CLUSTAL format seed alignment for MF_03003

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EIF3D_DICDI       ------------MSLELNTIKVNPTGWGPVGK--------------LEKFTDIPYAPFSK
F0Z618_DICPU      ------------MSLELPNVKSNPSGWGPITK--------------LEKFTDIPYAPFSK
D3B418_POLPP      ---------MASFSLDLGTIKSNTEGWGPTGN--------------IEKFDDIPYAPFSK
EIF3D_CAEBR       ------MATTELPKFELLSLADNTSGWGPLTTS-------------SSSVEPVPFQQFNK
EIF3D_CAEEL       ---------MALPKFELLSLADNTVGWGPLASS-------------SSADEPVPFQQFNK
W5JBM2_ANODA      MSEATISCTPEIATFEAPQLQCNEDGWGPCEL--------------PDAFKDIPYQPFSK
EIF3D_ANOGA       -MSDTISCTPETATFEAPQLQFNEDGWGPCEL--------------PDAFKDIPYQPFSK
EIF3D_AEDAE       -MNETIACTPESAVFEAPQLQFNEEGWGPCEL--------------PDAFKDIPYQPFSK
EIF3D_BOMMO       -MSEHVLPAEGPMRFISPIIQDNPTGWGPYEM--------------PDQFRDMPYQPFSK
EI3D1_DROME       -MSETINTAAQFPSFEKPTVQFNEKGWGPCEL--------------PDTFKDVPYQPFSK
EI3D1_DROPS       -MSETINTAAQFPSFEKPTVQFNERGWGPCEL--------------PDTFKDVPYQPFSK
E0VST5_PEDHC      -MGDD--EQKSVPKFVAPVIQDNVNGWGPCDM--------------PEQFKDMPYQPFSK
EI3D2_DROME       --------MSNYAPFIKPYVEYNEHGWGPCEV--------------PEL--DVPYQPFCK
EI3D2_DROPS       --------MSGRAPFIKPVLEYNEHGWGPCEE--------------LSV--DVPYQPFCK
E9H2T3_DAPPU      ----------MAAHFVPPATQDNNDGWGPLGI--------------PDRYKDMPYQPFSK
EIF3D_DANRE       -----------MAKFHAPVIQDNPSGWGPCAV--------------PEKFKDMPYQPFSK
H3BVT8_TETNG      -----------MAKFNAPVIQDNPSGWGPCAI--------------PEKFKDMPYQPFSK
G1RX45_NOMLE      -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_PONAB       -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_HUMAN       -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
H0WLV6_OTOGA      -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_BOVIN       -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_MOUSE       -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_RAT         -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
G1PTA3_MYOLU      -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
G1LSW8_AILME      -----------MAKFMTPVIQDNPSGWGPCAV--------------PEQFRDMPYQPFSK
EIF3D_XENTR       -----------MAKFQAPVINDNPLGWGPCAV--------------PDQFKDMPYQPFSK
H2ZWM9_LATCH      -----------MAKFIAPVIQDNLSGWGPCAI--------------PEQFKDMPYQPFSK
C3Z7P9_BRAFL      -----------MAHFNPPQIQDNHNGWGPCAI--------------PEKFKDMPYQPFSK
B7PYZ6_IXOSC      ----------------------------------------------------MPYQPFAK
EIF3D_NEMVE       --------MAGKAKFCAPEIQDNPDGWGPCSV--------------PTAFKDIPYQPFSK
B3RPZ1_TRIAD      ----------MAARFIPPEIPDNPNGWGPYSV--------------PNEFQEIPYQPFAK
EIF3D_ARATH       ---------MVTEAFEFVAVPFNSDGWGPPDASDVSSSASPTSVAAANLLPNVPFASFSR
Q9FKV6_ARATH      ---------MVFEAFEVGTVPFNSDGWGPPDASDTSS----TSVAAANLLPNVPFASFSR
F6HJU0_VITVI      ----------MVGGFEVGAVPFNPDGWGPPES---------ASPHLPNHPINVPFAPFSR
C5XFY4_SORBI      ------------MGFDVGFVPYNPDGWGPPEAAA-------APLSLGGGSSSVPFAPFSR
C5YVW3_SORBI      ------------MGFDVGVVPSNPDGWGPPDVPA-------IPQSLGGGAS-IPFAPFSR
EIF3D_EMENI       -------MAPISIADIVAALPA-EDTWGPV-TSA------------DNMLDGVPYAPFSK
EIF3D_ASPFU       -------MAPMSIADLVAALPA-EDTWGPA-TPS------------DNMLDGVPYAPFSK
C0P0X7_AJECG      -------MGPVSIADIVASLPS-EDSWGPP-VTT------------ETTLDGVPYAPFSK
C7YK22_NECH7      ------MGDSLDYVKICESCPA-GDGWGPS-VTT------------ETTLNGVPYAPFSK
EIF3D_NEUCR       --MTNPTPGLSGLVDLIDSLPDLGATWGPA-ITT------------ETTLNGVPYAPYSK
EIF3D_SCLS1       -------MAPISLSEIISALPS-EDSWGPT-TTS------------ETTLNGVPYAPYSK
EIF3D_PHANO       -------MAPASLLDLVSALPA-TESWGPA-VSD------------ETMLDGVPFAPYSK
EIF3D_USTMA       ----------MASFKLPELQPD-NDLWGPA-SGSNAL---------PAELKDIPFAPYAK
EIF3D_SCHPO       ---------MATGFKLPELAPV-KSAWGPP-ETE-------------QIGGDIPYAPFSK
A8NYW9_COPC7      ----------MASFSLPTIHDNPDGGWGPSTSTNFPE---------QFKFKDIPYAPFAK
E3KIW0_PUCGT      --MADNDSTSSPQFVLPAIHDHPDA-WGPS-PTALPT---------QF--KDIPYAPFSK
EIF3D_CRYNJ       ----------MANFVLPPIHDNSDGSWGPS-TSTLPA---------QF--KDIPYAPFSK
EIF3D_YARLI       -----------MALRLPALLDA-NAPWGPP--STVPE---------DLKFDDVPYAPFSK
A9UR66_MONBE      -----------MAAFSLGDLHINEAGWGPEGG--------------PKKFEGIPYQPFRK
Q4UB08_THEAN      ------------MNSLNIVTNFNHDGWGPDEEDDQTINT------CLNSINKLPFDPKLK
Q4MYQ4_THEPA      ------------MSNLNIVANFNSNGWGPDEEDDQTINT------CLHTINKFPFDPKLK
A7AM33_BABBO      ------------MTRLRIVTNLNASGWGPDESDDQTVVS------SLGSLSKLPLEPRLK
B3L3L2_PLAKH      ------------MSAFKLIGVANNRTWGPDSKNEELVNQ------CMGELKKYQFEPSMK
A5K7A0_PLAVS      ------------MSAFKLIGVANNRTWGPDSKNEELVNQ------CMGELKKYQFEPSMK
Q7RGS7_PLAYO      ------------MSTFKLFGVVNNRTWGPDIKNEELVNS------CMEDIKKYQFEPSMK
Q8IJW4_PLAF7      ------------MSSFNLVGVINNRTWGPDSKNEELVNY------CMPDIKKYQFEPSMK
Q5CPM5_CRYPI      ------------MSKFNYILNFSPDTWTPTIES-KAGEN------CLGGIKNFPFAPSMK
                                                                             :

EIF3D_DICDI       GDKIGK--CSDWNSNVR------------NYQRQN-YGSN---------AFNPFT-----
F0Z618_DICPU      GDKIGK--CSDWNSNVR------------NYQRQN-YGSN---------VFNPFT-----
D3B418_POLPP      SEKIGK--CSDFNSNMK------------QYQRQNIYGAN---------ASNPFT-----
EIF3D_CAEBR       ADRIGR--VADWIGVDRF------FRRGNERYNERVYGSA---------ANAGSQ---FD
EIF3D_CAEEL       ADRIGR--VADWIGVDRF------YRRGNERYNERVYGSA---------ANAGSQ---FD
W5JBM2_ANODA      SDRLGK--ISDWTGTAQ-----------TDKKFSNKYASQ---------FGGGSQ---YA
EIF3D_ANOGA       SDRLGK--ISDWTGTAQ-----------TDKKFSNKYASQ---------FGGGSQ---YA
EIF3D_AEDAE       SDRLGK--ISDWTGTAQ-----------TDKKYPNKYASQ---------FGGGNQ---YA
EIF3D_BOMMO       GDRLGK--ISDWTMVQ-------------DKKYQNKYASQ---------FGAGSS---YA
EI3D1_DROME       NDRLGK--ICDWTNTSN-----------NDKKYQNKYASS---------FGTGIQ---YS
EI3D1_DROPS       NDRLGK--ICDWTSTSN-----------NDKKYQNKYASS---------FGTGNQ---YS
E0VST5_PEDHC      GDRLGKASISDWAGTAF-----------QDKKYINKYQSQ---------FGAGSQ---YA
EI3D2_DROME       SDRLGK--ICDWTAMVP------------EKKFPSKYAST---------FGNNSQ---YA
EI3D2_DROPS       SDRVGK--ISDWTAPPT------------ERKFANKYVSS---------FGNSNQ---YA
E9H2T3_DAPPU      MSEWAG---GSSINYSF-----------TDRKYGGGKYSG---------GAGGSQ---YA
EIF3D_DANRE       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
H3BVT8_TETNG      GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
G1RX45_NOMLE      GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_PONAB       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_HUMAN       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
H0WLV6_OTOGA      GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_BOVIN       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_MOUSE       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_RAT         GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
G1PTA3_MYOLU      GDRLGK--VADWTGTTY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
G1LSW8_AILME      GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
EIF3D_XENTR       GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
H2ZWM9_LATCH      GDRLGK--VADWTGATY-----------QDKRYTNKYSSQ---------FGGGSQ---YA
C3Z7P9_BRAFL      GDRLGK--VSDWTGATY-----------QDRRYINKYSSQ---------FGAGNQ---YS
B7PYZ6_IXOSC      SDRLGK--VADWTGTTY-----------QDRRAANKYSSQ---------FGSGTQ---YA
EIF3D_NEMVE       ADRLGK--VSDWTGSVY-----------QDRRYANKYQSQ---------FGTGNQM--FS
B3RPZ1_TRIAD      SDRLGK--VTDWNAVGTS----------QDKKTKDKYAAH---------FGAGGSA--YS
EIF3D_ARATH       SDKLGR--VADWTRNLSNPSARPNTGSKSDPSAVFDFSAF---------AIDEGFGLASS
Q9FKV6_ARATH      SEKLGR--VADWTRALSNPSARPHTGSKSDPSAIFDFSAF---------AVDEGFGLTNS
F6HJU0_VITVI      SDKLGR--IADWTRTYNNPSRNPLRNP-SD--SVFDFTG------------DDSFG---A
C5XFY4_SORBI      SDKLGR--IADWTRNPPGPAAF----AAA-RDAVFDFAG-----------LEDSVG----
C5YVW3_SORBI      SDKLGR--IADWTRNPAGPAAF----AAASRDSVFDFTS-----------ADDSL-----
EIF3D_EMENI       GDKLGR--MADWTAD-SKD---RD-RGGRQAY-NRNYRDQ-------QVYGAGS-SSLFA
EIF3D_ASPFU       GDKLGR--MADWTGD-GKD---RD-RSGRQAY-NRNYRDQ-------QVYGAGT-SSLFN
C0P0X7_AJECG      GDKLGR--MADWATE-GKDG--RDGRGGRQAY-NRIYRDQ-------QVYGAGT-SSLFS
C7YK22_NECH7      GDKLGR--MADWTAE-GKD---RE-RGGRAQY-NRNFRDQ-------QVYGSSH-AVTFN
EIF3D_NEUCR       GDKLGR--MADWTAD-SKDG--RDGRGGRQQY-NRNFRDQ-------QIYGAGS-TSIFA
EIF3D_SCLS1       GDKLGR--MADWTAE-GKDG--RDGRGGRQQY-NRNYRDQ-------QVYGAGT-SSLFA
EIF3D_PHANO       GDKLGR--MADWTE--GKD---RE-RGGRQQYGNRNYRDQ-------QVYGANQQTNPFA
EIF3D_USTMA       NDKVGR--IADWNNA-SGAS--NDAANARGGRQGRARDVQ-------QNFGTSAASSAFA
EIF3D_SCHPO       GDRLGK--IADWSVDQPKDG--REQRGRQGAFAGRFRDQY-------QTYGYGA-SSIFG
A8NYW9_COPC7      SDKLGR--VADWNELALDG---RQAAQGLSAQANRGVGAAGRRRDGAQAFGSGT-ASAFA
E3KIW0_PUCGT      SDKIGR--IVDWNAESG------QLSVGANAH-QRGFRAN--RGSTREAYGAGQ-GGTFA
EIF3D_CRYNJ       SDKITR--IADWHDPQA--------EAAAGTRTARTVQSG----GRRTAYGAAE-GTVFG
EIF3D_YARLI       GDKLGK--VADWAAETKDG------KDQKRTQFGKNFRDP------YHAYGASS-ASFFT
A9UR66_MONBE      TDRIAT--AADFVSSMGP----------RAARTNRIYGDG-----------------EAF
Q4UB08_THEAN      LEKQIH--ICDFTFSTYQ----------RNVREGNRVNRL-------------------N
Q4MYQ4_THEPA      LDKQIH--ICDFTFSTYQ----------RNAREGNRLNRV-------------------N
A7AM33_BABBO      FDRQLR--VCDFTYFTYQ----------KNIRDAGRYGRQP------------------V
B3L3L2_PLAKH      FEKIGK--ICDFTSGSYQ----------KNVKDANK-NSNE------------------G
A5K7A0_PLAVS      FEKIGK--ICDFTSSSYQ----------KNVKDANK-NSNE------------------G
Q7RGS7_PLAYO      FEKIGK--ICDFTTTSYQ----------KNIKDINK-NSGD------------------G
Q8IJW4_PLAF7      FERIGK--VCDFTMNSYQ----------KNTKDINK-NSND------------------V
Q5CPM5_CRYPI      IDRLGA--VCDFSYTSYS----------RGRDAKSS------------------------
                   ..       .                                                 

EIF3D_DICDI       FKLEDDEDSFTLVDYTRVQNKLK-----------NKGKT-------YQKQFYQQNKR---
F0Z618_DICPU      FKLEDDEDSFKLVDYTRVSAKLK-----------NKGKT-------YQKQFYQQSKR---
D3B418_POLPP      FKLDEDEDSFQLVDYSRPSANKGQYKQGRRQLGGGQQQQ-------QQRGFYGQRQG---
EIF3D_CAEBR       YIHGMDEHNFQLVDTSKPMARNPQRNFRVRQMHLRKMMQ-------KEVEKREMVNQ---
EIF3D_CAEEL       YIHGMDEHNFQLVDTSKPMARNPQRNFRVRQMHLRKMMQ-------KENEKREMVNQ---
W5JBM2_ANODA      YFHEEDETTFHLVDSARIQKP--PHQRGRFRGNMRNNRS-------GRGRGARGG-----
EIF3D_ANOGA       YFHEEDETTFHLVDSARIQKP--PHQRGRFRGNMRNNRS-------GRGRGARGG-----
EIF3D_AEDAE       YYHEEDETTFHLVDSARIQKQ--PHQRGRFRGNLRNQR--------GRGRGGRGG-----
EIF3D_BOMMO       YFHDEDESTFHLVDTTRVQKPYQSYQRGRARGQ--------------RGRGARGA-----
EI3D1_DROME       YYHEEDETTFHLVDTARVQKP--PHQRGRFRNMRN-SRS-------GRGRNARGG-----
EI3D1_DROPS       YYHEEDETTFHLVDTARVQKP--PHQRGRFRNMR--GRG-------GRGRNPRGG-----
E0VST5_PEDHC      YYHEEDESTFHLVDTTRVQKP--PYQRGRFKQNRP---N-------LRGRGGQRG-----
EI3D2_DROME       YFYEDDDSTFHLVDTTGSKAT-KPYQRGRYRPNMRNNVR-------SRGRTGRGTPN---
EI3D2_DROPS       YFHEDDESTFHLVDTSGFKGF-RPFQRGRFRGNTRNNPR-------TRGRTGRGG-A---
E9H2T3_DAPPU      YLHDEEENSFQLVDTARTPRP--MYARGRFLRNQR---L-------ARGRQNFRN-----
EIF3D_DANRE       YFHEEDEASFQLVDTAKTQKT--AYQRNRMRF-AQRNLR-------RDKDRRTLTQF---
H3BVT8_TETNG      YFHEEDETSFQLVDTAKTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNLTQF---
G1RX45_NOMLE      YFHEEDESSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
EIF3D_PONAB       YFHEEDESSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
EIF3D_HUMAN       YFHEEDESSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
H0WLV6_OTOGA      YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRTLR-------RDKDRRNMLQF---
EIF3D_BOVIN       YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
EIF3D_MOUSE       YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMVQF---
EIF3D_RAT         YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMVQF---
G1PTA3_MYOLU      YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
G1LSW8_AILME      YFHEEDETSFQLVDTARTQKT--AYQRNRMRF-AQRNLR-------RDKDRRNMLQF---
EIF3D_XENTR       YFHDEDETSFQLVDTTKMQKT--AYQRNRLRF-AQRNLR-------RDKDRRNMLQF---
H2ZWM9_LATCH      YFHEEDETSFQLVDTAKTQKT--AYQRNRMRF-AQARAS-------R-------------
C3Z7P9_BRAFL      YYHEEDESSFQLVDTTKTPKP--LYQRNRQRYNQQRNMR-------RERERREQQRA---
B7PYZ6_IXOSC      YYHEEDESTFQLVDTARMHKP--LHQRGRFRMNQQRNMR-------SRERQKMVQQQ---
EIF3D_NEMVE       YYHEEDETSFQLVDTSRTQRP--GYMRNRNRFNQRGGYR-------RDNRGGRFQGQ---
B3RPZ1_TRIAD      YYHDQDD-TFKLVDTNTRKDK---HGHRRYMYNRQRYNR-------RQVYNTHGNRD---
EIF3D_ARATH       GGNPDEDAAFRLVDGKPPPRP---KFGPKWRFNPHHNRN-------QLPQRRDEE-----
Q9FKV6_ARATH      GGNADEDAAFRLVDGKPPPRP---KFGPKWRFNQYHNRN-------QLPQRRDEE-----
F6HJU0_VITVI      GIAADEDSSFRLVDGKPPPRP---KFGPKWRFQQQR----------QLPQRRDEE-----
C5XFY4_SORBI      -LASADDSSFRLVDGKPPPRHP--RFGPRWRFQQRP----------QLPQRRDEE-----
C5YVW3_SORBI      -IAGAEDSSFRLVDAKPPPRPQ--RFGPKWRFNQRQ----------QLPQRQDEE-----
EIF3D_EMENI       VQVAEDESTFSVVDNTRTSAK-RTFGRGGG-TVFRGRAQ----RGGAGQRGGRAGFQ---
EIF3D_ASPFU       IQVAEDESSFSVVDNTRTSTK-RTFARGGG-TVFRGRGQ----RG-VGQRGGRAGFQ---
C0P0X7_AJECG      VQVAEDESSFSVVDNTRSSTKTRGFGRGGG-TVFRGRGQ----RGGPGQRG-RGGFQ---
C7YK22_NECH7      APPAEDESTFSVVSNVRDSTK-TRYGRGA--VFTRGRGR--GQGQAGGARGGRTQFQ---
EIF3D_NEUCR       PPVAEDESSFSVVSNVKDTGK-TRFGRGA--VFTRGRGQRGGAGAQAGRGGGRQTFQ---
EIF3D_SCLS1       VQLAEDESTFSVVSNTRDSTK-TRFGRGG--TFTRGRGQ---RGGRADTRGGRGQFQ---
EIF3D_PHANO       IQAAEEEATFSVVDNTRTSTRTRGFGRGGGTVFGRGRGQ----RGGQAQRGGRGTFQ---
EIF3D_USTMA       YFHGDDEASFSVVDNTRTVAS----RRGGLGQMSQ--------RGGRGGRGGAGGAG---
EIF3D_SCHPO       YQHSEDESSFSVIDRGSVNRTRTSARNGGTLLKVRGRGQ------NVQRGGRGGRYG---
A8NYW9_COPC7      YFHAEDESSFSLVDNKATAPR-RGTGFSRGRGGVRGTSY----TSRGGARGGRGG-----
E3KIW0_PUCGT      YFHDEDEASFNLVGGGTGSNR-GTGGLMGLNRGARGRGS----NLRGTAGRGRGAGGRLE
EIF3D_CRYNJ       FVHDEDEKSFSLVDSGVRVG-------ARGKAPIRGRSV----RGVASARGARGR-----
EIF3D_YARLI       NEDAEELSSFSVVDNAKNANK---PRGTATVLKTRGGAP------RGGSFAGRGGSQ---
A9UR66_MONBE      AYYHDDDSSFRLVDTAKARPTFRTQKKWQNKNRRHVRTD---------------------
Q4UB08_THEAN      STSMDEELQFQTVDSRTIVKIKPTTHYKKKTPIKQ-TTQAF-------------------
Q4MYQ4_THEPA      STSMDEELQFQTVDSRTIVKIKPTTHYKKKTPIKQ-TTQAF-------------------
A7AM33_BABBO      PVVVDEEMQFQTVDGRSLMKAKNMQHYRRKAVPKQ-TTQAF-------------------
B3L3L2_PLAKH      -NALEDEQQFQTVDLRAGQKQKGPMYNKKKIMNKQ-TTQAF-------------------
A5K7A0_PLAVS      -NAFEDELQFQTVDLRAGQKQKGPMYGKKKIMNKQ-TTQAF-------------------
Q7RGS7_PLAYO      DNAFEEELQFQTVDLRTGQKPKGTLFNKKKIINKQ-TTQAF-------------------
Q8IJW4_PLAF7      -NAFEEELQFQTVDLRTGQKQKGSIFNKKKIHNKQNTTQAF-------------------
Q5CPM5_CRYPI      ---QADNQDFHLVDSRPFPKTKVRYVQRKFQKETAQAYHQK-------------------
                       :   *  :.                                              

EIF3D_DICDI       -GGSNAGGRGGRGGM----RGGRFGSNNKYWNDRRQR---------NRESSIEILSSWES
F0Z618_DICPU      -GGSSNRG-AARG------RGGRYA--NKYWNDRRQR---------NRESSIEIGSSWES
D3B418_POLPP      -GRVILDRHSGRGSHGGRKQGGNRYNNRYHWNDRRQK---------NRESSIEIGADWEL
EIF3D_CAEBR       -TTNLRMKRSIAKEQQRAFKMWQRRGGNARQGQRGQGGRFGGDRPKERLPSVQVRPEWGV
EIF3D_CAEEL       -STNLRMKRSIAKEQQRAFKMWQRRGGNARQGQRGQGGRFGGDRPKERLPSVQVRPEWVV
W5JBM2_ANODA      ----VQVG---GMTTLSKSASKLRDQR--RGTTRKWG--MRGPPPKIRDASVTVRPDWVT
EIF3D_ANOGA       ----VQVG---GMTTLSKSANKMRDQR--RGTTRKWG--MRGPPPKIRDASVTVRPDWVT
EIF3D_AEDAE       ----VQAG---GMTTLSKNATKGRDQR--RGTTRKWG--AR-PPPKIRDASVAVRPDWVT
EIF3D_BOMMO       ----RTPG---GMTTLNKPRE--------RKLGKRWG--QRGAPMKIRDASVTVRPTWVT
EI3D1_DROME       ----LNTH---GMTTLSGKNVKARDPRHGRGMGKKFG--HRGPPPKMRESSVAVRADWAS
EI3D1_DROPS       ----LNNHHHHGMTTLNGKNVKARDTR--RGMGKKFG--HRGPPPKMRESSVAVRADWAS
E0VST5_PEDHC      ----TTSQLQLLTKGPKLRDKKVQQKKWSRQPGLRNQ--KNQPPIKNRDASVTVRADWVT
EI3D2_DROME       -IASLGGSTAGGATASTTKYGKGRNTRNTQNMGRRFG--RN-APTRIRESSVMVQSDWVS
EI3D2_DROPS       -VTGTGGNQPGVGVNERTKYGKGR--DNRRQMGRRFG--RN-APTRMRESSVVVRSDWVS
E9H2T3_DAPPU      ----SQPVPLKGGKMKDNRMRQTRNKWNNRGPRQ------GQIQVKNRESSVIVQPSWKI
EIF3D_DANRE       -NMQTLPKSAKQKERDR--MRLQKKFQKQFGVRQKWD-QKSQAQLKPRDSSVEVRSDWEV
H3BVT8_TETNG      -NMQTLPKSAKQKERER--MRLQKKFQKQFGVRQKWD-QKSQAQLKPKDSSVEVRSEWEV
G1RX45_NOMLE      -NLQILPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_PONAB       -NLQILPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_HUMAN       -NLQILPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
H0WLV6_OTOGA      -NLQALPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_BOVIN       -NLQTLPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_MOUSE       -NLQTLPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_RAT         -NLQTLPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
G1PTA3_MYOLU      -NLQTLPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
G1LSW8_AILME      -NLQTLPKSAKQKERER--IRLQKKFQKQFGVRQKWD-QKSQ---KPRDSSVEVRSDWEV
EIF3D_XENTR       -NMQTLPKSAKQKERDR--LRLQKKFQKQFGVRQKWD-QKSQAQLKPRDSSVEVRSDWEV
H2ZWM9_LATCH      ---------VRSIFLDR--LRLQKKFQKQFGVRQKWD-QKSQAQLKPRDSSVEVRSDWEV
C3Z7P9_BRAFL      -AAQSAPLSKTQKSRERDRMRLQKKLQKQFGGRQRWNDRNQQVQTKNRDASIEVRPDWKV
B7PYZ6_IXOSC      -QLQVLSKSAKGRERER--MQQVRKWQKQM--RQKFD-NKGQVPVKHREASVNVRPTWKV
EIF3D_NEMVE       -GGNMGMQNLSRGRDTR--NKFQRKMQRNWGGGRHWS-DKKTGGMHKRVASVTVREEWKV
B3RPZ1_TRIAD      -RPLTIINLQFSLLRDN---RQRKKQKHYYSYGRGHH---QQPQAKHRTASVEVLYNWKE
EIF3D_ARATH       ----VEAKKRDAEKERARRDRLYNNNRNNIHHQRR--------EAAAFKSSVDIQPEWNM
Q9FKV6_ARATH      ----VEAKKREAEKDRARRDRLYNNNRNNIHQQRR--------EAAAFKSSVDIQPEWNM
F6HJU0_VITVI      ----VEARKREAEKERARRDRLYNLNRSGGNNQRR--------EAAVFKSSVDIQPEWNM
C5XFY4_SORBI      ----VEARRREAEKERARRDRHWQQNRRTHHQFNRGG-----PSSSSAKPSVDIQPEWSV
C5YVW3_SORBI      ----VEARRRLAEKERARRDRHFQNNRSHHHSNFRFN-----QPLNSAKPSVDIQPDWTM
EIF3D_EMENI       -RVGAGRG--QGGDRYYDNRGARGN-----RG-RRFGWKDYDKPQRTREPSVNIRPDWSM
EIF3D_ASPFU       -RVGAGRG--QGGDRYYDNRSARSN-----RG-RRFGWKDYDKPQRTREPSVNVRPDWTM
C0P0X7_AJECG      -RVGAGRGGQPGGDRYYDNRGGRGG-----RG-RRFGWRDYDKPQRNRDSSVHIRTEWNM
C7YK22_NECH7      -RTG-AGGR-QGYGGYD--RGGRSNT--GARG-RRFGWKDYDKPARNRDASINVKAEWKL
EIF3D_NEUCR       -RTG-RGGQ-QYGGGYDGGRGGRQNT--GARG-RRFGWKDYDKPQRNRDASINIKGDWKL
EIF3D_SCLS1       -RVGGRGGQ-QGYSSYDT-RGGRG----GARGGRKFGWKDYDKPQRNRDASVNIKPDWKM
EIF3D_PHANO       -RVGGRGGQ------QYDSRGGRGG----GRGGRRFGWRD-DKPQRNRDASVQVKPEWTV
EIF3D_USTMA       -AAGGRGASKFGAGAGRGARGGRGGAAGARRGGGRFGWKEWDKPQRIREASVTVGQDWEQ
EIF3D_SCHPO       -SSGGRGAGDTVVSRSSGAGGARG---------RRFGWKDYDKHQRLRNASVTVGDDWQL
A8NYW9_COPC7      -TSGGRGG--------MQRTVASG-----RRGWRDWE-----KNNRTRESSVVISPSWQV
E3KIW0_PUCGT      RGSGARGG--------AGRRGGQW-----GRGGGTWKGDWGDRNSRIRESTVVIGQDWQV
EIF3D_CRYNJ       --GGQRGG--------FSTRGGRGGA---RGGYGDWN-----KPQRTRDSSVTIGPEWEV
EIF3D_YARLI       -----RGGRFQNQPGRGPVGGQRGPN--PRFGKSKFGWRDFDKPQRIRNASVDITDDWTE
A9UR66_MONBE      ---PNRGVQQLAYNKNRERDRRALERKLQKKWGQTAQRRFDRNISRKLEASLDVRPSWEL
Q4UB08_THEAN      -----NQKVMEEEQLQFSKQKQYPEVRRQKYIAKNRSLRLPTRYHPLNEWSIEPTPAWNV
Q4MYQ4_THEPA      -----NQKVMEEEQLQFSKQKQYPDLRRQKYIAKNRSLRLPTRYHPLNEWSIEPTPAWNV
A7AM33_BABBO      -----NQKQMEEEAMIMSAKQKHPEMRKQRMMHS-RGNRPTARHHTFNEWSIEPSHSWHL
B3L3L2_PLAKH      -----AQK-QEEENNLYSSRIKTAEQKKQKLLQQAKTARMNARHRIFTEWSIEPTPVWTV
A5K7A0_PLAVS      -----AQK-QEEENNLYSSRIKTAEQKKQKLLQQAKTARMNARHRIFTEWSIEPTPVWTV
Q7RGS7_PLAYO      -----TQK-QQEEDNLYSSRIKTAEQKKQKMLQQAKTARLNARHRIFTEWSNEPTPSWTV
Q8IJW4_PLAF7      -----TQK-QQEEDNLYSSRIKTAEQKKQKLLQQAKTARINARHRIFTEWSIEPTPLWTV
Q5CPM5_CRYPI      -----QQQQEKAEMLLRQGKRSAKMRQAGTQQYQYSRHRFVSRMRTLTEWSIEPLSSWIS
                                                                    :      *  

EIF3D_DICDI       KE--EFDLSTFKQYTVEQLPEPETIG--TYGQVKYYNKVYDRIN--AKNEKKLQK-TENS
F0Z618_DICPU      KE--EFDLQTFKQYTLENLPESETIG--TYGKVKYYNRVYDRIN--TKNEKKLQK-SEVN
D3B418_POLPP      KE--EIDLTVLKQYVIEVIPQSELIA--TCGAVRYYNKDIERVN--ARDERKLQR-TDKE
EIF3D_CAEBR       LE--EMNLSAFSKLALPNIPGGEDIGDHQYGSLQYYDKTVDRVS--VKNSVPLQR-CAGV
EIF3D_CAEEL       LE--EMNLSAFSKLALPNIPGGDDIGDHQYGSLQYYDKTIDRVS--VKNSIPLQR-CAGV
W5JBM2_ANODA      IE--EMDFPRLSKLSLPSVKEGEDI--MTCGTLEYYDKGYDRVN--VKNEKPLQS-VDRI
EIF3D_ANOGA       IE--EMDFPRLAKLSLPSVKEGEDI--MTCGTLEYYDKTYDRVN--VKNERPLQS-VDRI
EIF3D_AEDAE       VE--EMDFPRLSKLSLPNVEKGEDI--TTCGTLEYYDKTYDRVN--VKNEKPLQR-VDRI
EIF3D_BOMMO       IE--DMDFPRLAKLSLPGIKEGEDI--VSCGTLEYYDKAYDRVN--VKHEKPLQR-IDRI
EI3D1_DROME       IE--EMDFPRLIKLSLPNIKEGVDI--VTCGTLEYYDKTYDRIN--VKNEKPLQK-IDRI
EI3D1_DROPS       IE--EMDFPRLIKLSLPNIKDGVDI--ATCGTLEYYDKTYDRIN--VKNEKPLQK-IDRI
E0VST5_PEDHC      IE--EMDFPRLAKLSLPNVKEGVDI--MCCGSLEYYDKAYDRVN--VKNEKPLQR-IDRI
EI3D2_DROME       IE--EIDFPRLLKLALPNIKDGKDI--ATCGWLEFYDKLYDRVN--LRNEKPLQK-MDRV
EI3D2_DROPS       IE--EIDFPRLLKLSLPNVKEGQDV--VTCGSLEYYDKTYDRIN--VKNERPLLK-TDRI
E9H2T3_DAPPU      IE--EMDFPRLNKLSLRLSKEASDL--LTCGELEFYDKQYDRVT--VKNERRLQR-IDRI
EIF3D_DANRE       KE--EMDFPRLMKMRYMDVADPLDI--ECCGALEHYDKAFDRIT--TRNEKPLKS-IKRI
H3BVT8_TETNG      KE--EMDFPRLMKMRYMEVADPVDI--ECCGALEYYDKAFDRIT--TRNEKQLKS-IKRI
G1RX45_NOMLE      KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_PONAB       KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_HUMAN       KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
H0WLV6_OTOGA      KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_BOVIN       KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_MOUSE       KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_RAT         KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
G1PTA3_MYOLU      KE--EMDFPQLMKMRYLEVSEPQDI--ECCGGLEYYDKAFDRIT--TRSEKPLRS-IKRI
G1LSW8_AILME      KE--EMDFPQLMKMRYLEVSEPQDI--ECCGALEYYDKAFDRIT--TRSEKPLRS-IKRI
EIF3D_XENTR       KE--EMDFPRLMKMRYMEVSDPLDI--ECCGALEFYDKAFDRIT--TRNERPLKS-IKRI
H2ZWM9_LATCH      KE--EMDFPRLMKMRYLDVSEPQDI--ECCGSLEYYDKAFDRIT--TRNERTLKS-IKRI
C3Z7P9_BRAFL      LE--EMDFPRLTKLRMPDIDEPTEI--VQCGVLEYYDKSYDRVN--TKNERRLAR-VNRI
B7PYZ6_IXOSC      LE--EMDFPRLFKLSLPGVGEGKDV--YQCGAVEFYDKAYNLVT--CKNEKPLQR-VNRI
EIF3D_NEMVE       LEDGELDFPRLSKLNLPNVEEPETL--YECGSVEYYDKAYDRVT--TKNEVPLVG-VNRV
B3RPZ1_TRIAD      FD--EISFAQLSKLNLPDVGQPEDL--YCCGSMEYYDKSYDRVN--VRNEKPLLP-VNRT
EIF3D_ARATH       LE--QIPFSTFSKLSYTVQE-PEDLL--LCGGLEYYNRLFDRIT--PKNERRLERFKNRN
Q9FKV6_ARATH      LE--QIPFSTFSKLSFTVSE-PEDLL--LCGGLESYDRSFDRIT--PKADRRLERFKNR-
F6HJU0_VITVI      LD--QIPFSTFSKLSFSVPE-PEDLL--LCGALEFYDRSYDRVT--PKNERRLERFKNRN
C5XFY4_SORBI      KE--QIPFSSFSKLSFAVADQPEDLL--VCGAVEFYDRTYDRVT--PRAERRLERFKSRN
C5YVW3_SORBI      RE--QIPFANFTKLSFSVADQPEDLL--LCGAVEFYDRAYDRVN--PKAARRLERFKSRN
EIF3D_EMENI       LE--EVDFNRLSKLNLQAP---EGEDVDTYGFLYYYDRSYDKAP--VKNAERRLQALDRA
EIF3D_ASPFU       LE--EVDFNRLSKLNLEAP---EGEDLDSYGFLYYYDRSYDKAP--VKNAERKLQALERA
C0P0X7_AJECG      RE--EIDFTRLAKLNLETP---DGEDIDNYGFLYYYDRTYDKPP--VRNTERKLQSLDRA
C7YK22_NECH7      LE--EIDFNRLAKLNLDTD---DGEDIDDYGFLYYYDRSYDKPP--VKGTERKLTPIDRA
EIF3D_NEUCR       IE--EIDYNRLSKLNLETD---EGEDVDDYGFLYAYDRSYDKPV--VKNAERRLAAIDRA
EIF3D_SCLS1       LE--EIDFNRLAKLNLDTD---DGEDIDSYGFLYYYDRAFDKQP--VKAAERKLNVVDRA
EIF3D_PHANO       ME--EIDFSRLGKLNLDTG---DGEDLENYGFLYYYDRSYDKQPG-AKTSERRLNVLERA
EIF3D_USTMA       VE--EIDFVRLGKLRLEVE---EPQDISSYGSLFEYDRSYDRVT---VKTAQSLSSIDRI
EIF3D_SCHPO       LD--EVEFSHLSKLNLAAA---APVTVDSYGYIYPYDKSFDKIH---VKSEKPLQALDRV
A8NYW9_COPC7      LE--EIEFHRLAKLRLEVD---EPDELDSYGRIFAYDKTYDRIT---TKTERPLQLVDRI
E3KIW0_PUCGT      LE--EIEFSRLAKLRLEVDV-DAAEDVSTHGFLYEYDRTYDRIN---TKNPQPLQILDRS
EIF3D_CRYNJ       LE--EIDFNRLSKLSLSVE---DPEDLASYGTVQAYDKTFDRIN---TRNEKPLEIVNRV
EIF3D_YARLI       IQ--EITYSEMQKLSYDVA---QGVEIDTYGDLFPYDRKFDRTN-----NITKLAHLGRT
A9UR66_MONBE      LE--DIEFAKFAKFKTAIPEVSDYK---KAGELYFLDQAKEKTVPKRPVEVPPDFTGEYD
Q4UB08_THEAN      VA--EIPFNVLLKQEMNSSLVTVEDL-FWRGKLGIYDRKMDQITPKSEVYLLHLSNSYDY
Q4MYQ4_THEPA      VA--EIPFNILLKQEMDSSQVTVEDL-FWRGKLGIYDRKMDQITPKNEVYLLHLSNSYDY
A7AM33_BABBO      LS--DIPFSQLSKVDL-PGKVVGTDV-TWRGKLGVYDKRMDHISAKSEVPLQNLNDQFDY
B3L3L2_PLAKH      EC--EVMFNELPKKLIKMENFQMQDI-YFRGRLLYYDKKFENINVKNPPGLVNQNKDNNY
A5K7A0_PLAVS      EC--EVMFNELPKKLIKMENFQMQDI-YFRGRLLYYDKKFENINVKSPPGLVNQSKDSIN
Q7RGS7_PLAYO      DC--EIMFNELPKKLIKIDHLKIEDI-FFRGKVLYYDKRFENINVKNPPFLAHLNKDANV
Q8IJW4_PLAF7      EC--EIMFNELPKKIIKIDNLKVEDL-FFKGKSLFYDKKIENINVKNPPLLFHHTKEGIN
Q5CPM5_CRYPI      VA--EIPLSSLPKQFLDVSKSTIEDI-GWFGTLKSYNKSMDRISPKLPMVLKDFGN-MEF
                      :.    : :                 *     ::  :                   

EIF3D_DICDI       VPLIPTSDDKVIRSEYMNGN----------------------------------------
F0Z618_DICPU      VPLIPTSDDKVIRSEYMNGN----------------------------------------
D3B418_POLPP      IPLISTSDDKVIRTNFKFAN----------------------------------------
EIF3D_CAEBR       YYNVTTTEDPVIQELAQGGVG---------------------------------------
EIF3D_CAEEL       FYNVTTTEDPVIQELAQGGAG---------------------------------------
W5JBM2_ANODA      FHTVTTTDDPIIRQLSKAHG----------------------------------------
EIF3D_ANOGA       FHTVTTTDDPIIRQLSKTHG----------------------------------------
EIF3D_AEDAE       FHTVTTTDDPVIRLLSKSHG----------------------------------------
EIF3D_BOMMO       FHTVTTTDDPVIRRLSKTAG----------------------------------------
EI3D1_DROME       VHTVTTTDDPVIRRLSKTVG----------------------------------------
EI3D1_DROPS       VHTVTTTDDPVIRRLSKTVG----------------------------------------
E0VST5_PEDHC      FHTVTTTDDPIIRKLSKTEG----------------------------------------
EI3D2_DROME       VHTVTTTDDPVIRRLSRTMG----------------------------------------
EI3D2_DROPS       IHTLTTTDDPVIRRLSKTIG----------------------------------------
E9H2T3_DAPPU      FHKVTTTDDPIIRKLAKTEG----------------------------------------
EIF3D_DANRE       FHTVTTTDDPVIRKLAKTQG----------------------------------------
H3BVT8_TETNG      FHTVTTTDDPVIRKLAKTQG----------------------------------------
G1RX45_NOMLE      FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_PONAB       FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_HUMAN       FHTVTTTDDPVIRKLAKTQG----------------------------------------
H0WLV6_OTOGA      FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_BOVIN       FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_MOUSE       FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_RAT         FHTVTTTDDPVIRKLAKTQG----------------------------------------
G1PTA3_MYOLU      FHTVTTTDDPVIRKLAKTQG----------------------------------------
G1LSW8_AILME      FHTVTTTDDPVIRKLAKTQG----------------------------------------
EIF3D_XENTR       FHTVTTTDDPVIRKLAKTQG----------------------------------------
H2ZWM9_LATCH      FHTVTTTDDPVIRKLAKTQG----------------------------------------
C3Z7P9_BRAFL      FHKVTTTDDPVIRQIAKSHG----------------------------------------
B7PYZ6_IXOSC      FHKVTTTDDPIIRQLAKTEGQT--------------------------------------
EIF3D_NEMVE       FHKVTTTDDPIISKLLSQGN----------------------------------------
B3RPZ1_TRIAD      FHKVTTTDDPIIRKLTSKGN----------------------------------------
EIF3D_ARATH       FFKVTTSDDPVIRRLAKEDK----------------------------------------
Q9FKV6_ARATH      SFKVTTSDDLVIRRLAKEDK----------------------------------------
F6HJU0_VITVI      FFKVTTTDDPVIRRLANEDK----------------------------------------
C5XFY4_SORBI      FFKVTTTDDPVIRRLAENDT----------------------------------------
C5YVW3_SORBI      FFKVTTTDDPVIRRLAEEDK----------------------------------------
EIF3D_EMENI       AYNVTTSQDPVIQELAEKNQ----------------------------------------
EIF3D_ASPFU       AYNVTTSQDPVIQELAEKNE----------------------------------------
C0P0X7_AJECG      AYNVTTTADPIIQELAEKDE----------------------------------------
C7YK22_NECH7      AYNVTTSSDPVIQELADKDE----------------------------------------
EIF3D_NEUCR       AYNVTTSSDPVIQELAEKDE----------------------------------------
EIF3D_SCLS1       SYNVTTSSDPVIQELAEKDE----------------------------------------
EIF3D_PHANO       AYNVTTSSDPILQELSDKDE----------------------------------------
EIF3D_USTMA       RYNTTTSEDPVIHDISAKED----------------------------------------
EIF3D_SCHPO       HYNPTTTEDPVIQKLALNSD----------------------------------------
A8NYW9_COPC7      KYNPTTSDDPVIQQLVSKNV----------------------------------------
E3KIW0_PUCGT      RYHPTASEDPIIQELAAQNK----------------------------------------
EIF3D_CRYNJ       RYNPSTSDDPIISQYAEKKE----------------------------------------
EIF3D_YARLI       VFNTTTSEDPIMQELAKDPA----------------------------------------
A9UR66_MONBE      PFSVPASEDPVLQKIDRIGR----------------------------------------
Q4UB08_THEAN      YWTSTHDDDCIADVLLETYKTSPSKPFDSEDRNGLNSENDFDSPDKKQTGNMPLQGDSAS
Q4MYQ4_THEPA      YWTSTHDDDCIADVLLETYKTSPSKPLESEYQNGVEGEDEFDSGDKKQAGNMPLQGDSAS
A7AM33_BABBO      YWTSTNDDDCIMDYLLSTQRQ--------------------ESADAG-------------
B3L3L2_PLAKH      LVCKTMDDESLMQILHDEDKKVKAAAG-------------SDGMSSS-------------
A5K7A0_PLAVS      LVCKTMDDQSLMEILLDEDKKSKAAAAVA-----------EDGVNSS-------------
Q7RGS7_PLAYO      LVCKASDDQTLMEILDNEEKKAK-------------------ENNST-------------
Q8IJW4_PLAF7      LIPKTKEDHNLINILNNENKNKIISNE-------------EDPNNIN-------------
Q5CPM5_CRYPI      LQPTTSDDEILRDALLQPERN---------------------------------------
                      .   . :                                                 

EIF3D_DICDI       ------------------VYATDSILAVLMSAQKSVYSWDIVVQKVGA-RLFFELRPGTS
F0Z618_DICPU      ------------------VYATDSILAILMSAQKSVFSWDIVVQKVGA-RLFFELRPGTS
D3B418_POLPP      ------------------VYATDEIMSTLMTANRSVYSWDIVVIRIGG-KIFFEHRPGTT
EIF3D_CAEBR       -----------------NVFGTDIILATLMTAPRSVYSWDIVAYRIGD-KLFFDKRNTKD
EIF3D_CAEEL       -----------------NVFGTDIILATLMTAPRSVYSWDIVAYRVGD-KLFFDKRNTRD
W5JBM2_ANODA      -----------------NVYATDAILATIMCCTRSNYSWDIVIEKIGD-KLFMDKRDNTE
EIF3D_ANOGA       -----------------NVYATDAILATIMCCTRSNYSWDIVIDKIGG-KLFMDKRDNTE
EIF3D_AEDAE       -----------------NVYATDAILATIMCCTRSNYSWDIVIEKIGD-KLFMDKRDNTE
EIF3D_BOMMO       -----------------TVYATDAILATIMCCTRSNYSWDIVIEKIGD-KLFLHKRDNTE
EI3D1_DROME       -----------------NVFATDAILATIMCSTRSNYSWDIVIEKVGD-KVFMDKRDHTE
EI3D1_DROPS       -----------------NVFATDAILATIMCSTRSNYSWDIVIEKVGD-KIFMDKRDHTE
E0VST5_PEDHC      -----------------NVYATDAILAAIMCSTRSNYSWDIVIEKIGH-KLFFDKRDNTE
EI3D2_DROME       -----------------NVFATDEILSTIMCCTRSNYSWDVVVEKLGT-KVFLDKRYNDQ
EI3D2_DROPS       -----------------NIFATDEILATIMCCTRSNYSWDVVFDKVGN-KIFLDKRDNAQ
E9H2T3_DAPPU      -----------------NVYATDSILATLMCSIRSNYSWDIIVQKVGG-KLFFDKRDDSE
EIF3D_DANRE       -----------------NVFATDAILATLMCCTRSVNSWDIIVQRVGN-KLFFDKRDNSD
H3BVT8_TETNG      -----------------NVFATDAILATLMCCTRSVNSWDIIVQRVGN-KLFFDKRDNSD
G1RX45_NOMLE      -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_PONAB       -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_HUMAN       -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
H0WLV6_OTOGA      -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_BOVIN       -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_MOUSE       -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_RAT         -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
G1PTA3_MYOLU      -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
G1LSW8_AILME      -----------------NVFATDAILATLMSCTRSVYSWDIVVQRVGS-KLFFDKRDNSD
EIF3D_XENTR       -----------------NVFATDAILATLMCCTRSVNSWDIVVQRVGS-KIFFDKRDNSD
H2ZWM9_LATCH      -----------------NVFATDAILATLMCCTRSVYSWDIVVQRVGS-KVFFDKRDNSD
C3Z7P9_BRAFL      -----------------NVYATDIILATLMCCTRSVYSWDIVVQRVGS-KLFFDKRDDSE
B7PYZ6_IXOSC      ----------------NKIFATDAIVACLMCAGRSVYSWDIVVQRVND-KLFFDKRDDSE
EIF3D_NEMVE       ------------------VFATDAIISTLMTCTRSNYSWDIVVQRVGS-KLFFDKRDDSE
B3RPZ1_TRIAD      ------------------VFATDAIIATLMTCSRSVYPWDIVAHRVRD-KLFLDKRDDSG
EIF3D_ARATH       ----------------ATVFATDAILAALMCAPRSVYSWDIVIQRVGN-KLFFDKRDGSQ
Q9FKV6_ARATH      ----------------ATVFATDAILAALMCAPRSVYSWDLVIQRVGN-KLFFDKRDGSP
F6HJU0_VITVI      ----------------ATVFATDSILSTLMCAPRSVYSWDIVIQRVGN-KLFFDKRDGSQ
C5XFY4_SORBI      ----------------ATVFATDTILAALMCAPRSVQSWDIVIQRVGN-KLFFDKRDGSQ
C5YVW3_SORBI      ----------------ATVFATDAILAALMCTPRSIQSWDMVVQRVGN-KLFLDKRDGSQ
EIF3D_EMENI       ----------------ATIFATSDILSMLMCAPRSVYSWDIVIVHQGN-KIYFDKREGAS
EIF3D_ASPFU       ----------------ATVFATSDILSMLMCAPRSVYSWDIVIVHQGD-KIYFDKREGAS
C0P0X7_AJECG      ----------------ATVFATADILSMLMCAPRSVYSWDIIIIQQGN-KIYFDKRDNAS
C7YK22_NECH7      ----------------ATIFATDSILSMLMCATRSVYPWDIVISRHGN-KVFLDKRDNAA
EIF3D_NEUCR       ----------------ATIFATDNILSMLMCAPRSVAPWDIVISRQGN-KIFFDKRDNAA
EIF3D_SCLS1       ----------------ATIFATDSILSMLMCSPRSVYPWDIVIVRQGN-KVFLDKRDNAT
EIF3D_PHANO       ----------------ATVFATDNVLSMLMCATKSVYSWDLVFSRKGN-KVFIDKRDGSN
EIF3D_USTMA       ----------------AQIYMTDSILALLMCATRSVYSWDVIITKTADGKVFFDKRDGGA
EIF3D_SCHPO       ----------------ANIFITDSILSLLMCSTRSVYPWDIVITHQSG-KLFFDKREGGP
A8NYW9_COPC7      ----------------GNVYTTDIILSVLMCAPRSVYPWDIVIVREGN-NLFFDKRDGGP
E3KIW0_PUCGT      ----------------AQVFTTDSVLSLLMCATRSVYPWDIVIIKEGG-KLFLDKREGGP
EIF3D_CRYNJ       ----------------AQIFATDSILAVLMCAGRSVNSWDIIIEHRNG-QVFFDKRESGP
EIF3D_YARLI       ----------------NRIFITDTILSQIMCTTKSVAPWDIVITKKGE-QLFFDKREGGP
A9UR66_MONBE      ----------------ANVFATDDVLATFMAATRSHYSWDIVATKKDG-KIYFDKRPGAV
Q4UB08_THEAN      YDQAMKVERDLMRYDKIVLAATDQILSVLMTAGRSKHSWHLNVTKIEN-QIIIDKANGSI
Q4MYQ4_THEPA      YDQAMKVERDLLRYDKIVLAATDQILSVLMTAGRSKHSWHLNVTKIEN-QIIIDKANGSI
A7AM33_BABBO      --------------DHIILGATDQILAVLMTAARSKYSWHLNVTKIDN-KIIIDKANGSI
B3L3L2_PLAKH      ---------------NIIVVSTDQVLSCLMSAAQSKYSWHLLITKEGN-KIIIDKDEDSI
A5K7A0_PLAVS      ---------------NIIVVSTDQILSCLMSAAQSKYSWHLLITKEGN-KIIIDKDEDSI
Q7RGS7_PLAYO      ---------------GLIIVSTDQILSCLMSCVHSKYSWHLIIKKKGN-RIIIDKDDDSI
Q8IJW4_PLAF7      ---------------NIIVISTDQILSCLMSCVQSKYSWHLLIKKKGN-QIIIDKDDDSI
Q5CPM5_CRYPI      ----------------IDVAITDQILACLVAAAQSKYSWHILVTNVDG-KLIFDKQDGSI
                                    :  *  ::: ::   :*  .*.:   .    .: :.      

EIF3D_DICDI       -----EHLTVNENLTAHHQD----------------DKDPINTTSSLSQEATQVNLNYWQ
F0Z618_DICPU      -----EQLTVNENVSSHQ-D----------------EKDPINTSASLSSEATQINLNYWQ
D3B418_POLPP      -----NTLTVNETSNSHY-D----------------DKDPVNSASALSNEAAEVNINYWQ
EIF3D_CAEBR       ILNPVETLTVSETSAEPPSF----------------DGNGLNNARDLATEAFYINQNFRR
EIF3D_CAEEL       ILNPVETLTVSETSAEPPSF----------------DGNGINNAKDLATEAFYINQNFRR
W5JBM2_ANODA      ----FDLLTVNETASEPPQE----------------DGSSLNSPRNLAIEATFINHNFSQ
EIF3D_ANOGA       ----FDLLTVNETASEPPQE----------------DGNSLNSPRNLAIEATFINHNFSQ
EIF3D_AEDAE       ----FDLLTVNETAIEPPNE----------------DGNSLNSPRNLAIEATFINHNFSQ
EIF3D_BOMMO       ----FDLLTVNETSVEPPAD----------------DGNSINSPRNLALEATFINHNFSQ
EI3D1_DROME       ----FDLLTVNESSVEPPTD----------------DDSSCNSPRNLAIEATFINHNFSQ
EI3D1_DROPS       ----FDLLTVNESSVEPPTD----------------DDSSCNSPRNLAIEATFINHNFSQ
E0VST5_PEDHC      ----FDLLTVNETSVEPPQD----------------DGNSFNSPRNLALEATFINHNFSQ
EI3D2_DROME       ----FDLLTVNETSVEPPMD----------------EEGSINSAHSLAMEATLINHNFSQ
EI3D2_DROPS       ----FDLLTVNETALEPPLE----------------EEGSINSPHSLAMEATLINHNFCQ
E9H2T3_DAPPU      ----FDLLTVSETSNEPPQE----------------EG--INSPRNLALEATFINHNLSQ
EIF3D_DANRE       ----FDLLTVSETANEPPQD----------------EGSSLNSPRNLAMEATYINHNFSQ
H3BVT8_TETNG      ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
G1RX45_NOMLE      ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_PONAB       ----FDLPTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_HUMAN       ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
H0WLV6_OTOGA      ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_BOVIN       ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_MOUSE       ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_RAT         ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
G1PTA3_MYOLU      ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
G1LSW8_AILME      ----FDLLTVSETANEPPQD----------------EGNSFNSPRNLAMEATYINHNFSQ
EIF3D_XENTR       ----FDLLTVSETANEPPQD----------------DVNSLNSPRNLAMEATYINHNFSQ
H2ZWM9_LATCH      ----FDLLTVSETANEPPQE----------------EGNSFNSPRNLAMEATYINHNFSQ
C3Z7P9_BRAFL      ----FDLLTVSETATEPPQD----------------EGASINSPRNLALEATFINHNFSQ
B7PYZ6_IXOSC      ----FDLLTVNETASEPPHE----------------EGNSINAPRNLALEATFINHNFSQ
EIF3D_NEMVE       ----FDLLTVGETANDLNID----------------ETSGINTPTNLSLEATFINQNFSQ
B3RPZ1_TRIAD      ----FDLLTVNETSYDPPPD----------------DEDGINSAQSLALEATIINQHFSQ
EIF3D_ARATH       ----LDLLSVHETSQEPLPE----------------SKDDINSAHSLGVEAAYINQNFSQ
Q9FKV6_ARATH      ----LDLLSVHETSQEPLPE----------------GKDDINSAHSLGLEAAYINQNFAQ
F6HJU0_VITVI      ----LDLLSVHETSQEPLPE----------------AKEDINSAYSLSVEAAYINQNFSQ
C5XFY4_SORBI      ----LDLLTVNETAQEPLPE----------------AKEDINSAHSLAVEATYVNQNFSQ
C5YVW3_SORBI      ----LDLLTVNETAQEQLPE----------------NKDDINSAHSLAVEATYINQNFSQ
EIF3D_EMENI       ----LDLVTVNENAADAPLEVAESSG----------KQESINTPSALALEATFINHNFAL
EIF3D_ASPFU       ----IDLVTVNENAADAPVETADSSG----------KQESINTPSALALEATFINHNFAL
C0P0X7_AJECG      ----IDLVTVNENAQDAPLEASEAGGA---------KQDSINTPGALAIEATVINHNFAL
C7YK22_NECH7      ----LDMVTVNENAIDAPLDAADGSK------------DTINQPNALAEEATYINHNFAN
EIF3D_NEUCR       ----LDLVTVNENAADAPLDASEGSK------------DGINQPHALAEEATFINHNFAN
EIF3D_SCLS1       ----LDMVTVNENAADAPMDASEGSK------------DAINQPSALAEEATYINHNFAN
EIF3D_PHANO       ----LDMVTVNENAADAPLEISEGNK------------DSINSPGALMLEATHINNVFPL
EIF3D_USTMA       ----FDYLTVNENAADPPSEASEGKENE-----AAAKANAINTPSALSLEATYINQNFAF
EIF3D_SCHPO       ----FDYLTVNENAYDSPMDADNREG--------------VNSPGALSVEATYINQNFCV
A8NYW9_COPC7      ----FDTVTVNENAADPPQDPTPPNPNNPNEKPVVPETASINTATSLSLEATYINQNFGF
E3KIW0_PUCGT      ----FDFLSVNENAADPPAESDKPD--------------SPNTPSALSLEATFINQNFGL
EIF3D_CRYNJ       ----LDYITVNENAADPPVDSDDVS--------------NINSAGSLSLEATYISHNFSS
EIF3D_YARLI       ----LDFITVDENAADPPADSTDKDN--------------INSSANLGFEATLINQNFAS
A9UR66_MONBE      ----IDMLSVDETAFQPPSD----------------EGDSPNAPGNLSVEATHVNQMFKD
Q4UB08_THEAN      ----IDMLTVNETAPDPPQPD---------------CEIKINRPSSLRYEAVKVNQNLRQ
Q4MYQ4_THEPA      ----IDMLTVNETAPDPPQPD---------------CEIKINRPSSLRYEAVKVNQNLRQ
A7AM33_BABBO      ----IDMLTVNETSPEPPLPD---------------AEIKINRPPALGYEAVKVNQCLRQ
B3L3L2_PLAKH      ----VDLLTVNENSIDAPTQD---------------NENKINSLQALGFEAIKINQRFRK
A5K7A0_PLAVS      ----VDLLTVNENSIDAPTQD---------------NENKINSLQALGFEAIKINQRFRK
Q7RGS7_PLAYO      ----IDLLTVNENSLDAPTQD---------------SENKINSLQALGLEAVKINERFKN
Q8IJW4_PLAF7      ----IDLLTVNENSIDAPTQD---------------NENKINSLQALGIEAVKINQRFRK
Q5CPM5_CRYPI      ----IDLITVNETSAEPPLPD---------------NVNKNNRPHLLGLEALKSNQNYTQ
                       :  :* *.                            *    *  **   .     

EIF3D_DICDI       QVLSQNV-------EPFKFDNELPEGDEFENCVDVGYAYKKWDLGDD------------I
F0Z618_DICPU      QVLSSDA-------EPVALDNELPEGEEFENTVDVGYAYKKWDLGDD------------I
D3B418_POLPP      QVLTND--------EPHKFETQLDE-EEYENCVPVGYRYMKWNLGDD------------I
EIF3D_CAEBR       QVVKRNE---PGFTFKNVRVPFEDEETGDA--TGTAYKYRKWNLGNGVDG-------KPV
EIF3D_CAEEL       QVVKRND---AGFTFKNARAPFEDEETGE---SGTAYKYRKWNLGNGVDG-------KPV
W5JBM2_ANODA      QVLKSGEKE-PKYKFEHPN-PFIGDDEDGE-VASVAYRYRKWDLNNG------------I
EIF3D_ANOGA       QVLKSGEKE-PKYKFQQPN-PFIGDDEDGE-VASVAYRYRKWDLNNG------------I
EIF3D_AEDAE       QVLKSGEKE-PKYKFDQPN-PFIGDDEDGE-VASVAYRYRKWDLNNG------------I
EIF3D_BOMMO       QVLKSGPTE-PKYKFQEPN-PFVSEQEDGE-VASVGYRYRKWILNNG------------V
EI3D1_DROME       QVLKTGDQE-PKYKFEESN-PFISEDEDIQ-VASVGYRYKKWELGSD------------I
EI3D1_DROPS       QVLKTGDQE-AKFKFEEPN-PFISEDEDIQ-VASVGYRYKKWELGSD------------I
E0VST5_PEDHC      QVLKTG--E-PRYNFEEKN-PFISEEEEGE-VASVAYRYRKWDLDNG------------I
EI3D2_DROME       QVLRIGDQE-PRFMFEEPN-PFE--EPGVD-LASIGYRYRQWDLGND------------V
EI3D2_DROPS       QVLRGGDQK--KYQFEEPY-TLE--ESGVD-LVSIGYRYKQWDLGNN------------I
E9H2T3_DAPPU      QVLKMG--E-EKFKLDEPN-PFISEDEVGE-VASVAYRYRKWDLDGG------------V
EIF3D_DANRE       QCLRMGG---ERYKFPNPN-PFVEEDTEKSEVASVAYRYRRWKLGED------------I
H3BVT8_TETNG      QCLRMGS---ERYKFPNSN-PFVEEDMDQSEVASVAYRYRHWKLGED------------I
G1RX45_NOMLE      QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
EIF3D_PONAB       QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
EIF3D_HUMAN       QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
H0WLV6_OTOGA      QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
EIF3D_BOVIN       QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
EIF3D_MOUSE       QCLRMGR---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
EIF3D_RAT         QCLRMGR---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
G1PTA3_MYOLU      QCLRMGK---ERYNFPNPN-PFVEDDMDKNEIASVAYRYRRWKLGDD------------I
G1LSW8_AILME      QCLRMGK---ERYNFPNPN-PFVEDDMDKNEVASVAYRYRRWKLGDD------------I
EIF3D_XENTR       QCLRMGK---EKHTFPNPN-PFIEDDVDKNEVASVAYRYRRWKLGDD------------I
H2ZWM9_LATCH      QCLKMGG---EKYKFPNPN-PFVEEDMDKNEVASVAYRYRRWKLGDD------------I
C3Z7P9_BRAFL      QVLKMGS--SEVYRFNKPN-PFVTDE-DEGEVASVAYRYRKYKLGND------------I
B7PYZ6_IXOSC      QVLKMGE---EKHSFENPN-PFIQED-EEGEVASVAYRYRKFDLGDG------------V
EIF3D_NEMVE       QVLKRGE----VKTFDHPN-PFVTDEDDST-VASVCYRYRKWDLGDG------------I
B3RPZ1_TRIAD      QVLKKGE----RFEFDKPN-PFVQEEEDSD-VASVGYRYRKWVLKKDDAA--------AI
EIF3D_ARATH       QVLVRDG---KKETFDEAN-PFANEGEEI---ASVAYRYRRWKLDDN------------M
Q9FKV6_ARATH      QVLVKNG---KRETFDEPI-PNVNEGEEN---ASIAYRYRRWKLDDS------------M
F6HJU0_VITVI      QVLIRDG---NKVTFEEPN-PFANEGEEV---ASVAYRYRRWKLDDD------------M
C5XFY4_SORBI      QVLLRNG---EKVTFDEPN-PFATEGEEA---ASVAYRYRRWKLDDE------------T
C5YVW3_SORBI      QVLHRNG---EKVTFDEPN-PFASEGEEA---ASVGYRYRRWKLNDE------------I
EIF3D_EMENI       QTVVEANN---AKVDFNHPNPFYNAEEETEPLASKGYKYRRFDLSLESDE-------EPL
EIF3D_ASPFU       QTVVESEE---SKVTFNHPNPFYNAAEETEPLASKGYKYRRFDLSLQDDE-------EPL
C0P0X7_AJECG      QTVIESET---SKVDFANPNPFYNPSEETEPLASKAYKYRRFDLSLEKDE-------EQL
C7YK22_NECH7      QVVNESES---AKATMAHANPFYNSSEDTDPPASKAYKYRRFDLSTN-EE-------EPV
EIF3D_NEUCR       QVVVENES---EKVNMAHENPFYNASEENVPPASKAYKYRRFDLSTS-EE-------EST
EIF3D_SCLS1       QVMKESDS---QKVEMEHENPFYNPSEETDPPASKAYKYRKFDLSLN-DE-------DPV
EIF3D_PHANO       QVVSESDT---NKVNMTHEHPFYNEEVETDPPASKAYRYRRFDLSLEKDD-------EPL
EIF3D_USTMA       QVVNE--K---NVYKLEHENPFYS-SDETAPLASCAYRYRKFNLSSE-ES-------DPV
EIF3D_SCHPO       QALRETEE---EKYKLPHPNPFYNSKEQSEPLAAHGYIYRDVDLSLETDE-------KPV
A8NYW9_COPC7      QTVIETPPP--PAIDFAHANPFYGPD-ETEPLASCGYRYRLFDLGIT-ED-------EDI
E3KIW0_PUCGT      QVVKEDPK---TAYQFEQPNPFYGPD-ETEPCASAGLRYRSFDLSLS-EE-------EEM
EIF3D_CRYNJ       QVSANSKS---KAYTP-NPNPFYSPEVESEPPASTLYKYRKFDLSID-EE-------EQF
EIF3D_YARLI       NAITEDPK----SKVSYKANPFSNND---SNVLCHAYKYKKFNLSDDPEG-------APL
A9UR66_MONBE      FAVNKSG---------PKKEMKSAHDFKEEADMSVAYRYRVWDLGSG------------I
Q4UB08_THEAN      QVLLQDE------YAETFLDPPFVEES-DNPA-TIAYRYRKFTLPGTPNATNFE--KLPI
Q4MYQ4_THEPA      QVLLQDE------YSETFLDPPFVEES-DNPA-TIAYRYRKFTLPGTPNATNFE--KLPI
A7AM33_BABBO      QVLVSGQ------FSDEFELPPFVEEG-DNPS-TMAYRYRTFMVPGDNHGHGWS--RVPI
B3L3L2_PLAKH      QVLLKNE------QAEQFDNASFTAPN-CRNF-DVLYRYRKITIP--PIVHGSS--KKNC
A5K7A0_PLAVS      QVLLKNE------QAEQFDNASFTAKN-CKNF-DVLYRYRKILVP--PIVNGSS--KKKC
Q7RGS7_PLAYO      HVQLNNQ------IAEQYDNTSFNSKQ-CNNNSNILYRYRKINLP--PLIHGSS--KTNC
Q8IJW4_PLAF7      QVILKND------IAEEFEPGNFNIKN-IKIN-DILYRYRKFQIP--PLVQSNN--KKTY
Q5CPM5_CRYPI      NIQIFGDEG----IIKQFEPIPFSEENQDTNIESKCYRYRIFSLPPRAGASSSENAQKTV
                                                        *    :                

EIF3D_DICDI       VVLARTEIDGVVEGLPGQPP---------KFISIKAINEHDSNRFG-----IEFRKKLDS
F0Z618_DICPU      VVLARTEIDAAIEDASGEP----------KFISIKAINEHDSNRFG-----IEFRKKLDT
D3B418_POLPP      TVLARTEVDGCYVDK-DQTT---------KFVSIKATNEFDKRDQS-----TDFRKNIDN
EIF3D_CAEBR       ELVCRTELDGVIHGLGNET----------QTLTIKAFNEWDSSQAG----GVDWRTKLDV
EIF3D_CAEEL       ELVCRTELDGVIHGLGNET----------QTLTIKAFNEWDSTQSG----GVDWRTKLDV
W5JBM2_ANODA      TLVARCEHDGVLKVPHGDI----------QFLTIKALNEWDSKIAN----AVEWRQKLDT
EIF3D_ANOGA       TLVARCEHDAVLKMPQGDT----------QFLTIKALNEWDSKIAN----AVEWRQKLDT
EIF3D_AEDAE       ELVARCEHDAVLLTPQGDT----------QFLTIKALNEWDSKVAN----GVEWRQKLDT
EIF3D_BOMMO       VLIARCEHDAVMQGPQGET----------QFLTIKALNEWDSKLAN----GVEWRQKLDT
EI3D1_DROME       VLVARCEHDGVLQTPSGEP----------QFMTIKALNEWDSKLAN----GVEWRQKLDT
EI3D1_DROPS       VLVARCEHDGVLQTPSGEP----------QFMSIKALNEWDSKLAN----GVEWRQKLDT
E0VST5_PEDHC      VLIARCEHDAVMQMPNGDI----------QFLTIKALNEWDSKLSG----GVEWRQKLDT
EI3D2_DROME       VLIARCKHNGVIQGPNGDV----------QFLSIKALNEWDSKVTN----SVEWRQKLDT
EI3D2_DROPS       ILIARCKHNGVLQGPNGEV----------QFLSIRALNEWDSKASN----SLEWRQKLDT
E9H2T3_DAPPU      VLVARCEHDAVTVGSAGDN----------QFINIKALNEWDSRLSG----GVEWRQKLDT
EIF3D_DANRE       DLIVRCEHDGVMTGANGEV----------SFINVKTLNEWDSRYCN----GVDWRQKLDS
H3BVT8_TETNG      DLIVRCEHDAVMTGAKGEV----------SFINVKTLNEWDSRYCN----GVDWRQKLDS
G1RX45_NOMLE      DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_PONAB       DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_HUMAN       DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
H0WLV6_OTOGA      DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_BOVIN       DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_MOUSE       DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_RAT         DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
G1PTA3_MYOLU      DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
G1LSW8_AILME      DLIVRCEHDGVMTGANGEV----------SFINIKTLNEWDSRHCN----GVDWRQKLDS
EIF3D_XENTR       DLVVRCEHDGFMTGANGEV----------SFVNIKTLNEWDSRYCN----GVDWRQKLDS
H2ZWM9_LATCH      DLIVRCEHDGVMTGAGGEV----------SFINMKTLNEWDSRHCN----GVDWRQKLDS
C3Z7P9_BRAFL      ELVVRCEHDGSMLGPNGET----------QFINIKTLNEWDSRFSNK---NVEWRAKLDS
B7PYZ6_IXOSC      GLIVRCERDGAMVGPNGEL----------QFVSVKALNEWDPRFSG----GIDWRQKLDT
EIF3D_NEMVE       QLIVRCEHDAIMQGPRGET----------CLVNIKTLNEWDPKMTG-----VDWRQKLDS
B3RPZ1_TRIAD      ELIVRCEHDAVWVTASSEP----------TFMNIKALNEYDPQVIK----AEYWRKKLDT
EIF3D_ARATH       HLVARCELQSV-ADLNNQR----------SFLTLNALNEFDPKYSG-----VDWRQKLET
Q9FKV6_ARATH      YLVARCELQST-VDLNNQR----------SFLTLNALNEFDPKYSG-----VDWRQKLET
F6HJU0_VITVI      YLVARCEVQSV-VEVNKQR----------SFLTLNALNEFDPKYSG-----VDWRQKLET
C5XFY4_SORBI      SLVARCEVHAVNTDPRGER----------QFLTLNALNEFDPKVTG-----VDWRKKLET
C5YVW3_SORBI      SLVARCEVHAVNVDPSGGR----------QFITLNALNEFDPKITG-----VDWRQKLET
EIF3D_EMENI       NMIVRTEVDALVKNPVNGEDQ---------QLVVKALNEFDSKAQG-SGGSLDWRSKLYS
EIF3D_ASPFU       NMIVRTEVDAVMKNPVGGEDQ---------HLIVKALNEFDSKAPG-SGGALDWRSKLWS
C0P0X7_AJECG      QLIVRTEVDAVVKNNISGDDQ---------YLTIKALNEFDHKSQG-AGGALDWRTKLVS
C7YK22_NECH7      HLIVRTEVDAVQKNAISGDDQ---------LVSIHALNEFDSKAQG-SGGALDWRSKLVT
EIF3D_NEUCR       FLVVRTEIDAVQKNATDGKNQ---------LVTVHALNEWDSKAQG-AGGALDWRTKLAS
EIF3D_SCLS1       HLVVRTEIDAVSKNAISGEDQ---------YLTVKALNEFDSKAQG-SGGALDWRTKLVS
EIF3D_PHANO       HLIVRTELDAVVKNNINGEDQ---------YLTIKALNEFDNKAQG-SGGALDWRSKLAS
EIF3D_USTMA       ELVVRTEVDAYTVGASK-EKQ---------LITIKSLNEFDARAQG-AGGALDWRLKLDS
EIF3D_SCHPO       KLMVRTEVDGYVKNPAN-DVQ---------YISIKALNEYDPKFTN-VTGSVDWRSKLES
A8NYW9_COPC7      RLCVRTEVDAYS--PGQGNPREGQG-----LVTIRALNEFDPRAQG-SGGAPDWRTKLDS
E3KIW0_PUCGT      TLIIRTEVDAVLRGPNATNVKEQGGNDEDSFITIRTLNEFDSNSQG-SGGAPNWRAKLDT
EIF3D_CRYNJ       SVILRTEADAYL---GKKEV----------LVTVKALNEYDPRVQGGSGKPLDWRKNLDT
EIF3D_YARLI       NLILRTEVDALGPDGTT--------------LNLRVLNEYGS---------SEWKNKFNT
A9UR66_MONBE      QLAARTQHDAMATGKDGKS----------EYCSVNTLLERVGKGTT-----LDWRTVLAS
Q4UB08_THEAN      LVITRCEVHSKLQGTDT-------------YAYVCALNECPNKNNK------SWRSQIET
Q4MYQ4_THEPA      LVITRCEVHAKLQGTDT-------------YTYVCALNECPNKNNK------SWRSQIET
A7AM33_BABBO      HVITRGEVHARIPGVSNG-----------GYTYVCALNELPHKTQK------SWRIQIET
B3L3L2_PLAKH      TLITRGEIHSKLKGTAN------------SYVYICALNEYDIKSHK------NWRSQIEN
A5K7A0_PLAVS      TLITRGEIHSKLKGTAN------------SYVYICALNEYDIKSHK------NWRSQIEN
Q7RGS7_PLAYO      TIITRGEIHSKIKGSNN------------AYVYICSLNEYDIKSHK------NWRSQIEN
Q8IJW4_PLAF7      TLITRGEIHSQIKGLNK------------SYVYVCALNEYDIKSHK------NWRSQIEN
Q5CPM5_CRYPI      RVAIRTEIDAQIPNAESENS---------GFIFARALNEYDPKTVK------TWNTQLET
                   :  * : ..                            *              :.  :  

EIF3D_DICDI       QRAAILATEIKNNSTKFAKWSIQSTLAGCEMLNLG-FVSRDSIRDNNNHVILGTQFYPVA
F0Z618_DICPU      QRAAILATEIKNNSTKFAKWSIQSTLAGCEMMNLG-FVSRDSVRDNNNHVILGTQFYPVA
D3B418_POLPP      QRASVLANEMKNNSTKFAKWSIQSTLAGVETMNLG-YVSRYYQGDPTNHVVLASQNYSVS
EIF3D_CAEBR       QKGAVMATEIKNNSAKVAKWTLQALLAGSDTMKLG-YVSRNNARSTQNHSILNTQYVKPT
EIF3D_CAEEL       QKGAVMATEIKNNSAKVAKWTLQALLAGSDTMKLG-YVSRNNARSTQNHSILLTQYVKPT
W5JBM2_ANODA      QRGAILANELRNNSCKLAKWTVQALLAGSDQIKFG-YVSRAHVRDSSKHVILGTQQFKPH
EIF3D_ANOGA       QRGAILANELRNNSCKLAKWTVQALLAGSDQLKFG-YVSRAHVRDSSKHVILGTQQFKPQ
EIF3D_AEDAE       QRGAVLANELRNNSCKLAKWTVQALLAGSDQIKFG-YVSRAHVRDSSRHVILGTQQFKPQ
EIF3D_BOMMO       QRGAVLANELRNNSCKLAKWTVQALLAGSDQIKFG-YVSRAQVRDNSRHVILGTQQFKPH
EI3D1_DROME       QRGAVLANELRNNACKLAKWTVQAVLAGSDQLKLG-YVSRINPRDHSRHVILGTQQFKPH
EI3D1_DROPS       QRGAVLANELRNNACKLAKWTVQAVLAGSDQLKLG-YVSRINPRDHSRHVILGTQQFKPH
E0VST5_PEDHC      QRGAVLANELRNNACKLAKWTVQALLAGSDQIKFG-YVSRAHVRDSSKHVILGTQQYKPN
EI3D2_DROME       QRGAVLASELRNNACKLARWTVEAVLAGSDQLKLG-YVSRMNPRDHLRHVILGTQQFKPQ
EI3D2_DROPS       QHGAVLASELRNNACKLARWTVESVLSGSDQLKLG-YVSRVSTRDHLRHVILRTQQFKPQ
E9H2T3_DAPPU      QRGAVLANELKNNACKLAKWTVQALLANSDWIKFG-YVSRMHLRDTSRHVILGTQQFRPS
EIF3D_DANRE       QRGAVLATELKNNSYKLARWTCCAILAGSEYLKLG-YVSRYHVKDSSRHVVLGTQQFKPN
H3BVT8_TETNG      QRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGCYVSRYHVKDSARHVILGTQQFKPN
G1RX45_NOMLE      QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_PONAB       QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_HUMAN       QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
H0WLV6_OTOGA      QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_BOVIN       QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_MOUSE       QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_RAT         QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
G1PTA3_MYOLU      QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
G1LSW8_AILME      QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHVILGTQQFKPN
EIF3D_XENTR       QRGAVIATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRCHVKDSTRHVVLGTQQFKPN
H2ZWM9_LATCH      QRGAVLATELKNNSYKLARWTCCALLAGSEYLKLG-YVSRYHVKDSSRHLILGTQQFKPN
C3Z7P9_BRAFL      QRGAVLATELKNNSCKLAKWTASAVLAGSDALKLG-YVSRVNVRDSSKHVILGTQQFNPR
B7PYZ6_IXOSC      QRGAVLANELKNNSCKLAKWTVQALLAGSDQIKFG-YVSRLHVRDSSKHAILGTQQFKPK
EIF3D_NEMVE       QRGAVLATELKNNSCKLAKWTANSILAGSEYLKLG-YVSRVNFLDTSKHTILGTQQFRPR
B3RPZ1_TRIAD      QRGAVLAAELKNNSYKLTKWTASAILAGSQILKFG-YVSRVNPASTSKHVVLGTQQYSSV
EIF3D_ARATH       QRGAVLATELKNNGNKLAKWTAQALLANADMMKIG-FVSRVHPRDHFNHVILSVLGYKPK
Q9FKV6_ARATH      QRGAVLANELKNNGNKLAKWTAQALLANADMMKIG-FVSRVHPRDHFNHVILSVLGYKPK
F6HJU0_VITVI      QRGAVLATELKNNANKLAKWTAQALLASADLMKLG-YVSRVHPRDHFNHVILAVVGYKPR
C5XFY4_SORBI      QRGAVLATELKNNANKLARWTAQALLAGADMMKLG-YVSRLHPRDHYNHSILSVIGYKPR
C5YVW3_SORBI      QRGAVLATELKNNANKLARWTAQALLAGADMMKLG-YVSRVNPRDHYNHSVLTVMGYKPR
EIF3D_EMENI       QRGAVVATEMKNNSCKLARWTTQAILAKADGMKLG-FVSRANPRSAAAHVVLGVAGYKPR
EIF3D_ASPFU       QRGAVVATEMKNNSIKLARWTTQAILAKADAMKLG-FVSRANPRSATSHVILGVVGYKPR
C0P0X7_AJECG      QRGAVVATEMKNNSCKLARWATQAILAKADMMKLG-FVSRANPKSASAHIILGVVGYKPR
C7YK22_NECH7      QRGAVVATEMKNNSCKLARWTVQSILAKADFMKLG-FVSRLNPRSNDKHVVLGVVGWKPR
EIF3D_NEUCR       QRGAVVATEMKNNSCKLARWTVQSILAKADVMKLG-FVSRVNPKVNDKHVILGVVGWKPK
EIF3D_SCLS1       QRGAVVATEMKNNSCKLARWTVQSIIAKADVMKLG-FVSRANPKLNDRHVILGVIGWKPR
EIF3D_PHANO       QRGAVLATEMKNNSCKLARWAVQSILAKADTMKLG-FVSRTNPKNNNDHVILGVLTNKPR
EIF3D_USTMA       QRGAVVATEMKNNSFKLARFAVQSLLAGADSMKLG-YISRANPKDTSRHMILGTSWLKPR
EIF3D_SCHPO       QRGAVFATEMKNNSCKLARWTVEALLAGVDSMKVG-FVSRSNARDAQHHGILGVVAYKPA
A8NYW9_COPC7      QRGAVVATEMKNNSCKLAKWTVQSILAGADLMKIG-YVSRANPRDNTRHVVLSTTSIRPT
E3KIW0_PUCGT      QRGAVVATEMKNNSCKLAKWAVQSILAGADQMKMG-YISRANPRDASRHVILGQQWLKPK
EIF3D_CRYNJ       QKGAILASEMKNNSAKFARWAIQSILAGVEQMKMG-YISRANPRDAQRHTIVGVQSFKPL
EIF3D_YARLI       GRGAIIAAELKHNLNKISRWTVQSILGDVDQMKIG-FASRVSPKDNTQHNIIGVVSREPK
A9UR66_MONBE      QKTAVLASQLKDNAFKLARWTICSLLGNNSTMRLG-YVSRANPASPRKHVLLKVDSFRTE
Q4UB08_THEAN      QKGALLANEIRNNTTKLQRFVACANMAGCGVFKLA-YVTRRSPNDAENHSIIGIHTHTTQ
Q4MYQ4_THEPA      QKGALLANEIRNNTTKLQRFVACANMAGCGVFKLA-YVTRRSPNDAENHSIIGIHTHTTQ
A7AM33_BABBO      QKGALLANEMRNNTAKMQRFAACAIISGCDTLKLA-YVSRRSPGDAEHHSIIGIHTYTTE
B3L3L2_PLAKH      QKGALLANEIRNNTSKLQKFICQALISGCEDIKLG-FISRKNANDAENHNILSIQSHKTK
A5K7A0_PLAVS      QKGALLANEIRNNTSKLQKFICQALISGCEDIKLG-FISRKNANDAENHHILSIQSHKTK
Q7RGS7_PLAYO      QKGALLANEIRNNTYKLHKFICQALLSGCDDIKLG-FISRKNANDYENHNILSIQSHKTK
Q8IJW4_PLAF7      QKGALLANEIRNNTSKLQKFISQALLSGCDDVKLG-FISRKNANDPDNHHILSIQSHKTK
Q5CPM5_CRYPI      QKGALLATEIRNNACQLTKWATQALLSSCDILKLG-YIVRRTPNDRESHQIISVQSYKTK
                   : ::.* :::.*  :. ::   : :.    .... :  *        * ::        

EIF3D_DICDI       DLNKQNGVDMKNCWGILKHIAQTCMKLAN-----------GKYLLHRDPNRNVINLYSVP
F0Z618_DICPU      DLNKQNGVDMKNCWGIIKHIAQTCMKLAN-----------GKYLLHRDPNRNVITLYSVP
D3B418_POLPP      SLNSQNRVDMRNTWGIFKRIVQSCMKLPN-----------GKYLLHRDPNRAVVNIYAVP
EIF3D_CAEBR       EFASNIALNMDNCWGILRCVIDSCMKQKP-----------GKYLLMKDPQSPVIRLYSLP
EIF3D_CAEEL       EFASNIALNMDNCWGILRCVIDSCMKQKP-----------GKYLLMKDPQSPVIRLYSLP
W5JBM2_ANODA      EFANQINLSMDNAWGILRCIIDICMKQKD-----------GKYLIMKDPNKPMVRLYDIP
EIF3D_ANOGA       EFANQINLSMDNAWGILRCIIDICMKQKD-----------GKYLIMKDPNKPMVRLYDIP
EIF3D_AEDAE       EFANQINLSMDNAWGILRCIIDICMKQKD-----------GKYLIMKDPNKPMIRLYDIP
EIF3D_BOMMO       EFAAQINLSMDNAWGILRCIIDICMKQKD-----------GKYLIMKDPNKPLIRLYDIP
EI3D1_DROME       EFATQINLSMDNAWGILRCIIDLVMKQKD-----------GKYLIMKDPNKPIIRLYDIP
EI3D1_DROPS       EFATQINLSMDNAWGVLRCIIDLVMKQKD-----------GKYLIMKDPNKPIIRLYDIP
E0VST5_PEDHC      EFATQINLNMDNAWGILRCIIDICMKQKE-----------GKYLIMKDPNKPMIRLYDIP
EI3D2_DROME       EFATQINLNMDNAWGVLRCLIDLVMRQPD-----------GKYLIMKDPNKPMIRLYDVP
EI3D2_DROPS       EFSTQINLSMDNAWGILRCLIDIVMKQPD-----------GKYLLMKDPNKPMVRLYDVP
E9H2T3_DAPPU      DFASQINLNMDNAWGILRCIIDLCMKEED-----------GKYLLVKDPNKPVIRLYKVP
EIF3D_DANRE       EFASQINLSMENAWGILRCVIDICRKLEE-----------GKYLILKDPNKQVIRVYSLP
H3BVT8_TETNG      EFASQINLSMENAWGILRCVIDICRKLDE-----------GKYLILKDPNKQVIRVYSLP
G1RX45_NOMLE      EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_PONAB       EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_HUMAN       EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
H0WLV6_OTOGA      EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_BOVIN       EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_MOUSE       EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_RAT         EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
G1PTA3_MYOLU      EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
G1LSW8_AILME      EFASQINLSVENAWGILRCVIDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
EIF3D_XENTR       EFANQINLSMENAWGILRCVVDICMKLDE-----------GKYLILKDPNKQVIRIYSLP
H2ZWM9_LATCH      EFASQINLSMENAWGILRCVVDICMKLEE-----------GKYLILKDPNKQVIRVYSLP
C3Z7P9_BRAFL      ELAAQINLDMQNAWGI-----------------------------------PVVRIYGLP
B7PYZ6_IXOSC      EFADQINLNMDNAWGILRCIIDNCMKLPE-----------GKYLIMKDPN----------
EIF3D_NEMVE       EFATQIALNMDNAWGVLRCIIDICMKQPE-----------GKLLILKDPSKGVIRIYDIP
B3RPZ1_TRIAD      EFASQINLQMDNAWGILRVIIDTLMSYSE-----------GKYVILKDPNKPMIRLYSVP
EIF3D_ARATH       DFAGQINLNTSNMWGIVKSIVDLCMKLSE-----------GKYVLVKDPSKPQVRIYEVP
Q9FKV6_ARATH      DFAGQINLNTNNMWGIVKSIVDLCMKLSE-----------GKYVLVKDPSKPQVRIYEVP
F6HJU0_VITVI      EFAAQINLNTTNMWGIIKSIVDLCMKLNE-----------GKYVLVKDPSKPQVRIYEVP
C5XFY4_SORBI      DFAAQINLNTANMWGIVKSIVDVCMKLGE-----------GKYVLVKDPVKPQVRLYEVP
C5YVW3_SORBI      DFAAQINLNTANMWGIVKSIVDICMKFEE-----------GKYVFVKDPAKPQVRIYEVP
EIF3D_EMENI       EFAAQMNLNLGNGWGIVRTIVDRIRALDADEEED----KVTKYILVKDPNRPVLRLYSVP
EIF3D_ASPFU       EFAAQMNLNLGNGWGIVRTIVDRIRALDAEEEED----KVKKYVLIKDPNRPVIRLYSVP
C0P0X7_AJECG      EFAAQMNLNLSNGWGIVRTIVDLVRGLEHDDGEDGGDGDVRKFVLVKDPNKPVIRLYQVP
C7YK22_NECH7      DFANQMNLSLNNGWGIVRTIVDMCLSSSD---------QEAKFVLVKDPNKSILRLYEVP
EIF3D_NEUCR       DFANQMNLQLSNGWGIVRTIADMCLKSES---------EDAKFVLVKDPNKNILRLYEVP
EIF3D_SCLS1       DFASQMNLSLSNGWGIVRTIVDMCLKR-----------EEGKYVLVKDPNKPILRLYQVP
EIF3D_PHANO       DFASQMALNLNNGWGIVRTIVDMVLRMDE-----------GKYVLVKDPNKSLLRLYQVP
EIF3D_USTMA       ELAAQMAVNLSNGWGIVRTVADLARKAEQ-----------GKYVLLKDPNKQTIRMYRVP
EIF3D_SCHPO       DLASQMNLSLSNGWGIVRTIADVCLKMPD-----------GKYVLVKDPNRPILRLYSVP
A8NYW9_COPC7      DFAAQLNVSLANGWGIVRTIIDMCMKMPE-----------GKYVLVKDPNKPVIRLYSVP
E3KIW0_PUCGT      DFAAQINVNLSNGWGIVRTAIDLAFKAED-----------GKYLLMKDPNKPVVRLYKVP
EIF3D_CRYNJ       DFARQMNVSLANGWGIVRTIADLVLKQPE-----------GKFVLVKDPNNPLVRLYKVP
EIF3D_YARLI       QFAEQINVNLNNGWGIFKSVVNIATAKDD-----------GKYVLVKDPNNPAVKIYKPA
A9UR66_MONBE      KFAEQIGVNMANGWGIVKSMIVRLQKHGD-----------GQYVLMKDPGEPMLKMYRLP
Q4UB08_THEAN      NLALQMGFSLDNAWGSIKAIVHLIMRRPD-----------GQYVLLKDPMKPIIRLYSVS
Q4MYQ4_THEPA      NLALQMGFSLDNAWGSIKAIVHLVMRRPD-----------GQYVLLKDPMKPIIRLYSVS
A7AM33_BABBO      NLAVQMGLNMRNAWAVVRHICALIMDRPD-----------GQYILVKDPLKANIRFYAAP
B3L3L2_PLAKH      DLSTQIGLKYENIWGILRYIVDIISEKPD-----------GKYVILKDPLKALLRLYCTH
A5K7A0_PLAVS      DLSTQIGLKYENIWGILRYIVDIISEKPD-----------GKYVILKDPLKALLRLYCTH
Q7RGS7_PLAYO      DLSTQIGLKYENIWGILKFIVDNISDRSD-----------GKYVILKDPLKSLLRLYCTH
Q8IJW4_PLAF7      DLSTQIGLKYDNMWGIFRFVIDNLADKPN-----------GNYVILKDPLKPLLRLYCTH
Q5CPM5_CRYPI      ELSAQMGLKEENAWGIVRALVDLLSEQPE-----------GQYVILRTPVKHVLRVYRIP
                  .:  :  ..  * *.                                             

EIF3D_DICDI       ENAFDQIEEETQEEEEE-----------------EQSKGWVEESRE--------------
F0Z618_DICPU      ENAFDQIEEETEEEEEE-----------------EQSKGWVDESRE--------------
D3B418_POLPP      ENAFDPEEEEVQEEEEE-----------------TQNKGWAQSTR---------------
EIF3D_CAEBR       EGTFDSERESSEEENS----------------------DDDQ------------------
EIF3D_CAEEL       EGTFESERESSDEENS----------------------DDDQ------------------
W5JBM2_ANODA      DNTFESDGEEE-EGDDGEPFQP-MYGYSAPASSATGAQSSTTTSTTTPTAAPSAATKNET
EIF3D_ANOGA       DNTFDSDGEGE-EGDDGEAFQP-MYGYSAAASTSANVTAAQSNTSATVPDQSEKASA---
EIF3D_AEDAE       DNTFESDGEEE-EGDDGEAFQTYAYGPSAATTAAATAAANAATAAAAVAAAAAAAAAAAT
EIF3D_BOMMO       DNTFESDASEE-SGDE------------QADTPFAPLYSYGNSKRV--------------
EI3D1_DROME       DNTFDSDDSDDGEGDD---------------EGFQQVYNYAHNKI---------------
EI3D1_DROPS       DNTFDSDDSDDGEGDDG--------------EGFQQVYNYANNSNKI-------------
E0VST5_PEDHC      DNTFDSEGDED-EDDD---------------SRSAIPESYLE------------------
EI3D2_DROME       ENAFDSDGDEEEESSD-------------------PLSNSNDN-----------------
EI3D2_DROPS       ENAFESS-DEDDLSDD-------------------KLFLLSN------------------
E9H2T3_DAPPU      DNTFESDDEAFFEEGE-------------------GL-----------------------
EIF3D_DANRE       DGTFSSDEDEEEDDED------------------EEDEEEDEDN----------------
H3BVT8_TETNG      DGTFSSVDDEEDVQAD------------------EQSVECDEAG----------------
G1RX45_NOMLE      DGTFSSDEDEEEEEEE------------------EEEEEEEET-----------------
EIF3D_PONAB       DGTFSSDEDEEEEEEE------------------EEEEEEEET-----------------
EIF3D_HUMAN       DGTFSSDEDEEEEEEE------------------EEEEEEEET-----------------
H0WLV6_OTOGA      DGTFSSDEDDEEEEEE------------------EEEEEEEET-----------------
EIF3D_BOVIN       DGTFSSDEDDEEEEEE------------------EEEEEEEEA-----------------
EIF3D_MOUSE       DGTFSSEEDEEDEEEE------------------EEEEEEEET-----------------
EIF3D_RAT         DGTFSSEEDEEDEEEE------------------EEEEEEEET-----------------
G1PTA3_MYOLU      DGTFSSDEDDEDEEEE------------------EEEEEEEET-----------------
G1LSW8_AILME      DGTFSSDEDDEEEEEE------------------EEEEAKEET-----------------
EIF3D_XENTR       DGTFSSDEEDDDDDEE------------------EEEEVEEEES----------------
H2ZWM9_LATCH      DGTFSSEEDDEEEEDD------------------DDDDDSQAPFYYVNESRL--------
C3Z7P9_BRAFL      EGTFSSDEDDDDEEES------------------DEEDDDDDDEDDDDDDEKNG------
B7PYZ6_IXOSC      KGSDTRKEPSTLAKPT------------------RGS-----------------------
EIF3D_NEMVE       NSTFETDEEDDDDDED------------------DVENDDGDDEKDEGDGED--------
B3RPZ1_TRIAD      ENTFEDEDGDDYSENE------------------GKFLGYN-------------------
EIF3D_ARATH       PDAFENDYVEEPLPEDEQVQPTEE---------NTEGAEAS--VAATKETEEKKADDAQA
Q9FKV6_ARATH      ADAFDNDYVEEPLPEDEQVQPPEE---------NTDAGAETNGVSSTNVAVEDKKSEVEA
F6HJU0_VITVI      ADAFENDYVEEPLPEDEQVQPPAE---------EANGGEAN----AAITDVEEKEVTAEA
C5XFY4_SORBI      NDAFENDYVEEPLPEEEQVRPFSEDVDATAQEMDAAAEAEATGTTAGAEGDAEKSSDVAA
C5YVW3_SORBI      SDAFENDYVEEPLPEEEQVRPLGE-VDATAEEMDAVAEAEANNASSANGGEGEKSADATV
EIF3D_EMENI       ANAFEEDDEAAEE--EQE-AKGEVEEA---------------------------------
EIF3D_ASPFU       PNTFEEDDEAAEE--QEEKAEDESEE----------------------------------
C0P0X7_AJECG      VNTFDEDEDAGVETVKEEKESDEDEE----------------------------------
C7YK22_NECH7      AGSFDEDDEEEVEVPQGDDE----------------------------------------
EIF3D_NEUCR       AGSLDEEAEELDQVEEDGEEAEE-------------------------------------
EIF3D_SCLS1       AGSFEDDGEG-DVIEENVEEED--------------------------------------
EIF3D_PHANO       LHTFEEEDVEDMQAPNEEDEE---------------------------------------
EIF3D_USTMA       ANFGEENDEIVEEDEADE------------------------------------------
EIF3D_SCHPO       PNTFEEAAGPSLEASSTA------------------------------------------
A8NYW9_COPC7      QDTFVEQDEDEGSEEEDEDEA---------------------------------------
E3KIW0_PUCGT      ENAFDLQEDEEDGEEADEDDELDLGT----------------------------------
EIF3D_CRYNJ       DDTFEAGAEEEE-EEQDEE-----------------------------------------
EIF3D_YARLI       AGF---------------------------------------------------------
A9UR66_MONBE      EEGLAEGIEDDGTEDGQS---------------SSMAAGIFGGSANM-------------
Q4UB08_THEAN      EEEELNQGQPQESK----------------------------------------------
Q4MYQ4_THEPA      EEEEVNSAQPQESK----------------------------------------------
A7AM33_BABBO      EEEDVEYPSKE-------------------------------------------------
B3L3L2_PLAKH      DDENN-------------------------------------------------------
A5K7A0_PLAVS      DDENN-------------------------------------------------------
Q7RGS7_PLAYO      EDD---------------------------------------------------------
Q8IJW4_PLAF7      EDSN--------------------------------------------------------
Q5CPM5_CRYPI      DEESSELPQDEQNHNKE-------------------------------------------
                                                                              

EIF3D_DICDI       ---------------------------------
F0Z618_DICPU      ---------------------------------
D3B418_POLPP      ---------------------------------
EIF3D_CAEBR       ---------------------------------
EIF3D_CAEEL       ---------------------------------
W5JBM2_ANODA      TSA------------------------------
EIF3D_ANOGA       ---------------------------------
EIF3D_AEDAE       TTPAATETVATATTEATTPTTATKTTAPAAAQK
EIF3D_BOMMO       ---------------------------------
EI3D1_DROME       ---------------------------------
EI3D1_DROPS       ---------------------------------
E0VST5_PEDHC      ---------------------------------
EI3D2_DROME       ---------------------------------
EI3D2_DROPS       ---------------------------------
E9H2T3_DAPPU      ---------------------------------
EIF3D_DANRE       ---------------------------------
H3BVT8_TETNG      ---------------------------------
G1RX45_NOMLE      ---------------------------------
EIF3D_PONAB       ---------------------------------
EIF3D_HUMAN       ---------------------------------
H0WLV6_OTOGA      ---------------------------------
EIF3D_BOVIN       ---------------------------------
EIF3D_MOUSE       ---------------------------------
EIF3D_RAT         ---------------------------------
G1PTA3_MYOLU      ---------------------------------
G1LSW8_AILME      ---------------------------------
EIF3D_XENTR       ---------------------------------
H2ZWM9_LATCH      ---------------------------------
C3Z7P9_BRAFL      ---------------------------------
B7PYZ6_IXOSC      ---------------------------------
EIF3D_NEMVE       ---------------------------------
B3RPZ1_TRIAD      ---------------------------------
EIF3D_ARATH       ---------------------------------
Q9FKV6_ARATH      ---------------------------------
F6HJU0_VITVI      ---------------------------------
C5XFY4_SORBI      V--------------------------------
C5YVW3_SORBI      A--------------------------------
EIF3D_EMENI       ---------------------------------
EIF3D_ASPFU       ---------------------------------
C0P0X7_AJECG      ---------------------------------
C7YK22_NECH7      ---------------------------------
EIF3D_NEUCR       ---------------------------------
EIF3D_SCLS1       ---------------------------------
EIF3D_PHANO       ---------------------------------
EIF3D_USTMA       ---------------------------------
EIF3D_SCHPO       ---------------------------------
A8NYW9_COPC7      ---------------------------------
E3KIW0_PUCGT      ---------------------------------
EIF3D_CRYNJ       ---------------------------------
EIF3D_YARLI       ---------------------------------
A9UR66_MONBE      ---------------------------------
Q4UB08_THEAN      ---------------------------------
Q4MYQ4_THEPA      ---------------------------------
A7AM33_BABBO      ---------------------------------
B3L3L2_PLAKH      ---------------------------------
A5K7A0_PLAVS      ---------------------------------
Q7RGS7_PLAYO      ---------------------------------
Q8IJW4_PLAF7      ---------------------------------
Q5CPM5_CRYPI      ---------------------------------