CLUSTAL format seed alignment for MF_03004

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q4UE81_THEAN      -------------------MNESNFPDCHKYDITSKLSPYLEPKMVLYVLDWLSS-----
Q4N5B4_THEPA      -------------------MKESNFPDCHKYDITSKLSPYLEPKMVLYVLDWLSS-----
A7ANK5_BABBO      --------------------MAPSVEEHTPYDITSRISPYLDVEMLLHVLDWLAD-----
Q4Z7U2_PLABA      -----------------------MLTQNDQAYFIGKVCAYLDPHMTQIIFAWLSE-----
Q4XVK1_PLACH      -----------------------MPTQNDQANFIGKVCAYLDPHMTQIIFAWLSE-----
Q7RQ22_PLAYO      ----------------MDEMQNSMPTQNDQAYFIGKVCAYLDPHMTQIIFAWLSE-----
B3L5Y1_PLAKH      -------------------MEINKSSNHDQADLISKICAYLDPHMTQIILSWMKE-----
A5K977_PLAVS      -------------------MEINKSSNNDQTNLISKICAYLDPHMTQIILSWMKE-----
Q8I3I5_PLAF7      ------------------------MEENNNNDLTGKICSYLDPHMVQIILTWLKE-----
B6KDN0_TOXGV      -------------MVSDSNMANGAAPSQGGLGLIKLMSPYWDSHMSIPVMDWMLS-----
EIF3E_DICDI       ----------------------------MEYDLTKQICSFLDAHMMLPLINYLKDT----
F0ZI56_DICPU      ----------------------------MEYDLTKQIWGFLDSHMMLPLVKYLNDT----
D3AVQ5_POLPP      ----------------------------MEHDLTKKICSFLDAHLMLQLVDFLKG-----
EIF3E_CAEEL       ---------------------------MSTFDLTQRMAPFLDLHLIIPLLEFIEP-----
G4M126_SCHMA      ---------------------------MSEFDLTKKISGFLDKHLTLPLLEYISV-----
W5JQD6_ANODA      ---------------------------MAKFDLTAKNCQYLDRHLTFPLLEFLLQ-----
EIF3E_ANOGA       ---------------------------MAKFDLTAKNCQYLDRHLTFPLLEFLLQ-----
EIF3E_AEDAE       ---------------------------MAKFDLTAKNCQYLDRHLTFPLLEFLLQ-----
EIF3E_DROME       ---------------------------MANFDLTRINCQFLDRHLTFPLLEFLCG-----
EIF3E_DROPS       ---------------------------MANFDLTRINCQYLDRHLTFPLLEFLCG-----
EIF3E_BOMMO       -------------------------MSYSKFDLTFKIGQYLDRHLVFPLLEFLAA-----
E0VAQ3_PEDHC      ---------------------------MAEFDLTGKIGQYLDRHLVFPLLEFLSV-----
EI3EA_DANRE       ---------------------------MAEYDLTTKIAHFLDRHLVFPLLEFLSV-----
EI3EB_DANRE       ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_BOVIN       ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
G1QVT7_NOMLE      --------------------------<MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
G1P8X3_MYOLU      ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
H0X2Y0_OTOGA      ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_PONAB       ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_RAT         ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_HUMAN       ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_MOUSE       ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
G1M2D6_AILME      ---------------------------MAEYDLTTRIAHFLDRHLVFPLLEFLSV-----
EIF3E_CHICK       ---------------------------MAEYDLTTKIAHFLDRHLVFPLLEFLSV-----
H3A4A4_LATCH      ---------------------------MAEYDLTTKIAHFLDRHLVFPLLEFLSV-----
EIF3E_XENTR       ---------------------------MAEYDLTTKIAHFLDRHLVFPLLEFLSV-----
H3DDC2_TETNG      ---------------------------MAEYDLTTKIAHFLDRHLVFPLLEFLSV-----
C3Y1L0_BRAFL      ---------------------------MAEWDLTTRMGQYLDRHLVFPLLEFLSV-----
EIF3E_NEMVE       ---------------------------MAEHDLTSKMGCFLDRHLVFPLLEFLSV-----
E9GEY1_DAPPU      ---------------------------MAEHDLTSKLGNYLDQHLVFPLFEFLAV-----
B3S263_TRIAD      ---------------------------MAEFDLSTRIASKLDRHLVFPLLEFLSV-----
F4P7G6_BATDJ      ------------------------------MDLTLKITPFLDKHLILPLIEFQEK-----
EIF3E_ARATH       -----------------------MEESKQNYDLTPLIAPNLDRHLVFPIFEFLQE-----
F6HS75_VITVI      ---------------------------MATHDLTPRIAPNLDRHLVFPLLEFLQE-----
A9TXR1_PHYPA      ---------------------------MAQYDLTARVAPFLDRHLVFPLLEFLQD-----
A9SFG7_PHYPA      ---------------------------MAQYDLTAAVAPFLDRHLVFPLLEFLQE-----
A8JGK5_CHLRE      -------------------------MAATNYELSSKLVQYLDLHLTLPIMEYLQE-----
D0NHD9_PHYIT      ---------MSTHDETDVAAAGVSVPPNAKFDLTNRLAPFMDLHFMFPLIDFLSS-----
EIF3E_EMENI       MAANVPPSAEALTSGGAAH--KTAEDIANQYDLLPKLIPYLDRHLVFPLLEFSSG-----
EIF3E_ASPFU       MAANVPPSAETLSSGAAAHPSNTAEEIANQYNLLPKLIPYLDRHLVFPLLEFSSG-----
C0NV20_AJECG      MTDKIPPSADTLLKGAASRSAKTPEEIAKEYDLLPKLMPYLDRHLVFPLLEFASG-----
EIF3E_SCLS1       MADNTPTTANDFLNGAAQV-AKSPEEIAKENDLLPKLITHLDRHLIFPLLQFVAD-----
EIF3E_PHANO       MAESATDSGN----------------VAEQYSLLPKLMPNLDRHLIYPLLNFSAD-----
C7YPX8_NECH7      -----MEELLN-------------AVSADGSSIMPLIARHLSRHLLFPLIQFESERA---
EIF3E_NEUCR       MASTSPATTNG-------------DVAPANYDLVLKLAPHLDRHMIFPLLEFNAGRL---
EIF3E_SCHPO       MGSELKSTSPL----------------AVKYDLSQKIMQHLDRHLIFPLLEFLSL-----
EIF3E_YARLI       ----------------------------MEYDLTQKTLPFLDRHLIYPLLQFLKG-----
A8P8E3_COPC7      ---------------------------MAEHDLTKTIIPYLDRHLAFPLLAHLAE-----
EIF3E_USTMA       --------------------------MAVKYDLTQTLLPYLDRHLGLPLLSHLAG-----
EIF3E_CRYNJ       ---------------------------MADYDLTQKLIPHLDRHLAIPLLNHLSD-----
E3L1Q1_PUCGT      ------------------MTNSDNEQRLDSFDLTSRLIPQLDRHLVLPLLEFLDS-----
B7G3T4_PHATC      -------------------MSTGESASRATWDLTSQISPFLDRHMIFPLLEYLDTLIKDQ
B8BUG4_THAPS      --------------MTSPAPADAAADDAANYDLTSLISPYLDLHMMFPLLEYIDSLISTG
EIF3E_MONBE       ---------------------------MAAHDLTQAICQNLDPHLILPLLDHCVD-----
A4I3W2_LEIIN      ------------------------------MDMLTKLLPYMDKHLALGLLNHYAQ-----
Q4Q833_LEIMA      ------------------------------MDMLTKLLPYMDKHLALGLLNHYAQ-----
A4HGT5_LEIBR      ------------------------------MDMLMKLLPYMDKHLALGLLNHYAQ-----
Q383C1_TRYB2      -----------------------------MTEMLSCLVPYLDKHLVLGLLYFYDD-----
V5BEE1_TRYCR      -----------------------------MTEMLRCLLPHLDKHLALGLLYFYDE-----
A0CLZ2_PARTE      ---------------------------MVKFEEFQKLTPKEKKKAMAELHDLPLQSHS--
A0D3M3_PARTE      ---------------------------MVKFEEFQKLTPKEKKKAMAELHDLRGPTYQI-
                                                           . .    :           

Q4UE81_THEAN      ----KDIYSADELSSTREELNKKLESVKLSDEE---------FSQMESDCLSKIQQFKIV
Q4N5B4_THEPA      ----KNIYSADDLSSIREELNKKLQSRKLSDEE---------FSKLETDSLSKIEQFKVV
A7ANK5_BABBO      ----KETSS-DELADVRADVAKKVESQKLTDEK---------FKEVEAELLMKIEPLKEA
Q4Z7U2_PLABA      ----NKVLKQDELNKQIALINEGCEKEIVSIENEFTNGNRGVILNCLDSLEIEIEEFQEA
Q4XVK1_PLACH      ----NKVLKQDELDKQLALINEGCEKEIVSIENEFTNGNRGVISNCLDSLEIEIEEFQEA
Q7RQ22_PLAYO      ----NKVIKQDELDKQLALINEGCEKEIVSIENEFTNGNRGVISNCLDSLEIEIEEFQEA
B3L5Y1_PLAKH      ----NKVLNEADIDQSLGLLKEGCEKEIVNIENEFTNGNRGVIVNCLDSLEVEIDDFQEA
A5K977_PLAVS      ----NKVLNEAEIEQSLGLLKEGCEKEIVNIENEFTNGNRGVIVNCLDSLEVEIEEFQDA
Q8I3I5_PLAF7      ----NKVGDVNDLEKNLELLNEGCDKEIALIENECTNGNRGVINNYLESVELEIDEFQEA
B6KDN0_TOXGV      ----NEMITPEEREQMGQSLLGQAATTPAGRAA---------VEAEIREIEAKLVNFNNA
EIF3E_DICDI       -----QQYQENEINKAMADILSQTGCCDYAINAYESIGRDTAPLQ------AKKQELVGE
F0ZI56_DICPU      -----QQYSENEINKAMADILSNTGCCDYAIDAYKATGRDTAPLQ------EKKKQLVEE
D3AVQ5_POLPP      -------YSEEDINRAKADILAQTGCCDYAITVYQSIGRDIAPLQ------EKKQKLVEQ
EIF3E_CAEEL       ----RGIYDEKSLTEMHRQLLTKTNMIDSVIETYNG----KPIPA---AIEAKKKQIIKE
G4M126_SCHMA      ----KNIYDEKSILKTKWEVLLETSMVDYAADTYRSIY-DTEPPK---GLLDKREKVLES
W5JQD6_ANODA      ----KNVYDQSSLLKFILETVSKTNMVDYTMDIRERLTLEKTLPE---ELNTRRANVLVT
EIF3E_ANOGA       ----KKVFDQTSLLKFILETVSKTNMVDYKHDIRERLAMDKVHPD---ELAQGRANVLAT
EIF3E_AEDAE       ----KDIYDQTSLLKFILQTVSKTNMVDYTMDIRERLNMGDELPE---ELSKRRANVLVK
EIF3E_DROME       ----KEIYNQQELLEYILETVNKTNMIDYTMDTRKRLNLSQEMPE---ELVQRKAEVLAT
EIF3E_DROPS       ----KEIYNQQELLEYILETVNKTNMIDYTMDTRKRLNLSQEMPD---ELVQRKAEVLAT
EIF3E_BOMMO       ----KETYDQSELLQAKLEILSKTNMIDYVTDIRRMLYPEEDTPE---EIIQRRGVVLSE
E0VAQ3_PEDHC      ----KGIYDKNELLQVKLDILNKTNMLDYAIDIRRLLYPSE-EPE---SLKARRNVVVQT
EI3EA_DANRE       ----KEIYNEHELLHGKLDLLSDTNMVDFAMDVYRNLFPDKEIPN---SLREKRTTVVAQ
EI3EB_DANRE       ----KEIYNEKELLQGKLDLLSETNMVDFAMDVYKNLYPDKEIPH---SLRDKRTTVVAQ
EIF3E_BOVIN       ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
G1QVT7_NOMLE      ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
G1P8X3_MYOLU      ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
H0X2Y0_OTOGA      ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
EIF3E_PONAB       ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
EIF3E_RAT         ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
EIF3E_HUMAN       ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
EIF3E_MOUSE       ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
G1M2D6_AILME      ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-DIPH---ALREKRTTVVAQ
EIF3E_CHICK       ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSD-EIPH---ALREKRTTVVAQ
H3A4A4_LATCH      ----KEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYPDKEIPH---ALREKRTTVVAQ
EIF3E_XENTR       ----KEIYNEKELFQGKLDLLSDTNMVDFAMDVYKNLYADKEIPH---ALREKRTTVVAQ
H3DDC2_TETNG      ----KAIYNEEELLNGKLDLLSDTNMVDFAMDVHRSLFPEKDIPY---TLKEKRTEVVAQ
C3Y1L0_BRAFL      ----KGIYDEHELLKGKLDLLSNTNMVDFAMDVWKSLYPDQDVPD---SLVQKRQEVVGQ
EIF3E_NEMVE       ----KEIYDEHELLKGKLDLLSNTNMVDFAMDVYKGLYPDEEVPT---SLVEKRVEVVKE
E9GEY1_DAPPU      ----QGIYKENELLRAKLDLLSKTNMVDFAMDVHKNLYPDQEIPP---TLKDKRTVVVEQ
B3S263_TRIAD      ----NKIYNEDDILKGKLELLKNTKMVDFAMDVHKKLYPEMEVPE---SFRDKRTEVVSE
F4P7G6_BATDJ      ----RQIYNKKDLLKSKHQLLSTTKMMDFTNTVYKELQGTKKNEP---GYDKRREHVLAT
EIF3E_ARATH       ----RQLYPDEQILKSKIQLLNQTNMVDYAMDIHKSLYHTEDAPQ---EMVERRTEVVAR
F6HS75_VITVI      ----RQLYPDEQILKAKIELLNKTNMVDYAMDIHKSLYHTEDVPQ---DMVERRAEVVAR
A9TXR1_PHYPA      ----KQLYSDDQILKSKIELLAKTNMVDYAMDIHKSLYHTEDVPQ---DMVDRRAEVVGR
A9SFG7_PHYPA      ----NQLYSDDQILKAKIELLAKTNMVDYAMDIHKSLYHTEDVPQ---DMVDRRAEVVGR
A8JGK5_CHLRE      ----RGLYNEDDILRAKLALLDKTNMVDFAMDIYKGLNGVDEVPA---EMKDRRSQVVAR
D0NHD9_PHYIT      ----SELYDEAQLMAAKLALLKPTNMADFAVEIHQTVHNSEEVPE---EFETRRGEILDA
EIF3E_EMENI       --QDDDSE----IVRAKYELLKHTNMTDYVANLWQEINNSDTIPD---EFVKKREEVLAK
EIF3E_ASPFU       --QDDEKE----IVRAKYELLKHTNMTDYVANLWKEINNSDDIPD---EFVKKREEVLAK
C0NV20_AJECG      --QEEGDEQVDELTKAKYELLKQTNMTDYVANLWQEINNSETMPE---EFVKKREEVVKK
EIF3E_SCLS1       --QDEEPSP--EITKAKFELLKKTNMTDYVASLYCEIEGVEEPPK---EYATKRQEILQR
EIF3E_PHANO       --EDAEQPLD--QKKLLLELLKPTNMTDFVGQLYQDVHNLDDMPD---EYKTKRDQVLQR
C7YPX8_NECH7      -DEQGDDAKAKEILSSKIKLLEDTNMTDYVATMYCELHGVSEAPA---EYNKKRQEVLSE
EIF3E_NEUCR       -KED-ETDKAREILAAKYALLKKTNMTDYVANLYCELEGLKEPPA---EYAERRQKVFHQ
EIF3E_SCHPO       --RQTHDPK--ELLQAKYDLLKDTNMTDYVANLWTNLHGGHTDEDMANAFAEKRRSVLQE
EIF3E_YARLI       --RGVYNDT--ELLQLEYDLLKDTNMTDYLVELSKELGQNDAD------LQAKKENVVKT
A8P8E3_COPC7      ----LSIFTDRDVQIAQYELVKGTNMYDYSAQLFKSIYP---DQEVPAEFEEARKNALST
EIF3E_USTMA       ----SGIFSETDIAKAQYELAKNTSMVDYALQLYEQAYP---NQPAPAEIEKQRENAIAL
EIF3E_CRYNJ       ----IAIYPAEQLARAQYDLAKGTNMVNYVEQFHAQIE-----NAEPTDFARLRDEATAK
E3L1Q1_PUCGT      ----NGIYPHQQLLQAKYDALKETNMITYLTGLHRELHNLDDQAPVPQEFSQKEEQVMNK
B7G3T4_PHATC      DGKHLVDYNPQDVAAARLEILRPTHMVDYAIDVHQTLHP--GQP-VPDEMEAQKKTVYEE
B8BUG4_THAPS      S----VSYSSSDVAQARLKLLKPTHMVDYAMDIYREVHG--ENAEIPKDMEDQKVEVFRE
EIF3E_MONBE       ----LDIYNEADLKRAKMQVLSRTRLIEQALELADATEKK--------DLDARMRSISEE
A4I3W2_LEIIN      --------NGEDVQDAMMKLIETTGLNADGSIKTETEEMMAKATA-------AAQPALKE
Q4Q833_LEIMA      --------SGEDVQDAMMKLIETTGLNADGSIKAETEEMMAKATA-------AAQPALKE
A4HGT5_LEIBR      --------NGEDVQDSMIKLIETTGLNADGSIKAETEEMMAKATA-------AAQPALKE
Q383C1_TRYB2      --------QGVDVGDALRFVQATTALTPEGEVSLEQENKIRETAE-------RARPALDM
V5BEE1_TRYCR      --------QGLDVADALRAVQATTALTAEGEVSVEQERKIKETAQ-------RARPALDE
A0CLZ2_PARTE      ------KKSESKTQLWNLFSPKIFYLIQYMDHFLRFINPHVFLGSVQFLQLQTSKETEAL
A0D3M3_PARTE      ----FKEKPESKTQLWNIFSPKIFYLIQYMDHFLRFINPHVFLGCVQFLQLQTSKENEAL
                                                                              

Q4UE81_THEAN      LSLYKKDQLHRISSTF----EKTTVPSLIQWANTS--SLNVS------------------
Q4N5B4_THEPA      LSMYKKEQLHRISSTF----EKTTVPSLIQWANSS--QLNVS------------------
A7ANK5_BABBO      LGIYKKSQVNRISSSA----ERIWLVSLPQWLAS---QENVT------------------
Q4Z7U2_PLABA      MNEYKNDQLNKIGGSV----EKKSIMALREWCNTYLIDKNKT------------------
Q4XVK1_PLACH      MNEYKNDQLNKIGGSV----EKKSIMALREWCNTYLIDKNKT------------------
Q7RQ22_PLAYO      MNEYKNDQLNKIGGSV----EKKSIMGLREWCNTYLIDKNKT------------------
B3L5Y1_PLAKH      MNMYRNDQMNKIGATV----EKKSIMSLRDWCNVNVLEKTKT------------------
A5K977_PLAVS      MNMYKNDQVNKIGGTV----EKKSIMSLREWCGVNVLEKTKT------------------
Q8I3I5_PLAF7      MNEYKIDQMNRIGSNL----EKKSIVGLRDWCNTYLLDKNKM------------------
B6KDN0_TOXGV      IEAYKKEQQKRIGGYP----DRKTLVDLSEWWMTNSGQSPAP------------------
EIF3E_DICDI       LNKLKEQCSFVTQYIESKKQQKEQQKELKEQQK-EQ--QKEKDTDKTTPTTTDETTTTTT
F0ZI56_DICPU      LNKLKEECSFVTQYIESKRQQKEQQKELKEQQKQEK--EAAAAAAAASDKTEESTTTTTT
D3AVQ5_POLPP      LAQLKEACQVVTQYIEAKKEQ-HQQTVAAAAAAAAA--AAASTTTTSTTAASTTTPAIKD
EIF3E_CAEEL       RDELKSKVDSVVAILE--IPEVKEMMDNNRERDGNV--RILEHLTQ--------------
G4M126_SCHMA      IQETEVKLKPVKVIFS--QETMKEVAQCKNAKD------LLASLET--------------
W5JQD6_ANODA      LKELQTEVAPLMKCM----EELKNPDTLKDSKS------IIHSLQQ--------------
EIF3E_ANOGA       LKELQAEVAPLMKCM----EELKNPDSTKDSKS------VIHALQQ--------------
EIF3E_AEDAE       LKELQTEVAPLMKCM----EELKNPDSMKDSKS------IVHALQQ--------------
EIF3E_DROME       LKQLQNEVAPIMKAT----DILKNGESMKDSKT------FVNALQK--------------
EIF3E_DROPS       LKQLQNEVAPIMKAT----DILKNGESMKDSKT------FVNALQK--------------
EIF3E_BOMMO       LQELQDAVEPVLRLMQ-RDDVMKTIETMRDPKT------LINHLSTNK------------
E0VAQ3_PEDHC      LQELQNEASVVVRIMS-DENTRKQMETMRDSKT------LVSYLQT--------------
EI3EA_DANRE       LKQLQSETEPIVKVFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EI3EB_DANRE       LKQLQSETEPIVKMFE-DPETQRQMQSTRDGRM------LFEYLAD--------------
EIF3E_BOVIN       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
G1QVT7_NOMLE      LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
G1P8X3_MYOLU      LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
H0X2Y0_OTOGA      LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EIF3E_PONAB       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EIF3E_RAT         LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EIF3E_HUMAN       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EIF3E_MOUSE       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
G1M2D6_AILME      LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAD--------------
EIF3E_CHICK       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLAE--------------
H3A4A4_LATCH      LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDYLSD--------------
EIF3E_XENTR       LKQLQAETEPIVKMFE-DPETTRQMQSTRDGRM------LFDHLAE--------------
H3DDC2_TETNG      LKQLQSETEPIVKIFE-DPETTRQMQSTRDGRM------LFDYLAE--------------
C3Y1L0_BRAFL      LKFLQAECEPIVKIFE-DPEVARQIQSTRDGRQ------LFDYLAR--------------
EIF3E_NEMVE       LKDLQAQTEPIINCFS-DPEFTAQVQSTRDGRQ------LFEYLER--------------
E9GEY1_DAPPU      LKKMQAETEPILAMFM-NPEVTRQIQSSRDSRQ------LLDYLTK--------------
B3S263_TRIAD      LKNFREKCTPVVEVFSSDEDFMKLLQDHRDGRY------LFDYLSR--------------
F4P7G6_BATDJ      LDDLEKQVNPCMNIIQ-DPTFVQQMKQDKVANL--------TLLKD--------------
EIF3E_ARATH       LKSLEEAAAPLVSFLL----NPNAVQELRADKQ-----YNLQMLKE--------------
F6HS75_VITVI      LKALEEAAAPLVSFLQ----NPNAVQELRADKQ-----YNLQMLND--------------
A9TXR1_PHYPA      LKVLEESAAPLISFLQ----NPALVQELRSDKQ-----YNLQMLQE--------------
A9SFG7_PHYPA      LKVLEESAAPLISFLQ----NPALVQELRSDQQ-----YNLQMLQE--------------
A8JGK5_CHLRE      LRQLQADVDPIIKCLQ----NRHVVEKFRQDKS-----FNLQFLQE--------------
D0NHD9_PHYIT      LSFAKSECSPMLELIE---DEEKIMQLQSENLL------NASHLEQ--------------
EIF3E_EMENI       LQHYQNESEKITELLQ-DEAVVGNLRS--DKVA------NLRFLEE--------------
EIF3E_ASPFU       LQQYEEESAKITQLLQ-DESVVANLRS--DKVA------NLKFLEE--------------
C0NV20_AJECG      LQQYVEDSSKITELLQ-DDNVVSNLRN--DKAA------NLKFLEE--------------
EIF3E_SCLS1       LEIFGQESEKITDLLG-REDVVTGLRS--DKVA------NLEFLKK--------------
EIF3E_PHANO       RDKLEEETSKISGLLD-DENVVTNLRS--DKVQ------NLAYLKD--------------
C7YPX8_NECH7      LEKYEQATAKIADLLT-QDEVVNGLRS--DKVA------NLEFLKN--------------
EIF3E_NEUCR       LEKYEQETAKITELLQ-RDDVVNNLRS--DKVA------NLEFLKK--------------
EIF3E_SCHPO       LSELEEEVQGILGVLE-NPDLIAALRQ--DKGQ------NLQHLQE--------------
EIF3E_YARLI       LAELEEATKPVFEVLE-NPEVVSELKE--NKTQ------NQALLTS--------------
A8P8E3_COPC7      HERLQQEAQAVFDVIE-NPEVAQALRQ--DKIQ------NLQYLKD--------------
EIF3E_USTMA       NDKLGSEVDHVLEVIQ-DPSVASALKQ--DKAQ------NLQWLEE--------------
EIF3E_CRYNJ       YQELQEKAQPVTKVIE-DPDAVAKLRSGGDKDR------NLDLLRS--------------
E3L1Q1_PUCGT      LDTLQESVDQIMSVIS-APEVVAALRQ--DKAQ------NLAYLEK--------------
B7G3T4_PHATC      LEALRAACGAFDKLCQ----DETERSKLMATGQ-----WNFGSL----------------
B8BUG4_THAPS      LEELREGQMKLDELFR----NEEVRANLVQNNQ-----WNVKSLIA--------------
EIF3E_MONBE       EKTWEKQLEPVFEMFE-NDEVLSIIEATKNKDS------LLSELEP--------------
A4I3W2_LEIIN      FFDESEDDHSTYQFKL----TETEIGERRTQGE-----LSHEFLS---------------
Q4Q833_LEIMA      FFDESEDDHSTYQFKL----TETEIGERRTQGE-----LSHEFLS---------------
A4HGT5_LEIBR      FFDPSEDDHSTYQFKL----TETEIGERRTQGE-----LSHEFLS---------------
Q383C1_TRYB2      FFEQNVSDNCTYQLCL----TESRIDELRGKGE-----LSRGFL----------------
V5BEE1_TRYCR      FFEKSETENSTYQFKL----TGSEIDALRSNRE-----LSRDVL----------------
A0CLZ2_PARTE      LGTRLFERLRKLGVPSEKIDQIIQQDNLNGKLTSVAELLKLRQRALVD------------
A0D3M3_PARTE      LGTRLFERLRKIGVPQEKIDQIMQQDNLNGKLSQVSELLRLRSRALVD------------
                                                                              

Q4UE81_THEAN      --------------------------TDFPRDVDELILKLAKAYFDREDYENCKSLLIYY
Q4N5B4_THEPA      --------------------------TDFPHDVDELILKLAKAYFDREDYENCKSLLIYY
A7ANK5_BABBO      --------------------------LEIDSEAEQAVFMLAKLYSNQGDWSKCKQWLVYY
Q4Z7U2_PLABA      --------------------------YKFSDNIDDKILKLSRYYYQKKDYQKSKQHLLLY
Q4XVK1_PLACH      --------------------------YKFSDNIDDKILKLSRYYYQKKDYQKSKQHLLLY
Q7RQ22_PLAYO      --------------------------YKFSDNIDDKILKLSRYYYQKKDYQKSKQHLLLY
B3L5Y1_PLAKH      --------------------------YNFTDNIDDKILKLSRYYYQKKDYQRSKQHLLLY
A5K977_PLAVS      --------------------------YNFTDNIDDKILKLSRYYYQKKDYQKSKQHLLLY
Q8I3I5_PLAF7      --------------------------YTFSDNIDDKILKLSRYYYQKKDYVKSKQYLLLY
B6KDN0_TOXGV      --------------------------PALELGVDALVPRLAKLYYDIGDYKQSLQQLQYM
EIF3E_DICDI       TAPTTTTTTTTTTITPITVIPFSQLLEKITPEILDSIYRFSKLLFEIGQYGSAREHLEIF
F0ZI56_DICPU      TTPTPAPTTTTTTTPTIQVIPFSQLQETVTPAILESIYRFSKLLFETGQYGSARDHLEIF
D3AVQ5_POLPP      EEAEESTPATTTAAPQKSELTFGSLREKVTPEIVESLYRYAKLLFETGQYKNAREYLDIY
EIF3E_CAEEL       -------------------------NHNFTVDMVDTLFKYSKFMYECGNYTVASVCLYYY
G4M126_SCHMA      -------------------------KYNFKTEMLNDMFDAARVFYDAGNYNLASEYLKIV
W5JQD6_ANODA      -------------------------QLDY--DIIQSAQKLAKYLYECGNYNDSLSYLYIC
EIF3E_ANOGA       -------------------------TLDY--DIILSAQKLAKYLYECGNYNDSLSYLYVC
EIF3E_AEDAE       -------------------------EFDFKHDIIKSAQKLAKYLYECGNYRDSISYLYIC
EIF3E_DROME       -------------------------DYNFKVEHLESAYKLAKYLYECGNYQESTSYLYFC
EIF3E_DROPS       -------------------------DYNFKVEHLESAYKLAKYLYECGNYQESTSYLYFC
EIF3E_BOMMO       -------------------------EYEFKIEMIDSMYRLAKYRYECGNYVESASYLYFC
E0VAQ3_PEDHC      -------------------------QFDFKLEMMDVTYRLAKYRYECGNYSNSTSYLYFY
EI3EA_DANRE       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EI3EB_DANRE       -------------------------KHSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_BOVIN       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
G1QVT7_NOMLE      -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
G1P8X3_MYOLU      -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
H0X2Y0_OTOGA      -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_PONAB       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_RAT         -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_HUMAN       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_MOUSE       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
G1M2D6_AILME      -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_CHICK       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
H3A4A4_LATCH      -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
EIF3E_XENTR       -------------------------KHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
H3DDC2_TETNG      -------------------------KHNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFF
C3Y1L0_BRAFL      -------------------------NHGFESKMVDTLYDYAKFQYECGNYSGAAEYLYFH
EIF3E_NEMVE       -------------------------NHDIKPEMLDVLYKFAKFQYECGNYSGAAEYLYFY
E9GEY1_DAPPU      -------------------------NHGLKPEMLDKLYLFAKFQYECGNYSGAAEYLHFH
B3S263_TRIAD      -------------------------KHNIQPDTLDALYDYAKFQYECGNYSGAAEYLHFF
F4P7G6_BATDJ      -------------------------KYKFKPEMLDVLYKYALFQYDAGQYVIASDYLYHF
EIF3E_ARATH       -------------------------RYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQY
F6HS75_VITVI      -------------------------RYQIGQEQIEALYQYAKFQFECGNYSGAADYLYQY
A9TXR1_PHYPA      -------------------------RYQIGSEQIEALYQYAKFQFECGNYSGASDYLYEY
A9SFG7_PHYPA      -------------------------RYQIGSDQIEALYQYAKFQFECGNYSGASDYLYQY
A8JGK5_CHLRE      -------------------------EFQIGAEHVEALYQYARFQFNCGNYSLAAELLQSY
D0NHD9_PHYIT      -------------------------NEGITPAVLDGLYKYAKLQYECGNYQDCLTYLTYY
EIF3E_EMENI       -------------------------QHGVTIEMVNSLYDYGRFQYSCGSYGNAAELLYQF
EIF3E_ASPFU       -------------------------QHGVTVEMVNSLYDYGRFQYSCGSYGNAAELLYQF
C0NV20_AJECG      -------------------------QHGVTMDMVNILYDYGRFQYSCGSYANAAELLYQF
EIF3E_SCLS1       -------------------------EHDVTIDMVNVLYDFGNFQYSCGNYGAAAELLYQF
EIF3E_PHANO       -------------------------THGVTVEMVNQLYEFGSFQYSCGVYPHAAELLYRF
C7YPX8_NECH7      -------------------------QHGVTMEMVNALYDFGQFQFRCGQYGPAADMLYQF
EIF3E_NEUCR       -------------------------EHDVTIDMVNALYDFGQLQYSCGNYADASELLYRF
EIF3E_SCHPO       -------------------------HYNITPERIAVLYKFAQFQYNCGNYGGASDLLYHF
EIF3E_YARLI       -------------------------KYGLSVEQINLLYKFGQFQYNAGRYQAASDILYHF
A8P8E3_COPC7      -------------------------NYNLTLEQITALYHYGKFRYSSGNYSSAADYLYHF
EIF3E_USTMA       -------------------------KYNLTSEQINALYRYGYFQFSCGNYGDASSYLYHF
EIF3E_CRYNJ       -------------------------EYQIDIDQINALYHFGQYQYSLGDYGSAGNLLYHF
E3L1Q1_PUCGT      -------------------------EHNVSLSQIAVLYQYGHYNYTIGNYGGSSDYLYHF
B7G3T4_PHATC      -----------------------NQSHQITPEMVEAYRKLARFQFECGDYQSARAM----
B8BUG4_THAPS      -----------------------ATSYGITSDTIAAYYKFAKFNFDCGDYQQGPAAKSSP
EIF3E_MONBE       --------------------------YGFTENTADLLYHGSKFYFDRGQYDLAHGLLYNY
A4I3W2_LEIIN      ------------------------EKKGITAAVMNALYKLAYLYYDTGAYGDASELLTLC
Q4Q833_LEIMA      ------------------------EKKGITAAVMNALYKLAYLYYDTGAYGDASELLTLC
A4HGT5_LEIBR      ------------------------EKKGITAAVMNAVYRLAYLYYDTGAYGDASELLALC
Q383C1_TRYB2      ------------------------EKEGITPKVMTAVMDLAFLYYDAARYGDASELLSLL
V5BEE1_TRYCR      ------------------------EAKGITSNVMKAVMELAYLYYDAARYTDASELLSLC
A0CLZ2_PARTE      -------------------------YVQENLWTVEEAYQALIILFDSGEYEKATEIVDNL
A0D3M3_PARTE      -------------------------YVQENLWTVEEAYQALIILFDQGEYERATEIVDNL
                                                                   :          

Q4UE81_THEAN      VNSVSKYTVEGWNLEIIFSSGSSTKKKMKCYWGIISCNILSVLLPSSHEELQEMSSMVIV
Q4N5B4_THEPA      VNSVSKYTVEG----------SSTRNKMKCYWGIISCNMLSVLLPSSHEELQEMSSMVIV
A7ANK5_BABBO      LENVAKYTYDG----------NTPANRAKCYWGILRSITVGVLLPSTEAELIAMASTPLP
Q4Z7U2_PLABA      ILNISEIIINIS----------ESPKMRTCYWGIISNIINSFFLNINNDEYLFTVND---
Q4XVK1_PLACH      ILNISEIIINIS----------ESPKMRTCYWGIISNIINSFFLNINNDEYLFTVND---
Q7RQ22_PLAYO      ILNISEIIINIS----------ESPKMRTCYWGIISNIINSFFLNLNNDDYLFTVND---
B3L5Y1_PLAKH      ILNISEIIINIS----------DSPKMRLCYWGIISNIINSFFANLHNDDYILQKTE---
A5K977_PLAVS      ILNISEIIINIS----------DSPKMRLCYWGIISNIINSFFANLNNDEYMLVKTE---
Q8I3I5_PLAF7      ILNISEMIINIS----------ESSKMKTCYWGIISNIINSFFMNINNDDYLFSKNE---
B6KDN0_TOXGV      LTTLYELLAEGT----------NTQTRMACYWGVCACIILLHHQQQSENKSAASEETEKK
EIF3E_DICDI       LQLSPTHQN--------------KDKRLSALWGILESDILSL------------------
F0ZI56_DICPU      LQLSQHSIS--------------REKRLSALWGILESDILSL------------------
D3AVQ5_POLPP      VKLSHDRQ-----------------KQFSASWGILEADILSS------------------
EIF3E_CAEEL       RNLVNQA----------------DPNYLNALYGKLASEILLQ------------------
G4M126_SCHMA      RQLVTPG----------------TQRHLDASWGRLASEILVQ------------------
W5JQD6_ANODA      MLVMEPN----------------DKNYLGVLWGKLAVEILTL------------------
EIF3E_ANOGA       MLVMEPN----------------DKNYLGVLWGKLAVEILTL------------------
EIF3E_AEDAE       LLVMEPA----------------DKNYLTVLWGKLAAEILVL------------------
EIF3E_DROME       LIVMSPN----------------DKNYLNVLWGKLAAEILTL------------------
EIF3E_DROPS       LIVMSPN----------------DKNYLNVLWGKLAAEILTL------------------
EIF3E_BOMMO       QLVMSPT----------------DKNYLSVLWGKLASEILVQ------------------
E0VAQ3_PEDHC      MLVMPPT----------------DKNYLNVMWGKLASEILLQ------------------
EI3EA_DANRE       RVLVPAT----------------DRNALNSLWGKLASEILMQ------------------
EI3EB_DANRE       RVLVPST----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_BOVIN       RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
G1QVT7_NOMLE      RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
G1P8X3_MYOLU      RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
H0X2Y0_OTOGA      RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_PONAB       RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_RAT         RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_HUMAN       RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_MOUSE       RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
G1M2D6_AILME      RVLVPAT----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_CHICK       RVLVPAT----------------DRNALSSLWGKLASEVLMQ------------------
H3A4A4_LATCH      RVLVPST----------------DRNALSSLWGKLASEILMQ------------------
EIF3E_XENTR       RVLVPST----------------DRNALSSLWGKLASEILMQ------------------
H3DDC2_TETNG      RVLVPPT----------------DRNALSSLWGKLASEILMQ------------------
C3Y1L0_BRAFL      RVLVPSD----------------DKNAMNSLWGKLASEILMQ------------------
EIF3E_NEMVE       RALAPGG----------------DTNSLNALWGKLASEILMQ------------------
E9GEY1_DAPPU      RFLVTPN----------------DKNYLNGLWGKLASEILMQ------------------
B3S263_TRIAD      RVLSPNAN---------------DQKGESALWGKLASEILMQ------------------
F4P7G6_BATDJ      MALSINH----------------DKNN-SALWGKLAADIMAR------------------
EIF3E_ARATH       RTLCSNL-----------------ERSLSALWGKLASEILMQ------------------
F6HS75_VITVI      RALCTNS-----------------ERSLSALWGKLAAEILMQ------------------
A9TXR1_PHYPA      RALCTNS-----------------ERSISALWGKLACEVLMQ------------------
A9SFG7_PHYPA      RTLCTNS-----------------ERSISALWGKLACEILMQ------------------
A8JGK5_CHLRE      RTLCTNS-----------------ERNISALWGKLAAEILMHEAV---------------
D0NHD9_PHYIT      GVLIPNS----------------SEQFLNALWGKLAAEILIF------------------
EIF3E_EMENI       RVLSTDN-----------------DKVASATWGKLASEILTT------------------
EIF3E_ASPFU       RVLSTDN-----------------DKVASATWGKFASEILTT------------------
C0NV20_AJECG      RVLSTDN-----------------DKVASATWGKLASEILTT------------------
EIF3E_SCLS1       RVLSTDD-----------------DKVTAATWGKLACEILTG------------------
EIF3E_PHANO       RVLVRNI-----------------Q-EREATWGKLACEFLSV------------------
C7YPX8_NECH7      RVLSTDN-----------------DKVSAATWGKLASEILQT------------------
EIF3E_NEUCR       RVLSTDN-----------------DKVSYATWGRLACEILTM------------------
EIF3E_SCHPO       RAFSKDP-----------------ELNASATWGKFASEILTV------------------
EIF3E_YARLI       RALSTDP-----------------ELVASATWGRFACEILTS------------------
A8P8E3_COPC7      RVLSTDA-----------------ELNTSAHWGKLASDILSG------------------
EIF3E_USTMA       RVLSTDP-----------------VLTMSSHWGKLASDILVG------------------
EIF3E_CRYNJ       LILSPSY-----------------ELNISAQWGKLASNILNG------------------
E3L1Q1_PUCGT      RVLSTDN-----------------ELVLSSLWGKLASDILEG------------------
B7G3T4_PHATC      --------------------LTVDESMLQVLWGRLACEVLVE------------------
B8BUG4_THAPS      AEDEKTGNPNMYYL------TSIDTTLLQVLWGKLSCEILVE------------------
EIF3E_MONBE       RAVSTDD-----------------KLKFTALWGKLAAAILSG------------------
A4I3W2_LEIIN      QCVSGYDN----------------IRSDTILWGKLMSDIGAV------------------
Q4Q833_LEIMA      QCVSGYDN----------------IRSDTILWGKLMSDIGAV------------------
A4HGT5_LEIBR      QCVSGYDS----------------LRSDTILWGKLMSDIGAV------------------
Q383C1_TRYB2      QCVTGYE-----------------LGESKLLWGRLVCDTCSC------------------
V5BEE1_TRYCR      QCVMGYE-----------------IDQRTLLWGKLVSDMCTC------------------
A0CLZ2_PARTE      YPCVEATEK-------------LNHLRNGFLWARLNCKLIGLFK----------------
A0D3M3_PARTE      YPCVEATEK-------------LNHLRNGFLWARLNCKLIGLFK----------------
                                                 :.                           

Q4UE81_THEAN      QQDPDNDKDATLIDQRTP--------------------RSGVYCILKFAELLNS------
Q4N5B4_THEPA      QQDSDNDKDTTLIDQRTP--------------------RSGVYCVLKFAELLNS------
A7ANK5_BABBO      N---DENREVSILEPDLP--------------------RTAVQCIVRLAELLGN------
Q4Z7U2_PLABA      ----DNKTIIKEEIINEI--------------------NVCVETIIKLSQLLNK------
Q4XVK1_PLACH      ----DNKTIVKEEIINEI--------------------NVCVETIVKLSQLLNK------
Q7RQ22_PLAYO      ----DNKTIIKEEIINEI--------------------NVCVETIIKLSQLLNK------
B3L5Y1_PLAKH      ----EGKLVVREEIVNEI--------------------NVCIETIVKLSQVLNK------
A5K977_PLAVS      ----EGKLIVREEIINEI--------------------NVCIETIVKLSQVLNK------
Q8I3I5_PLAF7      ----DGKIIVKEDIINEM--------------------NVCIESIVKLSQLLNK------
B6KDN0_TOXGV      EAAQDEELLQTLDHGEDEEGDAARAALAEAAKKAAVETHTAAQCILKLGDILDQ------
EIF3E_DICDI       ------------------------------------NWGQAVGDISPLQDQIDSNG----
F0ZI56_DICPU      ------------------------------------NWTAAVNDISPLQDQIDSNG----
D3AVQ5_POLPP      ------------------------------------NWAGAVADIPQIKEEIDSNHN---
EIF3E_CAEEL       ------------------------------------EWEHARDDLLKLRAYIDANPFD--
G4M126_SCHMA      ------------------------------------NWDEALEDLEKLKDAIDCQNEDR-
W5JQD6_ANODA      ------------------------------------NWPTALEDLTRLRDFIE-------
EIF3E_ANOGA       ------------------------------------NWQTALEDLTRLRDFIE-------
EIF3E_AEDAE       ------------------------------------NWPTALEDLTRLRDFID-------
EIF3E_DROME       ------------------------------------NWNTALEDLTRLRDYID-------
EIF3E_DROPS       ------------------------------------NWNTALEDLTRLRDYID-------
EIF3E_BOMMO       ------------------------------------NWDGALDDLTKLREFIDN--GGA-
E0VAQ3_PEDHC      ------------------------------------NWDTALEDLNKLRDFID-------
EI3EA_DANRE       ------------------------------------NWEAAMEDLTRLRETIDN------
EI3EB_DANRE       ------------------------------------NWEAAMEDLTRLRETIDN------
EIF3E_BOVIN       ------------------------------------NWDAAMEDLTRLKETIDN------
G1QVT7_NOMLE      ------------------------------------NWDAAMEDLTRLKETIDN------
G1P8X3_MYOLU      ------------------------------------NWDAAMEDLTRLKETIDN------
H0X2Y0_OTOGA      ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_PONAB       ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_RAT         ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_HUMAN       ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_MOUSE       ------------------------------------NWDAAMEDLTRLKETIDN------
G1M2D6_AILME      ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_CHICK       ------------------------------------NWDAAMEDLTRLKETIDN------
H3A4A4_LATCH      ------------------------------------NWDAAMEDLTRLKETIDN------
EIF3E_XENTR       ------------------------------------NWDAAMEDLTRLKETIDN------
H3DDC2_TETNG      ------------------------------------NWEAAMEDLTRLRETIDN------
C3Y1L0_BRAFL      ------------------------------------NWDPAMEDLNRLKDVIDG------
EIF3E_NEMVE       ------------------------------------NWDTALEDLNRLKDVIES------
E9GEY1_DAPPU      ------------------------------------NWDTALEDLNRLKEYIDS------
B3S263_TRIAD      ------------------------------------NWDVALEDLHRLREVIDT------
F4P7G6_BATDJ      ------------------------------------NWDGAYGELISLRETIDQSSFPVP
EIF3E_ARATH       ------------------------------------NWDIALEELNRLKEIIDS------
F6HS75_VITVI      ------------------------------------NWDTAFEELNRLKEIIDS------
A9TXR1_PHYPA      ------------------------------------NWDTATDELNRLKEFIDS------
A9SFG7_PHYPA      ------------------------------------NWDVATEEVNRLKETIDS------
A8JGK5_CHLRE      ------------------------------------NIQEAREDVFKLKEVIDN------
D0NHD9_PHYIT      ------------------------------------RWDDALADISRISDVIES------
EIF3E_EMENI       ------------------------------------NWEAAMEEVQKAKDSIET------
EIF3E_ASPFU       ------------------------------------SWEAAMEEVQKVKDSIET------
C0NV20_AJECG      ------------------------------------NWEAAMEEVQKVKESIDT------
EIF3E_SCLS1       ------------------------------------NWESAMEEVQKVKELIET------
EIF3E_PHANO       ------------------------------------NWDSAIEEINKLKETIDT------
C7YPX8_NECH7      ------------------------------------NWESAVDELKNVRENIDS------
EIF3E_NEUCR       ------------------------------------NWESAMEELQKVRESIDT------
EIF3E_SCHPO       ------------------------------------DWDGAMEELGKLREMVDS------
EIF3E_YARLI       ------------------------------------QWDSVLEELGKLRDSVDS------
A8P8E3_COPC7      ------------------------------------RFDVALEELNTLRETIDT------
EIF3E_USTMA       ------------------------------------EWEQALSELKLLREQLDS------
EIF3E_CRYNJ       ------------------------------------EWDAALMQVRDLRETIDN------
E3L1Q1_PUCGT      ------------------------------------SFDAALEELNRLKEQLDQ------
B7G3T4_PHATC      ------------------------------------DWDGANVAA---------------
B8BUG4_THAPS      ------------------------------------DWEEASVAL---------------
EIF3E_MONBE       ------------------------------------NWQTAQEDMYLLLEYIDGG-----
A4I3W2_LEIIN      ------------------------------------NWQSAMRIAEEIRRLHNASEED--
Q4Q833_LEIMA      ------------------------------------NWQSAMRIAEEIRRVHNASEED--
A4HGT5_LEIBR      ------------------------------------NWQSAMRIAEEIRRLHNASEED--
Q383C1_TRYB2      ------------------------------------RWPSAIAAAEKLWKQQGADGSENK
V5BEE1_TRYCR      ------------------------------------NWPSAIAAAEKLRRQQNADVFE--
A0CLZ2_PARTE      ------------------------------------NTNNAAVCIEAIKDLIKQ------
A0D3M3_PARTE      ------------------------------------NNNNATACIEAIKDLLKQ------
                                                                              

Q4UE81_THEAN      --EELNRD-------------------RKDLILKRCWLLHWSLFYIFKYHLALFHLSNKN
Q4N5B4_THEPA      --EEMSRD-------------------KKDLILKRCWLLHWSLFYIFKYHLALFHLSNKS
A7ANK5_BABBO      --EEIGKT-------------------RKEMVLKRVWLLHWAMFYVFKYHIPLSQVKTKG
Q4Z7U2_PLABA      --EKVTK---------------------HEIILQRSWLIHWALILIFHFFMHVMYVKNIY
Q4XVK1_PLACH      --EKVTK---------------------HEIILQRSWLIHWALILIFHFFMHVMYVKNIY
Q7RQ22_PLAYO      --EKVTK---------------------HEIILQRSWLIHWALILIFHFFMHVMYVKNIY
B3L5Y1_PLAKH      --DKVGK---------------------TEIILQRSWLIHWSLILIFHFFMYLIYVKTIY
A5K977_PLAVS      --DKVGR---------------------SEIILQRSWLIHWSLILIFHFFMYLIYVKSIY
Q8I3I5_PLAF7      --EKVSK---------------------NEIILQRSWLIHWSLIIIFHFFMYVIYVKNTY
B6KDN0_TOXGV      --VAAASSKKDHQGNPPLPAGLTM--SREQQLLNRSWLLHWSVWPLFRYYFLMVHTKQFI
EIF3E_DICDI       ------TPVEQ--------------------LGQRAWLIHRALFVYFY------NPES--
F0ZI56_DICPU      ------SPIEQ--------------------LGQRAWLIHRALFVYFY------HPDS--
D3AVQ5_POLPP      -----LTPVQQ--------------------LHQRAWLIHRSLFVYFN------QPDS--
EIF3E_CAEEL       ------TEWEL--------------------VTQRAWLMHWALFVYY-------NYPK--
G4M126_SCHMA      --PASRTYLIQ--------------------LQQRTWMLHWSLFVFF-------NHPQ--
W5JQD6_ANODA      --NYNFSPIQV--------------------LQQRTWLIHWSVLVFF-------NHAK--
EIF3E_ANOGA       --NYNFSPIQV--------------------LQQRAWLIHWSVLVFF-------NHGK--
EIF3E_AEDAE       --NHNFSPIEV--------------------LQQRTWLIHWSVLVFF-------NHAK--
EIF3E_DROME       --NANFSTIQA--------------------LQQRTWLIHWSVLVFF-------NHPK--
EIF3E_DROPS       --SANFSTIQA--------------------LQQRTWLIHWSVLVFF-------NHPK--
EIF3E_BOMMO       --GSTASNMQA--------------------LQQRTWLVHWSLFVFF-------NHVK--
E0VAQ3_PEDHC      --GNNFSSLQL--------------------LQQRTWLIHWSLFVFF-------NHPK--
EI3EA_DANRE       --NTVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EI3EB_DANRE       --NTVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_BOVIN       --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
G1QVT7_NOMLE      --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
G1P8X3_MYOLU      --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
H0X2Y0_OTOGA      --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_PONAB       --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_RAT         --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_HUMAN       --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_MOUSE       --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
G1M2D6_AILME      --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_CHICK       --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
H3A4A4_LATCH      --NSVSSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_XENTR       --NTVSSPLQS--------------------LQHRTWLIHWSLFVFF-------NHPK--
H3DDC2_TETNG      --NSVTSPLQS--------------------LQQRTWLIHWSLFVFF-------NHPK--
C3Y1L0_BRAFL      --STFTNQLQV--------------------LQQRTWLIHWSLFVFF-------NHPK--
EIF3E_NEMVE       --NTSAGTLQL--------------------LQERTWLIHWSLFVFF-------NHPK--
E9GEY1_DAPPU      --NTFNTPLQA--------------------LQQRTWLIHWSLFIFF-------NHAK--
B3S263_TRIAD      --NTTLNVVEQ--------------------LQQRTWLIHWSLFVYF-------NHPK--
F4P7G6_BATDJ      SDNNATSNHVQ--------------------LQQRMWLLHWSLFVFF-------NHPR--
EIF3E_ARATH       --KSFSSPLNQ--------------------VQNRIWLMHWGLYIFF-------NHDN--
F6HS75_VITVI      --KSYASPLNQ--------------------VQSRIWLMHWSLFIFF-------NHDN--
A9TXR1_PHYPA      --KNFASPLNQ--------------------LQQRTWLMHWSLFIFF-------NHDN--
A9SFG7_PHYPA      --KSFASPLSQ--------------------LQQRTWLMHWSLFIFF-------NHDN--
A8JGK5_CHLRE      --QTFAPPLVQ--------------------LQQRTWLLHWSLYVFW-------NHEN--
D0NHD9_PHYIT      --STVMSPVEQ--------------------LQQRTWLLHWSLFVFA-------WHEE--
EIF3E_EMENI       --RLFNNPVG--------------------QLHNRSWLIHWSLFPFF-------NHDP--
EIF3E_ASPFU       --RLFNNPLG--------------------QLQNRSWLIHWSLFPFF-------NHDP--
C0NV20_AJECG      --RLFNNPLA--------------------QLQHRTWLIHWSLFPFF-------NHDP--
EIF3E_SCLS1       --KLFNKPVA--------------------QLNHRTWLIHWALFPFF-------NHEP--
EIF3E_PHANO       --RLFNNPLA--------------------QLQHRTWLIHWSLFPLF-------NHEP--
C7YPX8_NECH7      --KLFNNPRA--------------------QLDHRTMLVHWSLFPLF-------NSES--
EIF3E_NEUCR       --RLANNPLA--------------------QLQHRTELVHWALFPLF-------NYDK--
EIF3E_SCHPO       --KSFKDSAV--------------------QLRNRTWLLHWSLFPLF-------NHAN--
EIF3E_YARLI       --RS-LDPQQ--------------------QLHQRMWVIHWSLFPFFQ------NDTK--
A8P8E3_COPC7      --RTSASLLAAAAAASSTSSSQTTSDPALIQLHSRTWLVHWSLFVYF-------NHPE--
EIF3E_USTMA       --SAAHVTASYAQPSTSNGSSQNDDLTQEGLLKKRAWLLHWALFIFF-------NHPG--
EIF3E_CRYNJ       --PHGTSLAK-----------------PLAQLQARTWLLHWSLFVFF-------NLGENQ
E3L1Q1_PUCGT      --RTGYGNPL-------------------QSLQQRTWWLHWSLFVYF-------NHDK--
B7G3T4_PHATC      -------------------------------LQQRTWLLHWSLFVYW--------NGN--
B8BUG4_THAPS      -------------------------------VAVKTAIDLFVFWNDA--------SGK--
EIF3E_MONBE       --KNELTAVEQ--------------------LQQRNWLLHWSLFVFF-------NQPD--
A4I3W2_LEIIN      ----LFGAPNT------------------TTVRARVWLLHWVLFPFFK------GGLQ--
Q4Q833_LEIMA      ----LFGAPNT------------------TTVRARVWLLHWVLFPFFK------GGLQ--
A4HGT5_LEIBR      ----LFGAPNT------------------TTVRARVWLLHWVLFPFFK------GGLQ--
Q383C1_TRYB2      SGKTTLRGDNG------------------TSVTERVWLLHWALFPFFK------GGNQ--
V5BEE1_TRYCR      --EDIFRVANT------------------TTTRERAWLLHWVLFPFFK------GGNQ--
A0CLZ2_PARTE      --EDQIKY----------------------NFKQRADLLHAGVLVCF-------------
A0D3M3_PARTE      --EDQIKY----------------------NFKQRADLLHAGVLVCF-------------
                                                    :       .                 

Q4UE81_THEAN      TKSFEWPQLQEYFLDERNLAVVNLLTPHLLRYYAVYAILNRNRK----------------
Q4N5B4_THEPA      TKSFEWPQLQEYFLDERNLAVVNLLTPHLLRYYAVYAILNRNRK----------------
A7ANK5_BABBO      AKSYEWPHVQEYLIDDRNMAVVQIVAPHLLRYYAVYAILHRNRK----------------
Q4Z7U2_PLABA      PKNNTFSILQDWFIDEKNLSILNLICPHIIRYYCVYSIFYRNRK----------------
Q4XVK1_PLACH      PKNNTFSILQDWFIDEKNLSILNLICPHIIRYYCVYAIFYRNRK----------------
Q7RQ22_PLAYO      PKNNTFSILQDWFIDEKNLSILNLICPHIIRYYCVYSIFYRNRK----------------
B3L5Y1_PLAKH      PKNNSFSMLQDWFIDEKNLSILNLICPHIIRYYCVYAIFYRNRK----------------
A5K977_PLAVS      PKNNSFSMLQDWFIDEKNLSIINLICPHIIRYYCVYAIFYRNRK----------------
Q8I3I5_PLAF7      PKNNSFSMLQDWFIDEKNLSILNLICPHIIRYYCVYAIFYRNRK----------------
B6KDN0_TOXGV      PRNQAWSLMLEWVLHEGNLSCVTVVCPHLLRYYAVYAILNRKRK----------------
EIF3E_DICDI       -RSSLVDLLLE----DKYLNAIQTTCPHILRYLAVAIIVNKKKQQSN-------------
F0ZI56_DICPU      -RSSLVDLLLE----DKYLNAIQTTCPHILRYLAVAIIVNKKKQQSN-------------
D3AVQ5_POLPP      -RALLVDLLLD----DKYLNAIQTICPHVLRYLAVAIITNRRKPQQ--------------
EIF3E_CAEEL       GRDEIIEMFLNQ---QPYLNAIQVLAPHLLRYLAVAVVTSK-SR----------------
G4M126_SCHMA      GKEKLIEWFMQN---TTHLNAIQTLAPHLLRYLTVCVITST-DK----------------
W5JQD6_ANODA      GRDLIIDMFLYK---PQYLNAIQTMCPHILRYLATAVIINR-------------------
EIF3E_ANOGA       GRDLIIDMFLYK---PQYLNAIQTMCPHILRYLATAVIINR-------------------
EIF3E_AEDAE       GRDLIIEMFLYK---PLYLNAIQTMCPHILRYLATAVIINR-------------------
EIF3E_DROME       GRDLIIEMFLYK---PLYLNAIQTMCPHIMRYLATAVVINR-------------------
EIF3E_DROPS       GRDLIIEMFLYK---PLYLNAIQTMCPHIMRYLATAVVINR-------------------
EIF3E_BOMMO       GRDLIIEMFLYK---PLYLNAIQTMCPHILRYLATAVIINR-------------------
E0VAQ3_PEDHC      GRDNIIDMFLYR---AHYLNAIQTMCPHILRYLATAVVINR-------------------
EI3EA_DANRE       GRDNIIELFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EI3EB_DANRE       GRDNIIELFLYQ---PQYLNAIQTMCPHILRYLSTAVITNKDVR----------------
EIF3E_BOVIN       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
G1QVT7_NOMLE      GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
G1P8X3_MYOLU      GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
H0X2Y0_OTOGA      GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_PONAB       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_RAT         GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_HUMAN       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_MOUSE       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
G1M2D6_AILME      GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_CHICK       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
H3A4A4_LATCH      GRDNIIELFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
EIF3E_XENTR       GRDNIIDLFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
H3DDC2_TETNG      GRDNIIELFLYQ---PQYLNAIQTMCPHILRYLTTAVITNKDVR----------------
C3Y1L0_BRAFL      GRDMIIDLFLYQ---PSYLNAIQTMCPHILRYLTTAVICNK-------------------
EIF3E_NEMVE       GRDLIIDLILYQ---PQYLNAIQTMCPHILRYLTTAVITNK-------------------
E9GEY1_DAPPU      GRDLIVEMLLYQ---NQYLNAIETMCPHILRYLTTAVIINK--Q----------------
B3S263_TRIAD      GKDDLIELFLYA---PQYVNAIQTQCPYILRYVAAAVVINP-TK----------------
F4P7G6_BATDJ      GKDGLIDLFFL----PAYLNAIQTSCPWLLRYLAAAVIINK-------------------
EIF3E_ARATH       GRTQIIDLFNQ----DKYLNAIQTSAPHLLRYLATAFIVNK--R----------------
F6HS75_VITVI      GRTHIIDLFNQ----DKYLNAIQTNAPHLLRYLATALIVNK--R----------------
A9TXR1_PHYPA      GRNGIIDLFFS----ERYLNAIQTNAHHLLRYLATAVIVNK--R----------------
A9SFG7_PHYPA      GKNGIIDLFFS----ERYLNAIQTNAHHLLRYLVTAVIVNK--R----------------
A8JGK5_CHLRE      GRNDIIDLFLS----PAYISAIQINAPHLLRYVAVAVVINK--K----------------
D0NHD9_PHYIT      GRDAIVDFMLQ----SRCVEAIQSNAPWLLRYLCAGVILHK-------------------
EIF3E_EMENI       ARDVLTDLFFS----PAYINTIQTSCPWILRYLAAAVITNRNRA----------------
EIF3E_ASPFU       ARDVLTDLFFS----PAYINTIQTNCPWILRYLAAAVITNRNRA----------------
C0NV20_AJECG      ARDTLTDLFFS----PAYINTIQTACPWILRYLAAAVITSRSRA----------------
EIF3E_SCLS1       ARDVICDLFFS----PAFINTIQTACPWILRYLTAAVITNRNR-----------------
EIF3E_PHANO       ARESLTDMFFS----PSYINTIQTNCPWILRYLAAAVITNRNK-----------------
C7YPX8_NECH7      AREPILDMFFS----APYINTIQTSCPWILRYLIAAVITGRGR-----------------
EIF3E_NEUCR       AREPLLDLFFN----AGFINTIQANSPWILRYLTVAVITNRGR-----------------
EIF3E_SCHPO       GCDTLCDLFFY----TPYLNTIQTSCPWLLRYLTVAVVTNQNNAN---------------
EIF3E_YARLI       GKDALCDLFFS----SSYISTIQAACPWILRYLVVAVIAGGH------------------
A8P8E3_COPC7      GRTLLLETFLS----PTYLNTIQTASPWILRYLAAAAILSRKTA-------------AAS
EIF3E_USTMA       GREQLVEMFLS----PVYLNTIQTTCWWLLRYVVAALLLSRRTTRVYLVQQPAPATLMAS
EIF3E_CRYNJ       GCQGLLDMFLS----PAYLNTIQTSCPHLLRYLVAAAIISRRAP----------------
E3L1Q1_PUCGT      GRSSLVDAWLG----QGYLNTIQTSCPYLLRYLVVALVVSKRAG---------------S
B7G3T4_PHATC      RLENLVDLCFQ----EKYKQAITTNAPHLLRYLTAAVLLCKRRAVSP-------------
B8BUG4_THAPS      GLESMVELFTS----EKYLQAVTTHAPHLLRYLTAAVLLCKRRAAKKA------------
EIF3E_MONBE       GPDGIVDLFMNK---ETCTNAMQTIAPHLFRYATAVAIMSRRKK----------------
A4I3W2_LEIIN      YSLQLLYFIFDHRHDQTYRKAVETVCPHYLRYICAAVLLHRTRY----------------
Q4Q833_LEIMA      YSLQLLYFIFDHRHDQTYRKAVETVCPHYLRYICAAVLLHRTRY----------------
A4HGT5_LEIBR      YSLQLLYFIFDHRHDQTYRKTVETVCPHYLRYICAAVLLHRSRY----------------
Q383C1_TRYB2      YSTHLLNIVFDNKTDSIYQCVVETVCPHYLRYICAAAILNTHRR----------------
V5BEE1_TRYCR      YSTHLLNFVFDIKTNFVYQSVVETVCPHYLRYICAAAILNKQRR----------------
A0CLZ2_PARTE      -ISDDTNAFLEIFSGEQFLEVVHTIAPYLLYYYTVALLINQQFI----------------
A0D3M3_PARTE      -ISDDTNAFLELFSGDQFLEVVHTIAPYLLYYYAVALLINQQFV----------------
                                       :       : *  .  :                      

Q4UE81_THEAN      -------------DHFRTISNVIANTKHKY--NDTFTSLLGALFVDFNFEAAQKHIVEIK
Q4N5B4_THEPA      -------------DHFKTISNVIANTKHKY--NDTFTSLLGALFVDFNFEAAQKHIVEIK
A7ANK5_BABBO      -------------DHFKVISAAISNGKSKY--SDTFTALVGALFVDFNFEDAQKHIARIQ
Q4Z7U2_PLABA      -------------DHFELILNTLNLLKSKY--TDSFTSLLISIFTDYNFNLAQKCISEIG
Q4XVK1_PLACH      -------------DHFELILNTLNLLKSKY--TDSFTSLLISIFTDYNFNLAQKCISEIG
Q7RQ22_PLAYO      -------------DHFELILNTLNLLRSKY--TDSFTSLLVSIFTDYDFNLAQKCISEIG
B3L5Y1_PLAKH      -------------DHFELILNTLNLLKPKY--TDPFTSLLISIFTEYDFNMAQKCIAELG
A5K977_PLAVS      -------------DHFELILNTLNLLKPKY--TDPFTSLLISIFTEYDFNMAQTCIAQLG
Q8I3I5_PLAF7      -------------DHFELILNTLNFIKSKY--NDSFTSLLISIFTDYDFNMAQTCIATIG
B6KDN0_TOXGV      -------------DHFQAVITAIGQGKNRY--SDPFTSLLEALFLDFNFDEAQHHIARIG
EIF3E_DICDI       ----------VFQRILNALVRVVEQEAYVY--RDPITQFISSLFVKFNFEDAQAQLILCE
F0ZI56_DICPU      ----------VFQRVLNALIRVVEQESYVY--RDPVTAFISNLFVKFNFDEAQAQLTLCE
D3AVQ5_POLPP      ---------------LYQLVKVIEQEAYTY--KDPITIFVSSLYVRFNFEESQQYLAQCE
EIF3E_CAEEL       ----------QK-NSLKDLVKVIDIERHSY--KDPVTDFLTCLYIKYDFDEAQEMLQKCE
G4M126_SCHMA      ----------KKKNLIRDLKYLIQQESYSY--RDPVTEFFECLFVKFDFDGAQQKLRVCE
W5JQD6_ANODA      ----------GRRNALKDLIKVIQQESYTY--RDPITEFLEHLYVNFDFEGARKKLHECQ
EIF3E_ANOGA       ----------GRRNALKDLIKVIQQESYTY--RDPITEFLEHLYVNFDFEGARKKLHECQ
EIF3E_AEDAE       ----------GRRNALKDLIKIIQQESYTY--RDPITEFLEHLYVNFDFEGARMKLHECQ
EIF3E_DROME       ----------TRRNALKDLIKVIQQESYTY--RDPITEFLECLYVNFDFEGARLKLHECQ
EIF3E_DROPS       ----------TRRNALKDLIKVIQQESYTY--RDPITEFLECLYVNFDFEGARLKLHECQ
EIF3E_BOMMO       ----------SRRNALKDLVKVIQQEAYTY--RDPITEFIEHLYVNFDFEAARRKLNQCQ
E0VAQ3_PEDHC      ----------SRRSSLKDLVKVIQQESYTY--RDPITEFIEHLYVNFDFDGARQKLHECH
EI3EA_DANRE       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDSAQKKLRECE
EI3EB_DANRE       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDSAQRKLRECE
EIF3E_BOVIN       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
G1QVT7_NOMLE      ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
G1P8X3_MYOLU      ----------KRRQVLKELVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
H0X2Y0_OTOGA      ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_PONAB       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_RAT         ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_HUMAN       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_MOUSE       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
G1M2D6_AILME      ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_CHICK       ----------KRRQVLKDLVKVIQQESYTY--RDPITEFVECLYVNFDFDGAQKKLRECE
H3A4A4_LATCH      ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
EIF3E_XENTR       ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDGAQKKLRECE
H3DDC2_TETNG      ----------KRRQVLKDLVKVIQQESYTY--KDPITEFVECLYVNFDFDSAQKKLRECE
C3Y1L0_BRAFL      ----------RRRTVLKDLVKVIQQESYTY--QDPITEFLECLYVNFDFDGAQKKLRECE
EIF3E_NEMVE       ----------RRRPVLKDLVKVIQQESYTY--RDPITEFLECLYVNFDFDGAQKKLRECE
E9GEY1_DAPPU      ----------NRRTMLKDLVKVIQQESYAY--RDPITEFIEHLYVNFDFDAAQQKLRQCK
B3S263_TRIAD      ----------IRRGVFKDLIKFIQQESGAY--KDPITEFLEHIYVNFDFDNAQQMLRECE
F4P7G6_BATDJ      ----------RRHNHLKDLVEIIKQESHAY--SDPITEFLISLYANFDFDGAQQKLAECE
EIF3E_ARATH       ----------R-RPQLKEFIKVIQQEHYSY--KDPIIEFLACVFVNYDFDGAQKKMKECE
F6HS75_VITVI      ----------R-RTQFKDFIKVIQQEQYAF--KDPITEFLACVYVNYDFDGAQKKMRECE
A9TXR1_PHYPA      ----------R-RNMIKELIKVIQQERYSY--SDPVTEFLECLYVNYDFEGAQRKLRECE
A9SFG7_PHYPA      ----------R-RNVIKELIKVIQQERYTY--SDPVTEFLECLYVNYDFEGAQQKLRECE
A8JGK5_CHLRE      ----------KQRSVLKELIRAIQQESYEY--SDPVTQFLECVFVHYDFDGAQQKLKECE
D0NHD9_PHYIT      ----------RRRNLIKDLLRVLRVDDKGY--RDPIVDFVDCLFVSFDFESAQEKLRECE
EIF3E_EMENI       -----HKNSSVYQKQLKDLIRVVRQEGYEY--SDPITDFVKALYVDFDFEEAQKKLGEAE
EIF3E_ASPFU       -----HKNSSVYQKQLKDLIRVVRQEGYEY--NDPITDFIKALYVDFDFEEAQKKLGEAE
C0NV20_AJECG      -----HKNTSLYQKQLKDLIRVVRQEQYEY--QDPIVDFIKALYIDFDFEGAQQKLGEAE
EIF3E_SCLS1       -----TRNTGQYQKQLKDIIRIVKQENYEY--SDPVTDFIKALYLDFDFEEAQKKLSEAE
EIF3E_PHANO       -----GRNSNQYQKQLKDLIRIVRQEGYEY--SDPVTDFIKALYIDFDFEEAQKKLSETE
C7YPX8_NECH7      -----ARNSSIQQKQVKDIIRYVRQEAYEY--TDPITQFVNALYIAHDFEAAREALSMAE
EIF3E_NEUCR       -----AKNAGVHQKQMKDVVRIVKQEAYEY--QDPITRFVHALCIDFDFEEAQQQLVLAE
EIF3E_SCHPO       --QKPRNPRQSYQRRMRDLVRIISQENYEY--SDPVTSFISALYTEVDFEKAQHCLRECE
EIF3E_YARLI       -----PHTASVFQKRLKDLVRVVGQEEYEY--QDPLTRFVKSLYIDYSFEDAQNQLADCE
A8P8E3_COPC7      NNSAAPVSSR-VRHAIREVVKVIQTEEYQY--QDPITNFLRELYVEFDFERAQQELSKAE
EIF3E_USTMA       VSGANVNKLS-PQQAIKDIVNIIDSESYRIAGTDPIVDFLSKLFVDFDFEAAQEQLTLAE
EIF3E_CRYNJ       ----KPANVR-SRDHVKELTRIVETEEYQY--TDPITSFLKDVFADFDLTQAQQRLSVAE
E3L1Q1_PUCGT      GSLKGPSSSRGSRETIKEVLRAVSQESYQY--SDPITDFLLNLYVKVDFEGAQKALKQSE
B7G3T4_PHATC      ------------RRVLRSLIYVMQDCDYVD----PIVDFVDCLCVKFDFDKAQTKLAECE
B8BUG4_THAPS      ----GSNSNAEGRRLLRDLVKVMQQCEYSD----PIVEFVDKLSVKFDFEAAQSQLARCE
EIF3E_MONBE       ------------RDVMWEFVGIARQDKDLG--DDPVVGFLVSLIKDFDFVTAEEKLQQCR
A4I3W2_LEIIN      ----------------SNFVSAAELVEAIYEYSDPLTQLVSLIQK-ASFEDAIALLPEVR
Q4Q833_LEIMA      ----------------SNFVSAAELVESIYEYSDPLTQLVSLIQK-ASFEDAIALLPEVR
A4HGT5_LEIBR      ----------------SNFVSAAELVESIYEYSDAITQLVNLIQK-ASFEDAIALLPEVR
Q383C1_TRYB2      ----------------SALRRAAEMVGRIYEYSDPLTQLVREITNYRSFEDTLELLPKVS
V5BEE1_TRYCR      ----------------SALRSAAAMVLNVYEYSDPITQLVNAIVNRQSFEDALALLPEVK
A0CLZ2_PARTE      ---------------GNTSLAIIGNNANKSIKPFHLLNYVEEIIVKFQFNNAIKMISDIS
A0D3M3_PARTE      ---------------GNTSLAQIGANASKSVMHFHLLNYVEEIIVKFQFDNAIKMVNDIA
                                                     .   .  :    .:  :   :    

Q4UE81_THEAN      EACYVDVLLN-----------PLKDAIEESSRHIIFETYCRIHKSINLDIIAQNVNMTSL
Q4N5B4_THEPA      EACYVDVLLN-----------PLKDAIEESSRHIIFETYCRIHKSINLDIIAQNVNMTSL
A7ANK5_BABBO      DACRLDVFLD-----------PLKFQIEEHSRHIIFETYCRIHKSINLDLIAQKVNMSAL
Q4Z7U2_PLABA      QICQNDVFLF-----------KLKPYIEEQSRFIIFETYCRIHKSINIDMLANQVNLQRD
Q4XVK1_PLACH      NICQNDVFLF-----------KLKPYIEEQSRFIMFETYCRIHKSINIDMLANQVNLQRD
Q7RQ22_PLAYO      QICQNDIFLF-----------KLKPYIEEQSRFIIFETYCRIHKSINIDMLANQVNLQRD
B3L5Y1_PLAKH      SICEKDIFLF-----------KLKPFIEEQSRYIIFETYCRIHKSINIDMIANKVNLPRD
A5K977_PLAVS      SICEKDIFLF-----------KLKPFIEEQSRYIIFETYCRIHKSINIDMIANKVNLPRD
Q8I3I5_PLAF7      TLCERDVFLY-----------KLKPYIEEHCRFIIFETYCRIHKSINIDMISSKVNLTRE
B6KDN0_TOXGV      EECDSDFFLQ-----------PLKGAINEFARLLIFETYCRIHKCINVDMIAKKVNMSPE
EIF3E_DICDI       KVLKNDFFLN-----------TCVDEFMENARVCVFETYCNILESIDIDMLCKNLRIDPE
F0ZI56_DICPU      KVLKNDFFLH-----------TCVEEFMENSRVCVFETYCNILENIDIDMLCKNLGIPQE
D3AVQ5_POLPP      QVLKQDFFLS-----------SCYDDFMEHARACIFETYCNIHENIDIDMLCKNLGIAPE
EIF3E_CAEEL       EVLSNDFFLT-----------AVLGDFRESARLLIFEMFCRIHQCITIEMLARRLNMSQE
G4M126_SCHMA      TVLPNDFFLT-----------GCYDEFMENARLLMFESFCRIHHSVGISVLAEKLNMDVD
W5JQD6_ANODA      TVIINDFFII-----------GCLDEFIENARLMIFETFCRIHQCITIGMLADKLNMKPD
EIF3E_ANOGA       TVIVNDFFII-----------GCLTEFVENARLMIFETFCRIHQCITIGMLADKLNMKPD
EIF3E_AEDAE       TVIVNDFFII-----------GCLQEFIENARLMIFETFCRIHQCITIGMLADKLNMEPD
EIF3E_DROME       TVILNDFFIV-----------ACLNEFVEDARLMIFETFCRIHQCITISMLADKLNMKPN
EIF3E_DROPS       TVILNDFFIV-----------ACLNEFVEDARLMIFETFCRIHQCITISMLADKLNMKPN
EIF3E_BOMMO       AVLLTDFFLI-----------ACLEEFVENARLMIFETFCRIHQVISIGMLAENLNMQPD
E0VAQ3_PEDHC      TVLFNDFFLI-----------ACLEEFVENARLMIFETFCRIHQCISIGMLAQKLNMNPD
EI3EA_DANRE       AVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISIGMLADKLNMTPE
EI3EB_DANRE       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISISMLADKLNMTPE
EIF3E_BOVIN       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
G1QVT7_NOMLE      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
G1P8X3_MYOLU      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
H0X2Y0_OTOGA      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
EIF3E_PONAB       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
EIF3E_RAT         SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
EIF3E_HUMAN       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
EIF3E_MOUSE       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
G1M2D6_AILME      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPE
EIF3E_CHICK       TVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISIGMLADKLNMTPE
H3A4A4_LATCH      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISISMLADKLNMTPE
EIF3E_XENTR       SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISISMLADKLNMTPE
H3DDC2_TETNG      SVLVNDFFLV-----------ACLEDFIENARLFIFETFCRIHQCISISMLADKLNMSPE
C3Y1L0_BRAFL      TVLVNDFFLV-----------ACLEEFIENARLFIFETFCRIHQCISISMLAEKLNMTPD
EIF3E_NEMVE       TVLLNDFFLV-----------ACRDDFIENARLFIFETFCRIHQCISISMLAEKLNMTPE
E9GEY1_DAPPU      DVLLNDFFLV-----------AVLDDFIENARLMIFETFCRIHQCISIKMLAEKLNMTAE
B3S263_TRIAD      TVISNDIFLV-----------SSLDDFIESARRLIFETFCRIHHRISISMLAEKLNMTQD
F4P7G6_BATDJ      AVFSNDFFLV-----------HFLSEFRESARLFIFEMYCRIHQHIDIRALCDKLNMDSV
EIF3E_ARATH       EVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFVFETYCKIHQRIDMGVLAEKLNLNYE
F6HS75_VITVI      EVILNDPFLGKRVEEGSFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLSDKLNLNYE
A9TXR1_PHYPA      ELIVSDFFLGKQTSENGFVPIPLLDEFMENARLFIFETYCRIHQCIDICMLSQKLNMNYD
A9SFG7_PHYPA      EVIVSDFFLGKQLSENGFVTIPLRDEFMENARLFIFETYCRIHQCIDIGMLSQKLNMNYD
A8JGK5_CHLRE      AVLDNDFFLA-----------AYKDEFIENARLFIFETYCRIHQSISIALLAERLGMDQE
D0NHD9_PHYIT      VVLASDFFLYE----------KNSTDFMEAARLAIFEMYCRVHRTIDMKVLSSKLAMQED
EIF3E_EMENI       EVLRGDFFLV-----------SAADAFVEAARHLISESYCKIHQRIDIKDLSTRLGLN--
EIF3E_ASPFU       EVLRSDFFLV-----------STTDAFVEAARHLISESYCKIHQRIDIKDLSTRLGLN--
C0NV20_AJECG      EILRNDFFLV-----------AAADAFVDAARHLISESYCKIHQRIDIKDLSTRLGLN--
EIF3E_SCLS1       EVLRSDFFLV-----------AASENFVEAARHLISESYCKIHQRIDIKDLSARLGLN--
EIF3E_PHANO       EILKNDFFLL-----------GAADQFVDAARHLISESYCKIHQRIDIKDLSTRLGLS--
C7YPX8_NECH7      QVCRSDFFLA-----------SSADAFVDAARHLICESYCKIFSRMNIRDLSSKLGLN--
EIF3E_NEUCR       EVLRSDFFLL-----------AHADDFVDSARHLIFESYCKIHARISLKDLSARLGLN--
EIF3E_SCHPO       EVLKTDFFLV-----------SLCDHFLEGARKLLAEAYCRIHSVISVDVLANKLEMD--
EIF3E_YARLI       KVLKQDFFLA-----------DSADAFLESARKLMSQVYCRVHQRVDIAQLSQTLNLS--
A8P8E3_COPC7      EVVSNDFFLN-----------QFVEEFLDNARYLISEAYCRIHQKIDIADLSARLNLS--
EIF3E_USTMA       QVASKDFFLA-----------DFKDELVEACRVVISEAYCRIHSKVDIADLVKRLNLS--
EIF3E_CRYNJ       SVVRSDFFLS-----------GFADEFVENARWLISEVICRLHRRIDIGQLSKTLNLS--
E3L1Q1_PUCGT      KVFNVDFFLS-----------EEMNPWVENCRIMISETYCRVHHRIDIADLASRLGLNEN
B7G3T4_PHATC      RVLGTDFFLC-----------QQTDLFMEEARVFVFENYCRIHNKIDLQTLGDKLAMDQI
B8BUG4_THAPS      TVLSSDFFLC-----------KQTELFMEEARVFVFENYCRIHHKIDLTTLGEKLAMDRD
EIF3E_MONBE       EVLSKDYFLA-----------EMTDEFINTAQLYLFEVYLRVHSRVSIKNAATRLGKSED
A4I3W2_LEIIN      RMIKEDYFLA-----------DYEDELIENAKRMIFSKYMSLHSVVSIPYVAEQLDMSKA
Q4Q833_LEIMA      RMIKEDYFLA-----------DYEDELIENAKRMIFSKYMSLHSVVSIPYVAEQLDMSKA
A4HGT5_LEIBR      RVIREDYFLA-----------DYEEELIENAKRMIFSKYMSLHSVVSISYVAEQLDMSKA
Q383C1_TRYB2      ELAQGDYFLN-----------LHADNLVENAKRLIFTQYVVTHSVVSIPYMAERLEMSAA
V5BEE1_TRYCR      STALGDYFLS-----------LHANEILENARRLIFARYMMTHSVVSIPYVAEKLGTRTA
A0CLZ2_PARTE      TEIEQDFIVK-----------SKKALIINACKLYFFSTYIKIFNGIQIKQFSTYLQLNEE
A0D3M3_PARTE      TEIDKDFIVK-----------SKKAIIINACKLYFFSTYIKILNGVQIKQFSNYLQLNEE
                       * ::                   : .:  .          : :      :     

Q4UE81_THEAN      ------DAERWIVN----------------------------------IIRHSH--VEAK
Q4N5B4_THEPA      ------DAERWIVN----------------------------------IIRHSH--VEAK
A7ANK5_BABBO      ------EAERWIVG----------------------------------LIRHSH--LEAK
Q4Z7U2_PLABA      ------EAEKWIVN----------------------------------LIRNAK--LDAK
Q4XVK1_PLACH      ------EAEKWIVN----------------------------------LIRNAK--LDAK
Q7RQ22_PLAYO      ------EAEKWIVN----------------------------------LIRNAK--LDAK
B3L5Y1_PLAKH      ------DAEKWIVN----------------------------------LIRNAK--LDAK
A5K977_PLAVS      ------DAEKWVVN----------------------------------LIRNAK--LDAK
Q8I3I5_PLAF7      ------QAEKWIVN----------------------------------LIRNAK--LDAK
B6KDN0_TOXGV      ------AAERWIVN----------------------------------LIRHAR--LEAR
EIF3E_DICDI       ------SSEKWIVE----------------------------------AIRNTR--FSAK
F0ZI56_DICPU      ------SSEKWIVE----------------------------------AIRNTR--FTAK
D3AVQ5_POLPP      ------NSEKWIVE----------------------------------AIRNAR--FVAK
EIF3E_CAEEL       ------EAERWIVD----------------------------------LIRTYR-IEGAK
G4M126_SCHMA      ------DAEKWIVN----------------------------------LIRNAR-MD-AK
W5JQD6_ANODA      ------EAECWIVN----------------------------------LIRNAR-LD-AK
EIF3E_ANOGA       ------EAECWIVN----------------------------------LIRNAR-LD-AK
EIF3E_AEDAE       ------EAECWIVN----------------------------------LIRNAR-LD-AK
EIF3E_DROME       ------EAECWIVN----------------------------------LIRNAR-LN-AK
EIF3E_DROPS       ------EAECWIVN----------------------------------LIRNAR-LN-AK
EIF3E_BOMMO       ------EAECWIVN----------------------------------LIRNAR-LD-AK
E0VAQ3_PEDHC      ------EAECWIVN----------------------------------LIRNAR-LD-AK
EI3EA_DANRE       ------EAERWIVN----------------------------------LIRNAR-LD-AK
EI3EB_DANRE       ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_BOVIN       ------EAERWIVN----------------------------------LIRNAR-LD-AK
G1QVT7_NOMLE      ------EAERWIVN----------------------------------LIRNAR-LD-AK
G1P8X3_MYOLU      ------EAERWIVN----------------------------------LIRNAR-LD-AK
H0X2Y0_OTOGA      ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_PONAB       ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_RAT         ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_HUMAN       ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_MOUSE       ------EAERWIVN----------------------------------LIRNAR-LD-AK
G1M2D6_AILME      ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_CHICK       ------EAERWIVN----------------------------------LIRNAR-LD-AK
H3A4A4_LATCH      ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_XENTR       ------EAERWIVN----------------------------------LIRNAR-LD-AK
H3DDC2_TETNG      ------EAERWIVN----------------------------------LICNAR-LD-AK
C3Y1L0_BRAFL      ------EAERWIVN----------------------------------LIRNAR-LD-AK
EIF3E_NEMVE       ------EAERWIVN----------------------------------LIRNAK-LD-AK
E9GEY1_DAPPU      ------DAERWIVN----------------------------------LIRNAR-LD-AK
B3S263_TRIAD      ------AAERWIVD----------------------------------LIRTAL-LD-AK
F4P7G6_BATDJ      ------EGEKWIVN----------------------------------LIRDAR-MH-AK
EIF3E_ARATH       ------EAERWIVN----------------------------------LIRTSK-LD-AK
F6HS75_VITVI      ------EAERWIVN----------------------------------LITTSK-LD-AK
A9TXR1_PHYPA      ------DAERWIVN----------------------------------LIRNAR-LD-AK
A9SFG7_PHYPA      ------DAARWIAN----------------------------------LIRNAR-LD-AK
A8JGK5_CHLRE      ------AAEKWIAN----------------------------------LILNAK-LN-AK
D0NHD9_PHYIT      G-----EAEKWIVN----------------------------------LIRNAR-LD-AK
EIF3E_EMENI       ----QDEGEKWIVN----------------------------------LIRDTR--VDAK
EIF3E_ASPFU       ----QDEGEKWIVN----------------------------------LIRDTR--VDAK
C0NV20_AJECG      ----QDEGEKWIVN----------------------------------LIRDTR--VDAK
EIF3E_SCLS1       ----QDEGEKWIVN----------------------------------LIRDTR--VDAK
EIF3E_PHANO       ----QDEGEKWIVN----------------------------------LIRDTR--VDAK
C7YPX8_NECH7      ----PDDGEKWIVN----------------------------------LIRETR--LDAK
EIF3E_NEUCR       ----NDDAEKWIVN----------------------------------LIRDTR--LDAK
EIF3E_SCHPO       ----SAQLIQLVENRNNPSVAAASNVAADQSTEDESIESTSTNVVADDLITEAE--TATE
EIF3E_YARLI       ----QEQGEKWIAN----------------------------------LIKDSR--MDAK
A8P8E3_COPC7      ----PEDGEKWIVN----------------------------------LIRETRMGADAK
EIF3E_USTMA       ----KEDGEKWIVN----------------------------------LVRDTR--ADAK
EIF3E_CRYNJ       ----NEEGEKWIVN----------------------------------LIRDSRMGVEAK
E3L1Q1_PUCGT      SDGQQEEGEKWIVN----------------------------------LVRDAR--LDAK
B7G3T4_PHATC      ------QAERWIVD----------------------------------LIRNAD--LDAK
B8BUG4_THAPS      ------RAERWIVD----------------------------------LIRNAL--LDAK
EIF3E_MONBE       ------DAEEWLVK----------------------------------LIRDAK--LDAQ
A4I3W2_LEIIN      ------DAEVWLVN----------------------------------LISESV-KHRAK
Q4Q833_LEIMA      ------DAEVWLVN----------------------------------LISESV-KHRAK
A4HGT5_LEIBR      ------DAEVWLVN----------------------------------LISESV-KHRAK
Q383C1_TRYB2      ------GAEVWLAD----------------------------------LISET--KQRAK
V5BEE1_TRYCR      ------DAEVWLAN----------------------------------LISET--KQRAK
A0CLZ2_PARTE      ------ETESWLVN----------------------------------AIRTLN--INAK
A0D3M3_PARTE      ------ETESWLVN----------------------------------AIRTLN--INAK
                             :                                     :        :.

Q4UE81_THEAN      IDSEKN-------------CVEISTVPPNLYQQVIEKTQNLTLRSNMILQNLSQMTPNSD
Q4N5B4_THEPA      IDSEKN-------------CVEISTVPPNLYQQVIEKTQNLTLRSNMILQNFSQMTGSAD
A7ANK5_BABBO      IDSEKN-------------CVEISTVPPNLYQQVIEKTQNLTLRSNIILQNLINADSSGP
Q4Z7U2_PLABA      IDSEKN-------------CIEISTTLPNLYQQVIDKTQNLTMRSNFLVQMLNRSSSDE-
Q4XVK1_PLACH      IDSEKN-------------CIEISTTLPNLYQQVIDKTQNLTMRSNFLVQMLNRSSSDE-
Q7RQ22_PLAYO      IDSEKN-------------CIEISTTLPNLYQQVIDKTQNLTMRSNFLVQMLNRSSSDE-
B3L5Y1_PLAKH      IDSEKN-------------CIEISTTLPNLYQQVIDKTQNLTMRSNFLVQVLNRSSTDE-
A5K977_PLAVS      IDSEKN-------------CIEISTTLPNLYQQVIDKTQNLTMRSNFLVQVLNRSSTDE-
Q8I3I5_PLAF7      INSEKN-------------CIEISTPPPNLYQQVIDKTQNLIMRSNFIVQVLNRSSNDDQ
B6KDN0_TOXGV      IDSEKN-------------RVQMSAAPPNLYQQVIDKTRNLCIRSNLILQNIARPAGFTG
EIF3E_DICDI       IDSANN-------------QIKMFTQH-NSYRQVMDKTKALFNRGIEMVVGINESRSQQN
F0ZI56_DICPU      IDSANN-------------QIKMFTQH-NSYRQVMDKTKALFNRGIEIVVGINESRTQQN
D3AVQ5_POLPP      IDSANN-------------QIKMFSQHTNAYRQVMDKTKGLFNRGIEILVGINDSRTQNA
EIF3E_CAEEL       IDSKLG-------------QVVMGVKSVSIHEQVMENTKRLTLRAQQI--ALQLEKGRQ-
G4M126_SCHMA      IDSQKG-------------VIVMGTQNVSPYQQVIERTKSSGTCAHKLLERLRWEKSID-
W5JQD6_ANODA      IDSKLG-------------HVVMGTQPLSPYQQLVEKIDSLSVRSEALTLLVERKHKAKT
EIF3E_ANOGA       IDSKLG-------------HVVMGTQPLSPYQQLVEKIDSLSVRSEALTLLVERKHKAKT
EIF3E_AEDAE       IDSKLG-------------HVVMGTQPLSPYQQLVEKIDSLSVRSEALTVLVERKQKAKT
EIF3E_DROME       IDSKLG-------------HVVMGTQPLSPYQQLVEKIDSLSMRSEHLAGLIERKSKQKQ
EIF3E_DROPS       IDSKLG-------------HVVMGTQPLSPYQQLVEKIDSLSMRSEHLAGLIERKSKQN-
EIF3E_BOMMO       IDSKLG-------------HVVMGAQPLSPYQQLVERIDSLAVRSEALTSLVERKHKARN
E0VAQ3_PEDHC      IDSKLG-------------HVVMGTQPASPYQQLVEKIDSLSVRSEALLNLIERKVKAK-
EI3EA_DANRE       IDSKLG-------------HVVMGNNAISPYQQVIEKTKSLSFRSQMLAMNIEKKQSNA-
EI3EB_DANRE       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKISHS-
EIF3E_BOVIN       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
G1QVT7_NOMLE      IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
G1P8X3_MYOLU      IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
H0X2Y0_OTOGA      IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_PONAB       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_RAT         IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_HUMAN       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_MOUSE       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
G1M2D6_AILME      IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_CHICK       LDSELG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQS-
H3A4A4_LATCH      IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQN-
EIF3E_XENTR       IDSKLG-------------HVVMGNNAVSPYQQVIEKTKSLAFRSQMLAMNIEKKTNQN-
H3DDC2_TETNG      IDSKLV-------------FLHYNKANNS---ELFWHNSPKSSRLQSLAYRISRNQQQT-
C3Y1L0_BRAFL      IDSKLG-------------HVVMGTQAISPYQQVIEKTKGLAFRSQMLLHNLDKRKGKE-
EIF3E_NEMVE       IDSKLG-------------HVVMGVQAPSVYQQVIEKTKNLQYKTQVLAGNIEKKLTQDK
E9GEY1_DAPPU      IDSQQG-------------HVVMATQTVSPYQQLIEKTKMLSVRSQKLAADIEKKLNVR-
B3S263_TRIAD      IDLKEG-------------HVIMGVQMPSVYEQIIEKTKSLTFKTQYLMQNIEKKTNMQ-
F4P7G6_BATDJ      IDSESN-------------TVIMGVQYQSVHQQVMERTKALSFRSSLLAFNIEKRETELH
EIF3E_ARATH       IDSESG-------------TVIMEPTQPNVHEQLINHTKGLSGRTYKLVNQLLEHTQAQ-
F6HS75_VITVI      IDSKSG-------------TVVMEPNHPNVYQQIIDHTKAVSGRTYKLVNQLLEKAQTQ-
A9TXR1_PHYPA      IDSKMG-------------TVVMGTQYPNIYEQIIEKTKVLSQRSYALTTNVVMTSAAV-
A9SFG7_PHYPA      IDSKMG-------------TVVMGTQSPNIYEQIIEKTKVLGQRSYALTSNLILTSAAV-
A8JGK5_CHLRE      IDSKSG-------------TVVMGTQSQSVHEQLVDKAKMLSVRTYVLANTVVGSVKP--
D0NHD9_PHYIT      IDSQEG-------------RIVMGTPLNSVHRQVIDKTRDLAARTCSMVAQFERMGKRK-
EIF3E_EMENI       IDYKEG-------------TVIMNHPPQSVYQQVIEKTKGAFFRTQVLRFVAS-------
EIF3E_ASPFU       IDYKEG-------------TVIMNHPPQSVYQQVIEKTKGAFFRTQVLSAAVAK------
C0NV20_AJECG      IDYKEG-------------TVLMNHPPQSVYQQVIERTKGAFFRTQVLSAAVAK------
EIF3E_SCLS1       IDYKEG-------------TVVMNHPPSSVYQQVIERTKGGFFRTQVLSAAVAK------
EIF3E_PHANO       IDYKAG-------------TVIMNHPPQSVYQQVIERTKGGFFRTQVLSAAVAK------
C7YPX8_NECH7      IDSQDG-------------TVVMNHPPNNVYQQVIEKTKGGFFRTQVLNAAVSK------
EIF3E_NEUCR       IDYKEG-------------TVVMNHPPSSVYQQVIERTKGGFFRTQVLTAAVAR------
EIF3E_SCHPO       AEEPEPEVQFGFKAKLDGESIIIEHPTYSAFQQIIDRTKSLSFESQNLEQSLAKSISELK
EIF3E_YARLI       IDESDS-------------TVILNHPSVSVYQQVIEKTKGLTFRSS---QVLNQGVTI--
A8P8E3_COPC7      IDLGKN-------------VIEINRPPQPVYQTVIEKTRGLALRTQAMGAALGRAAAL--
EIF3E_USTMA       IDFKEG-------------MVFMNPTHPPVYQTIIEKTRGFTFRTSAMGTAIDRKAHPP-
EIF3E_CRYNJ       IDLKEN-------------MLHITRPHATPTATLIETTRGLAFRSQAIQFAMQSSVGE--
E3L1Q1_PUCGT      IDFKEN-------------TVQMNHPASSVYQTVIERAKRITAISQDQTYKLGALALAQQ
B7G3T4_PHATC      IDSEEG-------------CVVMGGNPQSIYEQVMDRTRDLNVRSATLAQNLNNLMNQTR
B8BUG4_THAPS      IDSEEG-------------CVVMGTGSTSVYEQVMDKTRDLTARSGGLVVNLRGYVNDAR
EIF3E_MONBE       IDPASG-------------EIHITKPVTTVYQHVLDRTKNLQYRTYVIVESLHHLHPNGA
A4I3W2_LEIIN      IDSVNE-------------QLNVEPQTRSLESLIYDKLDTVLR-----------------
Q4Q833_LEIMA      IDSVNE-------------QLNVEPQTRSLESLIYDKLDTVMR-----------------
A4HGT5_LEIBR      IDSVNE-------------QLNVEPQTRSLESLIYDKLDAVLR-----------------
Q383C1_TRYB2      IDAVTG-------------QMFVGSQVRSVHQTVLDRLEPVDHGRR--------------
V5BEE1_TRYCR      IDSVSE-------------QMVVSSQARSVHQTVLDKLEVVDRR----------------
A0CLZ2_PARTE      IDGDKI--------------IVQKQDINAQNTQLLRQLRDLQPKSNMLISNLQRIINIK-
A0D3M3_PARTE      IDGDKI--------------IVQKQDNNAQNTQLLKQLRDLQPKSNMLISNLQRIINIK-
                   :                  :            :                          

Q4UE81_THEAN      NSLQNLRNSDL-GDRNLQRRLFVHNQQKKNQYKFNQGKEYQRAEQESLW-----------
Q4N5B4_THEPA      NTLQNMRTSDL-GDRNLQRRPFVYNQQKKNQHKFNQGKDFQRTDQESLW-----------
A7ANK5_BABBO      VYTRSQDDKGA-KRSGQQQR----RQQNTRFQNFSQRDFFRSAEVEQ-------------
Q4Z7U2_PLABA      -HFQKYIKFKN-KNEKNKN-KRNKQYNNNSMYTNAGKDNAKMVTANI-------------
Q4XVK1_PLACH      -HFQKYIKFKN-KNEKNKN-KRNKQYNNNSMYGNAGKDNAKMVAANI-------------
Q7RQ22_PLAYO      -HFQKYIKFKN-KNEKNKN-KRNKQYNNNSMYTNTGKDNPKMVTANI-------------
B3L5Y1_PLAKH      -QFQKNIRFKN-KNEKGKNPKRGG-KQYNSLYNPNKGGGVKLVSANM-------------
A5K977_PLAVS      -HFQKNIRFKN-KNEKGKNPKRGGGKQYNSLYSPNKGG-IKLVSANM-------------
Q8I3I5_PLAF7      QQIQKNLRFKN-KNEKNLK-NNKRNKNFNHMYHI----NNKIVAPDT-------------
B6KDN0_TOXGV      REGDDVVTSRTNRQRGGRGRQWVQGGEGDGFYRGEGGRGGRGGRGDRGHMGDGRRDPMAA
EIF3E_DICDI       RKGGD-NRKNQRGQNRNQQNQQNQQSNESNETTTTTTTAAAATTTTTTTATPTSA-----
F0ZI56_DICPU      RKGDNKDRKNQR-QNRNQP----TTTSTTTTTTTTATTPTTTTTTPVATAAPTATA----
D3AVQ5_POLPP      RRNAGDRNKGQRRPNNKQQQ---QQANATGAATPAQSTEATATAAAAVTTASTPVSV---
EIF3E_CAEEL       ------DKVKAT------------------------------------------------
G4M126_SCHMA      ------TELWSSSNLHVY------------------------------------------
W5JQD6_ANODA      -----QESGEGHWKYY--------------------------------------------
EIF3E_ANOGA       -----QEAGEGHWKYY--------------------------------------------
EIF3E_AEDAE       -----QESGEGNWKYY--------------------------------------------
EIF3E_DROME       -----NQESADSWKYY--------------------------------------------
EIF3E_DROPS       -----NKESIDSWKYY--------------------------------------------
EIF3E_BOMMO       -----QDIRWGAQEF---------------------------------------------
E0VAQ3_PEDHC      -----QESRWGAQDFY--------------------------------------------
EI3EA_DANRE       --NRNETPNWAAQDAGFY------------------------------------------
EI3EB_DANRE       --NRNETPNWAAQDTGFY------------------------------------------
EIF3E_BOVIN       --SRSEAPNWAAQDSGFY------------------------------------------
G1QVT7_NOMLE      --SRSEAPNWAAQDSGFY------------------------------------------
G1P8X3_MYOLU      --SRSEAPNWATQDSGFY------------------------------------------
H0X2Y0_OTOGA      --SRSEAPNWATQDSGFY------------------------------------------
EIF3E_PONAB       --SRSEAPNWATQDSGFY------------------------------------------
EIF3E_RAT         --SRSEAPNWATQDSGFY------------------------------------------
EIF3E_HUMAN       --SRSEAPNWATQDSGFY------------------------------------------
EIF3E_MOUSE       --SRSEAPNWATQDSGFY------------------------------------------
G1M2D6_AILME      --SRSEAPNWATQDSGFY------------------------------------------
EIF3E_CHICK       --GRSEAPNWATQDSGFY------------------------------------------
H3A4A4_LATCH      --NRNEAPNWATQDSGFY------------------------------------------
EIF3E_XENTR       --SRTEAPTWAAQDSGFY------------------------------------------
H3DDC2_TETNG      --FCFETPNWAGQDTGF-------------------------------------------
C3Y1L0_BRAFL      --DQDSVSPFF-------------------------------------------------
EIF3E_NEMVE       GGYDAYGGSWNAYEPGFLAH----------------------------------------
E9GEY1_DAPPU      ---NADASQWGNNDF---------------------------------------------
B3S263_TRIAD      -----KSGREGNVSFCI-------------------------------------------
F4P7G6_BATDJ      QRRLGHAPTTTPASGGGRKSKK--------------------------------------
EIF3E_ARATH       ------ATR---------------------------------------------------
F6HS75_VITVI      ------AAR---------------------------------------------------
A9TXR1_PHYPA      ------TASAAR------------------------------------------------
A9SFG7_PHYPA      ------TASAAQ------------------------------------------------
A8JGK5_CHLRE      ------------------------------------------------------------
D0NHD9_PHYIT      ------TFQ---------------------------------------------------
EIF3E_EMENI       ------------------------------------------------------------
EIF3E_ASPFU       ------------------------------------------------------------
C0NV20_AJECG      ------------------------------------------------------------
EIF3E_SCLS1       ------------------------------------------------------------
EIF3E_PHANO       ------------------------------------------------------------
C7YPX8_NECH7      ------------------------------------------------------------
EIF3E_NEUCR       ------------------------------------------------------------
EIF3E_SCHPO       HATV--------------------------------------------------------
EIF3E_YARLI       ------------------------------------------------------------
A8P8E3_COPC7      ----THQQLAQQQQQGGQGQQAQGGQ--QGGQRQQ---------------EAKVAQPPPA
EIF3E_USTMA       SLNNTHNLNGNDKRGNAGGRGGRGGQRNQGGQRDRSHAHNNEAKREGESASAEEAQQQQP
EIF3E_CRYNJ       ----------PRERGERGERGNKGGR------------------------------GRPR
E3L1Q1_PUCGT      DGQSTEGAAGQANGGRGGGRGGRGGG-----------------------------RGRGR
B7G3T4_PHATC      KERTKKERSSMEE-----------------------------------------------
B8BUG4_THAPS      REKIRKERKATEEAEAY-------------------------------------------
EIF3E_MONBE       FHHSNSSIPALFRRMMNEQLQGGGKSNKKGDYKKGDYKKGGDFKKGGDFKKGGDHKKRAW
A4I3W2_LEIIN      ------------------------------------------------------------
Q4Q833_LEIMA      ------------------------------------------------------------
A4HGT5_LEIBR      ------------------------------------------------------------
Q383C1_TRYB2      ------------------------------------------------------------
V5BEE1_TRYCR      ------------------------------------------------------------
A0CLZ2_PARTE      ------------------------------------------------------------
A0D3M3_PARTE      ------------------------------------------------------------
                                                                              

Q4UE81_THEAN      -----------------
Q4N5B4_THEPA      -----------------
A7ANK5_BABBO      -----------------
Q4Z7U2_PLABA      -----------------
Q4XVK1_PLACH      -----------------
Q7RQ22_PLAYO      -----------------
B3L5Y1_PLAKH      -----------------
A5K977_PLAVS      -----------------
Q8I3I5_PLAF7      -----------------
B6KDN0_TOXGV      VAASMASRRQDDTAFAA
EIF3E_DICDI       -----------------
F0ZI56_DICPU      -----------------
D3AVQ5_POLPP      -----------------
EIF3E_CAEEL       -----------------
G4M126_SCHMA      -----------------
W5JQD6_ANODA      -----------------
EIF3E_ANOGA       -----------------
EIF3E_AEDAE       -----------------
EIF3E_DROME       -----------------
EIF3E_DROPS       -----------------
EIF3E_BOMMO       -----------------
E0VAQ3_PEDHC      -----------------
EI3EA_DANRE       -----------------
EI3EB_DANRE       -----------------
EIF3E_BOVIN       -----------------
G1QVT7_NOMLE      -----------------
G1P8X3_MYOLU      -----------------
H0X2Y0_OTOGA      -----------------
EIF3E_PONAB       -----------------
EIF3E_RAT         -----------------
EIF3E_HUMAN       -----------------
EIF3E_MOUSE       -----------------
G1M2D6_AILME      -----------------
EIF3E_CHICK       -----------------
H3A4A4_LATCH      -----------------
EIF3E_XENTR       -----------------
H3DDC2_TETNG      -----------------
C3Y1L0_BRAFL      -----------------
EIF3E_NEMVE       -----------------
E9GEY1_DAPPU      -----------------
B3S263_TRIAD      -----------------
F4P7G6_BATDJ      -----------------
EIF3E_ARATH       -----------------
F6HS75_VITVI      -----------------
A9TXR1_PHYPA      -----------------
A9SFG7_PHYPA      -----------------
A8JGK5_CHLRE      -----------------
D0NHD9_PHYIT      -----------------
EIF3E_EMENI       -----------------
EIF3E_ASPFU       -----------------
C0NV20_AJECG      -----------------
EIF3E_SCLS1       -----------------
EIF3E_PHANO       -----------------
C7YPX8_NECH7      -----------------
EIF3E_NEUCR       -----------------
EIF3E_SCHPO       -----------------
EIF3E_YARLI       -----------------
A8P8E3_COPC7      GQTVAVA----------
EIF3E_USTMA       AQAIAAN----------
EIF3E_CRYNJ       TQEVAA-----------
E3L1Q1_PUCGT      ATIAEMDD---------
B7G3T4_PHATC      -----------------
B8BUG4_THAPS      -----------------
EIF3E_MONBE       VK---------------
A4I3W2_LEIIN      -----------------
Q4Q833_LEIMA      -----------------
A4HGT5_LEIBR      -----------------
Q383C1_TRYB2      -----------------
V5BEE1_TRYCR      -----------------
A0CLZ2_PARTE      -----------------
A0D3M3_PARTE      -----------------