTAY------------------------------------
G1PSM2_MYOLU          -----------RGGYRQQQSQTAY------------------------------------
EIF3C_MOUSE           -----------RGGYRQQQSQTAY------------------------------------
EIF3C_RAT             -----------RGGYRQQQSQTAY------------------------------------
EIF3C_XENTR           -----------RGYRRDQQGQSNY------------------------------------
EIF3C_DANRE           ------KQNYQRGGYRNQ-NQSSY------------------------------------
H3DCM5_TETNG          ------KGGYQRGGYRNQ-NQSNY------------------------------------
EIF3C_AEDAE           ----------DNRENRGNR-NQNR----------------DRDHRKQHRVEFEEKAE---
EIF3C_ANOGA           ----------DNR-NRGNRGNQNRGEGREQREHHRDHHRDQREHREHQNREFREQREQMR
EIF3C_DROME           ----------RNNRNRNQRGHHKNNQ--------------DRQQQQQQQVQTIDEE----
EIF3C_DROPS           ----------RNQRNRNQRGHHKN-----------------QQQQQQQQVQTIDEE----
EIF3C_BOMMO           ------------RRRDDERADD--------------------------------------
E9HGP7_DAPPU          ----------GGDNRDNHRGGDNRDN---------------RDNRDNRDRHNN-------
G4LYI7_SCHMA          ------------VGTRYTLNKFN-------------------------------------
B3RYW2_TRIAD          ------GRSGKGSGNRNKRKHGGK------------------------------------
EIF3C_CAEBR           -----------PDGKRGNWGSQGG-----------------QQRRHPQKPRAF-------
EIF3C_CAEEL           -----------QDGKRGNWGSQGG-----------------QQRRHPQKPRAF-------
EIF3C_DICDI           ------QQHHQQQQQTTQHHHHHHQNQNQGNQQYQNKKHHNSNQQKSHKKRQNNSLVVNN
F0Z7C0_DICPU          ------HGQQHQQQQSQQQHQQKKQQ----------------HQQKGKKKQ--NPLVVN-
D3BBM5_POLPP          ------KQQRNNNRRQ--------------------------------------------
EIF3C_ASHGO           ------------------------------------------------------------
EIF3C_KLULA           ------------------------------------------------------------
EIF3C_CANGA           ------------------------------------------------------------
EIF3C_YEAST           ------------------------------------------------------------
EIF3C_CANAL           --------QSSQQQSNNILSEESANKFRYANVNSNNDEFQATA-----------------
EIF3C_YARLI           ------------------------------------------------------------
EIF3C_EMENI           --------LPGGQQ-RRPGGQQFG--GGALGGAIKA------------------------
EIF3C_ASPFU           --------FPGGQQGRRPGGQQFG--GGALGGAIKA------------------------
C0NXA3_AJECG          --------GSGGGLPRRPGGQQFG--GGALGGAIKA------------------------
C7Z9S9_NECH7          ---------TGGNTQRQAGGTQFT--GGALGAAVRG------------------------
EIF3C_NEUCR           ---------TGGNPQRQAGGTQFT--GGALGNAVRG------------------------
EIF3C_SCLS1           ---------GISNAPRQAGGTQFT--GGALGAAVGSRA----------------------
EIF3C_PHANO           ---------GGG-VPRGGRNQQFT--GGALGRAIQA------------------------
D5G6D6_TUBMM          --------RGGHKGPRTQKNVQFNQQSGFHGGAMKT------------------------
EIF3C_SCHPO           ------------TENRNRSDMN--------------------------------------
F4P9G3_BATDJ          --------RHTGGSSSHRGG--SAGSGFRFRTAVGK------------------------
EIF3C_USTMA           --------RRGGSAARGRGR--GRGRAQQFQALGQKV-----------------------
D6RL89_COPC7          --------GARGGARGGRGARFAQGLGNQMPGGGQRQA----------------------
EIF3C_CRYNJ           --------RGRGG-RGGRGG-FNQGLGTTMGRRVTAQ-----------------------
E3KG31_PUCGT          --------NYRGG--RGRGTFSGPIGGRAVAAGGDRRRG---------------------
EIF3C_ARATH           ---------RVGSGNRG-MQMDGSSRMVSLNRGVRT------------------------
F6HLF0_VITVI          -----RTAYQTSSAVRG-SQMDTSTRMVSLNRGVRA------------------------
F4J1N5_ARATH          ------------SDNRG-LKMDGS----SLTRGVSA------------------------
A9RFE0_PHYPA          ---------TSGGINRGVQQADAAGRMVSLSRVGDSRF----------------------
A9SAG5_PHYPA          --------NTSGINNRGVQQADAGGRMVSLSRVGSNRF----------------------
A9SZ44_PHYPA          GRTPYQTGPTAAGINRGQQAADAGGRMVSLSRMG-SRF----------------------
Q4U8V4_THEAN          -----------RNRRFMQQPRQTKQFPVPTR-----------------------------
Q4N1J6_THEPA          -----------RNRRFIQQPRQTKQFPVPTR-----------------------------
A7APB4_BABBO          -----------RNRRPIQGARLHR------------------------------------
Q4YU35_PLABA          -----------HKNQNYKKNYKDKNINKNFVQH---------------------------
Q7RR21_PLAYO          -----------HKNQNYKKNYKDKNMNKNFVQH---------------------------
A0A077TJQ4_PLACH      -----------NKNQNYKKNYKDKNMNKNFVQH---------------------------
Q8I5Y3_PLAF7          -----------KKNAHYKKNYKDNNANKNYKKN---------------------------
B3LB47_PLAKH          -----------HKNVHYKKNYKEKSMPKGFA-----------------------------
A5K0G2_PLAVS          -----------HKNVHYKKNYKEKGMPKGFA-----------------------------
D0MQP5_PHYIT          ----------NQGGRGGFRPRRGGGAGGGRGPRQQRQ-----------------------
Q5CQQ0_CRYPI          -------TSNTNSSGTGNQSFNSNYYSRKTNSGQYNKHKNTSSSSSSVPSSSSMNLRPIR
                                                                                  

G1MAG9_AILME          ---------
H0X7M1_OTOGA          ---------
EIF3C_HUMAN           ---------
EIF3C_PONAB           ---------
EIF3C_BOVIN           ---------
G1PSM2_MYOLU          ---------
EIF3C_MOUSE           ---------
EIF3C_RAT             ---------
EIF3C_XENTR           ---------
EIF3C_DANRE           ---------
H3DCM5_TETNG          ---------
EIF3C_AEDAE           ---------
EIF3C_ANOGA           NVEYQNKAE
EIF3C_DROME           ---------
EIF3C_DROPS           ---------
EIF3C_BOMMO           ---------
E9HGP7_DAPPU          ---------
G4LYI7_SCHMA          ---------
B3RYW2_TRIAD          ---------
EIF3C_CAEBR           ---------
EIF3C_CAEEL           ---------
EIF3C_DICDI           ---------
F0Z7C0_DICPU          ---------
D3BBM5_POLPP          ---------
EIF3C_ASHGO           ---------
EIF3C_KLULA           ---------
EIF3C_CANGA           ---------
EIF3C_YEAST           ---------
EIF3C_CANAL           ---------
EIF3C_YARLI           ---------
EIF3C_EMENI           ---------
EIF3C_ASPFU           ---------
C0NXA3_AJECG          ---------
C7Z9S9_NECH7          ---------
EIF3C_NEUCR           ---------
EIF3C_SCLS1           ---------
EIF3C_PHANO           ---------
D5G6D6_TUBMM          ---------
EIF3C_SCHPO           ---------
F4P9G3_BATDJ          ---------
EIF3C_USTMA           ---------
D6RL89_COPC7          ---------
EIF3C_CRYNJ           ---------
E3KG31_PUCGT          ---------
EIF3C_ARATH           ---------
F6HLF0_VITVI          ---------
F4J1N5_ARATH          ---------
A9RFE0_PHYPA          ---------
A9SAG5_PHYPA          ---------
A9SZ44_PHYPA          ---------
Q4U8V4_THEAN          ---------
Q4N1J6_THEPA          ---------
A7APB4_BABBO          ---------
Q4YU35_PLABA          ---------
Q7RR21_PLAYO          ---------
A0A077TJQ4_PLACH      ---------
Q8I5Y3_PLAF7          ---------
B3LB47_PLAKH          ---------
A5K0G2_PLAVS          ---------
D0MQP5_PHYIT          ---------
Q5CQQ0_CRYPI          V--------