CLUSTAL format seed alignment for MF_03005

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EIF3F_DICDI       ------------------------------------------------------------
F0ZV65_DICPU      ------------------------------------------------------------
D3B645_POLPP      ------------------------------------------------------------
EIF3F_HUMAN       --------------MATPAVPVSAPPATPTPVPAAAP----ASVPAP-TPAPAAAPVPAA
EIF3F_PANTR       --------------MATPAVPVSAPPATPAPVPAAAPVSAPASVPAP-TPAPAAAPVPAA
M3Z9H6_NOMLE      --------------MATPAVPASAPVATPAPVSAAAPASVPASVPAP-TPAPAAAPVPAA
H0WMC2_OTOGA      ANSLPSGLGSFFHKMAAPAVTASDPPANPGPAPAAAPALAPASTPAP-APTP--APAPAA
E1C050_CHICK      -------------------------MAAPAPAAAPAP---PAAAPAP-SPTAAPATPTAG
EIF3F_MOUSE       --------------MASPAVPANVPPATAAAAPAPVVTAAPASAPTPSTPAPTPAATPAA
Q4SVD2_TETNG      --------------------------------------------------------MSVY
C3XZD8_BRAFL      --------------------------------------------------------MEGQ
B7P2T8_IXOSC      ---------------MGRSTAFSVFPDQGRKFDWHTATISSEKVGSQQCVVRHLEYLLFH
A7SIV6_NEMVE      ------------------------------------------------------------
EIF3F_ANOGA       ------------------------------------------------------------
W5J565_ANODA      ------------------------------------------------------------
EIF3F_AEDAE       ------------------------------------------------------------
EI3F1_DROGR       ------------------------------------------------------------
EI3F1_DROME       ------------------------------------------------------------
EI3F1_DROPS       ------------------------------------------------------------
E0W3F6_PEDHC      ------------------------------------------------------------
EIF3F_BOMMO       ------------------------------------------------------------
E9H7Q2_DAPPU      ------------------------------------------------------------
EI3F2_DROME       ------------------------------------------------------------
EI3F2_DROPS       ------------------------------------------------------------
EI3F2_DROGR       ------------------------------------------------------------
B3RIH4_TRIAD      ------------------------------------------------------------
EIF3F_ARATH       ------------------------------------------------------------
D7TMG2_VITVI      ------------------------------------------------------------
A9TT42_PHYPA      ------------------------------------------------------------
A9RVP0_PHYPA      ------------------------------------------------------------
A8J9A9_CHLRE      ------------------------------------------------------------
D0NBC1_PHYIT      ------------------------------------------------------------
A9UW93_MONBE      ------------------------------------------------------------
EIF3F_ASPFU       ------------------------------------------------------------
C8VRX6_EMENI      ------------------------------------------------------------
C0NQU7_AJECG      ------------------------------------------------------------
EIF3F_PHANO       ------------------------------------------------------------
EIF3F_NEUCR       ------------------------------------------------------------
C7YRJ2_NECH7      ------------------------------------------------------------
A7EZP9_SCLS1      ------------------------------------------------------------
D5G918_TUBMM      ------------------------------------------------------------
EIF3F_SCHPO       ------------------------------------------------------------
EIF3F_YARLI       ------------------------------------------------------------
EIF3F_USTMA       ------------------------------------------------------------
A8NYF3_COPC7      ------------------------------------------------------------
E3K2R2_PUCGT      ------------------------------------------------------------
EIF3F_CRYNJ       ------------------------------------------------------------
EIF3F_CAEEL       ------------------------------------------------------------
                                                                              

EIF3F_DICDI       ------------------------------------------MQKETSIFLPSQVTVKVH
F0ZV65_DICPU      ------------------------------------------MQKETSIFLPSQVTVKVH
D3B645_POLPP      -------------------------------MIKLLNIYKLKMQSEKSIFSPSQLTVKVH
EIF3F_HUMAN       AP------ASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLH
EIF3F_PANTR       AP------ASSSDPAAAAATTAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLH
M3Z9H6_NOMLE      APVPAAAPASCSDPATAAATTSAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLH
H0WMC2_OTOGA      AP------ASSSDPAAAAATATAPGQTPASAQAPSQTPAPALTGPALPGPFPGGRVVKLH
E1C050_CHICK      AP---------------------PSAAPPPPAAPAAPPPAAPLSAALSGPFPGGRVVRLH
EIF3F_MOUSE       SP-------APVSSDPAVAAPAAPGQTPASAPAPAQTPAPSQPGPALPGPFPGGRVVRLH
Q4SVD2_TETNG      GP-----------------------------------------------------VVKIH
C3XZD8_BRAFL      SL---------------------------------------------------GLRVHVH
B7P2T8_IXOSC      VY-------------------RKKACGLVGNVGPQIVKSPTVQSRATSPIMAPNITVRVH
A7SIV6_NEMVE      -------------------------------------------------MAARASKVLIH
EIF3F_ANOGA       ---------------------------------------------MSTINLPLNLTVRVH
W5J565_ANODA      ---------------------------------------------MSTINLPLNLTVRVH
EIF3F_AEDAE       ---------------------------------------------MSTINLPLNLTVRVH
EI3F1_DROGR       ---------------------------------------------MSA----LNLTVRVH
EI3F1_DROME       ---------------------------------------------MSA----LNLTVRVH
EI3F1_DROPS       ---------------------------------------------MSA----LNLTVRVH
E0W3F6_PEDHC      --------------------------------------------------MALNLTVKVH
EIF3F_BOMMO       --------------------------------------------------MALNISVKVH
E9H7Q2_DAPPU      --------------------------------------------------MALNLTVKLH
EI3F2_DROME       ----------------------------------------------MSRNFSMRAKVYLK
EI3F2_DROPS       ---------------------------------------------MSLSNFNLQSKVLLH
EI3F2_DROGR       ---------------------------------------------MSISNYKMHTKVRLQ
B3RIH4_TRIAD      ----------------------------------------------MAVSSPLQLSVVIH
EIF3F_ARATH       -----------------------------MAATSEHTILQFVSPSSTASATTSVLTARIH
D7TMG2_VITVI      ------------------------------MASSESAVLQFF-PSSTS------LSAKVH
A9TT42_PHYPA      ------------------------------MPSGHTGV-----------------VAKLH
A9RVP0_PHYPA      ------------------------------MPSGHTGV-----------------VAKLH
A8J9A9_CHLRE      --------------------------MSTVLLPSGSSV-----------------SVKVH
D0NBC1_PHYIT      --------------------------MSALLLGTEPVT-----------------EVKLH
A9UW93_MONBE      --------------------------MSSDLHLEGIAP-----------------RMRVL
EIF3F_ASPFU       -------------------------MAE-TDSFLHLARPLGPVAVG-SAPTTAPLNVVIQ
C8VRX6_EMENI      -------------------------MAE-TDSFLHLSRPLGPVLAG-SAPTTAPLNVVIQ
C0NQU7_AJECG      -------------------------MAD-TDSFLHLSRPLGPALVG-AQASTAPLNVVIQ
EIF3F_PHANO       -------------------------MSE-RDSFLHLARPLGPAPVG-AQPSTAPLNVAIQ
EIF3F_NEUCR       -------------------------MAVDQESFVHLSRPLAPNVLG-FGVSNAPLTVNIQ
C7YRJ2_NECH7      -------------------------MAAATESFIHLARPLAPNTVG-LQTNLAPLTVNIQ
A7EZP9_SCLS1      -------------------------MAVGTQSFLHLARPLAPAAIG-VQPTTAPLNVIIQ
D5G918_TUBMM      -------------------------MAD-KDSYIHLARPLPVVSVPPAQATTSPLSVVIS
EIF3F_SCHPO       -------------------------MALGTKHVLHLTKP---------SSRSSPLNIVIE
EIF3F_YARLI       -----------------------------MSETLQISRV--------AGTNGAPTHVTVT
EIF3F_USTMA       -------------------------MSLAGSSSSALHLDFPASTGSGVMHSRSVTGVHVH
A8NYF3_COPC7      -------------------------MPL-GPANAAIHIHAPAPAEILQANPRTPTKVTVH
E3K2R2_PUCGT      ---------------------------------MADSFTQPLSLPKPHSGPTSVTNVAVQ
EIF3F_CRYNJ       ------------------------------MSLDTSSSAIHLQLPPTSSSLRPPSQITVH
EIF3F_CAEEL       --------------------------------------------------MASNLTVNVH
                                                                            : 

EIF3F_DICDI       PVVIFNILDHYIRRNVG-----------------------QDRVIGTLLGFN---NDGVL
F0ZV65_DICPU      PVVIFNILDHFIRRNAG-----------------------QDRVIGTLLGFN---NDGVI
D3B645_POLPP      PVVIFNILDHYIRRHDG-----------------------QDRVIGTLLGYN---NDGVV
EIF3F_HUMAN       PVILASIVDSYERRNEG-----------------------AARVIGTLLGTV---DKHSV
EIF3F_PANTR       PVILASIVDSYERRNEG-----------------------AARVIGTLLGTV---DKHSV
M3Z9H6_NOMLE      PVILASIVDSYERRNEG-----------------------AARVIGTLLGTV---DKHSV
H0WMC2_OTOGA      PVILASIVDSYERRNEG-----------------------AARVIGTLLGTV---DKHSV
E1C050_CHICK      PVVLASIVDSFERRNEG-----------------------AARVIGTLLGTV---DKHSV
EIF3F_MOUSE       PVILASIVDSYERRNEG-----------------------AARVIGTLLGTV---DKHSV
Q4SVD2_TETNG      PVVLASISDSYERRNEG-----------------------ASRVIGTLLGTI---DKHSI
C3XZD8_BRAFL      PVVLFSIVDSYERRNED-----------------------AKRVIGTLLGTA---DKKIV
B7P2T8_IXOSC      PVVLFAIVDSYERRNDG-----------------------AERVIGTLLGSY---EKGGV
A7SIV6_NEMVE      PVVLFSVVDAFERRNED-----------------------AKRVIGTLLGTV---DKGVV
EIF3F_ANOGA       PVVLFQIVDAYERRNAD-----------------------SERVIGTLLGSV---DKGVV
W5J565_ANODA      PVVLFQIVDAYERRNAD-----------------------SERVIGTLLGSV---DKGVV
EIF3F_AEDAE       PVVLFQIVDAYERRNAD-----------------------SERVIGTLLGSV---DKGVV
EI3F1_DROGR       PVVLFQVVDAFERRNAD-----------------------SHRVIGTLLGSV---DKGVV
EI3F1_DROME       PVVLFQVVDAFERRNAD-----------------------SHRVIGTLLGSV---DKGVV
EI3F1_DROPS       PVVLFQVVDAFERRNAE-----------------------SHRVIGTLLGSV---EKGVV
E0W3F6_PEDHC      PVVKFQIVDAYERRSAD-----------------------ANRVIGTLLGFV---DKGVV
EIF3F_BOMMO       PVVLFQIVDAYERRNAD-----------------------SHRVIGTLWGTS---DKGVV
E9H7Q2_DAPPU      PVVLFQIIDSYERRNPD-----------------------AQRVIGTLLGTS---DKNGV
EI3F2_DROME       PLVFFQIIDAYDRRPKG-----------------------DNQVMGTLLGR---NKEGHI
EI3F2_DROPS       PLVLFQIIDAYERRAKD-----------------------VPEVLGTLLGTVA-GKTGRI
EI3F2_DROGR       PLVLFQIISAYEHRPKL-----------------------AEVAVGTLLGLRD-RSNDTI
B3RIH4_TRIAD      PVVVLTICDSYERRNED-----------------------IEKIHGTLLGKV---EKERI
EIF3F_ARATH       PLVIFNVCDCFVRRPDS-----------------------AERVIGTLLGSILP--DGTV
D7TMG2_VITVI      PLVIFNICDCYVRRPDQ-----------------------AERVIGTLLGSISP--DGTV
A9TT42_PHYPA      PTVLFNISDSYIRRNDQ-----------------------QERVIGTLLGSISP--DGTV
A9RVP0_PHYPA      PTVLFNICDSFIRRNDQ-----------------------QERVIGTLLGSISA--DGTV
A8J9A9_CHLRE      PVVLFAICDAYTRRKEH-----------------------QDRVIGTLLGVVV---DNTI
D0NBC1_PHYIT      PVVVLQVLDRSLRRAEN-----------------------QERVIGTLLGRVE---GGVA
A9UW93_MONBE      PVVYFSILDYHLRREARWEETTVIDPRTNQEEPRRNCKPINDRVIGCLLGTRT---GNSV
EIF3F_ASPFU       PQAIFSILDHSLRRNAD-----------------------QERVIGTLLGTR-SEDGTEV
C8VRX6_EMENI      PQALFSILDHSLRRNAD-----------------------QERVIGTLLGTR-SEDGTEV
C0NQU7_AJECG      PQAIFSILDHSLRRNAD-----------------------QERVIGTLLGTR-SEDGTEV
EIF3F_PHANO       PQAVFSILDHSLRRPAD-----------------------QERVIGTLLGTR-SEDGTEI
EIF3F_NEUCR       PQAVFSIIDHAVRRDDRDT--------------------QSTRVIGALVGVR-SEDGSEV
C7YRJ2_NECH7      PQAVLSILDHAVRRDIRDT--------------------QSTRVIGALVGTR-SEDGTEV
A7EZP9_SCLS1      PQAVFSILDHAIRRDTSVT--------------------QTPRVIGALLGIR-AEDGMEC
D5G918_TUBMM      AQALFSILDHSLRRNTD-----------------------QERVIGTLLGVR-NEDGAEV
EIF3F_SCHPO       PAVLFSILDHSTRKSEN-----------------------NQRVIGTLLGTR-SEDGREI
EIF3F_YARLI       AQALFQILDHALRREEE-----------------------QSKVIGTLVGIR-SEDGSEV
EIF3F_USTMA       PVALFSILDHYLRRNDGQH-----------------------RVIGTLLGTR-TES--EI
A8NYF3_COPC7      PVALFSILDHYLRRADSQE-----------------------RVIGTLLGTR-HDD--EV
E3K2R2_PUCGT      PLPLAAILDHHLRRPDHQD-----------------------RVFGTLLGVR-NTETGEV
EIF3F_CRYNJ       PSVIAQILTHHSRHSADSES---------------------TRVIGALMGNR-SDNGQEV
EIF3F_CAEEL       PGVYMNVVDTHMRRTKSSAKNTG-----------------QEKCMGTLMGYY---EKGSI
                  .     :     ::                               * * *          

EIF3F_DICDI       EIRNCFPVVHSET-----EQIAVEMEYQRKMLDLHLKSSPREPIIGWYATGND-INENSV
F0ZV65_DICPU      EIRNCFPVPHSET-----EQIAVEMEYQRKMLDLHLKSSPREPIIGWYATGND-INENSV
D3B645_POLPP      EIKNSFPVVHSEG-----DQIAVEMEFHRKMLDLHLKSSPREPIIGWYATGCD-INENSV
EIF3F_HUMAN       EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHD-ITEHSV
EIF3F_PANTR       EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHD-ITEHSV
M3Z9H6_NOMLE      EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHD-ITEHSV
H0WMC2_OTOGA      EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHD-ITEHSV
E1C050_CHICK      EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPSEIILGWYATGHD-ITEHSV
EIF3F_MOUSE       EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHD-ITEHSV
Q4SVD2_TETNG      EVTNCFSVPHNES----EDEVAVDMEFAKNMYELHKRVSPTEVIVGWYATGFD-ITEHSV
C3XZD8_BRAFL      EVTNCFPVPHNES----EDEVAVDMEFAKNMYELHKKVNPSEVIVGWYATGPD-ITEHSV
B7P2T8_IXOSC      EVTNCFCVPHNES----QDEVAVDLEFAKNMFELHKKVNSSEVIVGWYATGPD-VTGHSV
A7SIV6_NEMVE      EIRSCFGVPHNES----ADEVAVELEYAKSMYELSQKANPNEQIVGWYATGSD-VTEHSL
EIF3F_ANOGA       EVTNCFCLPHKEH----TDQVEAELGYASDLYELNQRVNASENIVGWWATGQE-VTNHSS
W5J565_ANODA      EVTNCFCLPHKEH----TDQVEAELGYASDLYELNQRVNASENIVGWWATGQE-VTNHSS
EIF3F_AEDAE       EVTNCFCVPHKEH----ADQVEAELGYASDLYDLNRRVNPSENIVGWWATGQE-VTNHSS
EI3F1_DROGR       EVTNCFCVPHKEH----DDQVEAELSYALDMYDLNRKVNSNESVVGWWATGNE-VTNHSS
EI3F1_DROME       EVTNCFCVPHKEH----DDQVEAELSYALDMYDLNRKVNSNESVVGWWATGND-VTNHSS
EI3F1_DROPS       EVTNCFCVPHKEH----DDQVEAELSYALDMYDLNRKVNSNEAVVGWWATGND-VTNHSS
E0W3F6_PEDHC      EVTNCFCVPHKEY----EVEVEAELSYASDMYELNRKVNPQEAIIGWWATGHE-VTCHSS
EIF3F_BOMMO       EVTNCFCVPHKEH----ADQVEAELNYAMDVYELNRRVNSSESIVGWWATGNE-VTNHSS
E9H7Q2_DAPPU      EVTNCFCVPHNES----EEEVAVELDFAKDMYDLHRKVNPQESIVGWWATGTG-VTSHSA
EI3F2_DROME       EITNCFTVPHKEHSENK--RIDLDMAYASEVLELNMFAYPNERVLGWFCTGKS-VSRSAS
EI3F2_DROPS       EITNCFSVVHRMHGDNNC-HIDLDLKYDNDMLELAQIAYPQEKVLGWFSTGKS-VSAAAV
EI3F2_DROGR       EITNSYMVIHKTQQIGEMEQVKLDKQYASEMYELNQINNPQEKIVGWYNTAKS-LSRSSA
B3RIH4_TRIAD      EIRNCFIDDNPTAS----GKKKFNLEEFQRLFDLHQRVYPNEVIVGRFSTGDQ-IDDTAL
EIF3F_ARATH       DIRNSYAVPHNES----SDQVAVDIDYHHNMLASHLKVNSKETIVGWYSTGAG-VNGGSS
D7TMG2_VITVI      DIRNSYAVPHNES----SDQVALDIDYHHNMLLSHQKVNPKEVIVGWYSTGLG-VTGGSA
A9TT42_PHYPA      EIRNSYAVPHSEQ----ADQVAVDIDYHRTMFELHQRVNHKEIIVGWYSTGSS-LSPSDT
A9RVP0_PHYPA      EIRNSYAVPHSEQ----ADQVAVDIDYNRTMYELHQRVNPKEVVVGWYSTGSS-LSPSDT
A8J9A9_CHLRE      EVKNCYVVPHNES----SDQVMVDVVHHKTMFELHQKVAPHEVIVGWFATGSE-LYNSDA
D0NBC1_PHYIT      EVTNSFAVPHLEN----GDEVAVGRDFHTHMYELHQRVNEGEVVVGWYAAGPNRLDDHSA
A9UW93_MONBE      EVTNCFPVGHEDK----EDTVDIRLDYFESLRALHAQANPNEEIVGWYSTGPELQHERSI
EIF3F_ASPFU       EIRSTFAVGHTETTD----QVEVDMEYQKQMLALHLKANPKEVLVGWYATSSE-LNTFSA
C8VRX6_EMENI      EIRSTFAVGHTETTD----QVEVDMEYQKQMLALHLKANPREVLVGWYATSSE-LNTFSA
C0NQU7_AJECG      EIRSCFAVGHTETTD----QVEVDMEYQKQMLALHLKANPKEVLVGWYATSSE-LNTFSA
EIF3F_PHANO       EIRNCYAVPHTETAE----QVEVDMDYQKQMLALHLRANPREVLVGWYATSSD-LNTFSA
EIF3F_NEUCR       EVRSTFAIPHTENED----QVEVDVEYQKNMLALTLKANPRETLLGWYTTSHE-LNSFSA
C7YRJ2_NECH7      EVRSCFAIPHTEEED----QVEVDVEYQKNMLALTLKASPREHLLGWYTTSHE-LNSFSA
A7EZP9_SCLS1      EVRNCFAIPHTETED----QVEVDVEYQKNMLALQLKANPREVLLGWYTTSLE-LNSFSA
D5G918_TUBMM      EIRNCFAVGHNESQE----QVEVDMDYHKTMLGLHLKANPKEVLIGWYATSPE-LNTFSA
EIF3F_SCHPO       EIKSCFAVPHNESSE----QVEVEMEYHRAMYHLHLKANPREVVVGWYATSPD-LDAFSA
EIF3F_YARLI       EVRNAYAVPHSESEQ----EMTIDLEYNPTMLALHRKAFPKEVIVGWYATSSE-LNTFSG
EIF3F_USTMA       EIKNCFAVPHLEDAEE--GQVQVDMEYHRSMYELCQKVRPDEVIVGWYATSPE-LNTYSA
A8NYF3_COPC7      EVRSSFAVLHSETDE----QVAVDMEYLKTMYELHHKVNPKEIIVGWYSTGSN-LNTYSA
E3K2R2_PUCGT      EVRSSFGVPYAATGR----DVAVDSDHHRTLLELHHRVSPKEVVVGWYATSPI-LNSFSS
EIF3F_CRYNJ       DIRSCFAVPHTEQGQ----QISVDRPFQQDMVNFLAKNGTKEVIVGWYASQKT-VNSNSA
EIF3F_CAEEL       QVTNCFAIPFNES----NDDLEIDDQFNQQMISALKKTSPNEQPVGWFLTTSD-ITSSCL
                  :: . :                        :          *  :* : :          

EIF3F_DICDI       HINNFYRDEMGNST---------PIHLTVDTGLT---NDTMGIHAYMAHNLSLNPESS--
F0ZV65_DICPU      HINNFYRDEMGNTS---------PIHLTVDTGLT---NDTMGIHAYMAHNLSLTPDSS--
D3B645_POLPP      IINNFYREEM-NGS---------PIHLTVDTGLT---NDTMGIHAYQAHSLSEHPDSS--
EIF3F_HUMAN       LIHEYYSREAPN-----------PIHLTVDTSLQ---NGRMSIKAYVSTLMGVPGRT---
EIF3F_PANTR       LIHEYYSREAPN-----------PIHLTVDTSLQ---NGRMSIKAYVSTLMGVPGRT---
M3Z9H6_NOMLE      LIHEYYSREAPN-----------PIHLTVDTSLQ---NGRMSIKAYVSTLMGVPGRT---
H0WMC2_OTOGA      LIHEYYSREAPN-----------PIHLTVDTSLQ---NGRMSIKAYVSTLMGVPGRT---
E1C050_CHICK      LIHEYYSREAHN-----------PIHLTVDTSLQ---NSRMSIKAYVSAPMGVPGKT---
EIF3F_MOUSE       LIHEYYSREAPN-----------PIHLTVDTGLQ---HGRMSIKAYVSTLMGVPGRT---
Q4SVD2_TETNG      LIHEYYSREASN-----------PIHLTIDTSLQ---SGKMNIRAYVSAQMGVPSKT---
C3XZD8_BRAFL      LIHEYYSRECNH-----------PVHLTVDTNLR---GNKMAFKAYQSVSMGVSGGT---
B7P2T8_IXOSC      LIHDYYSREATN-----------PIHLTLDTLMA---DGKINIKTYTSTPFGVPGKN---
A7SIV6_NEMVE      LIHEYYSRETNN-----------PVHMTVDTTLK---GLKMGIKTYQSVKMGVPGKT---
EIF3F_ANOGA       VIHEYYARECTN-----------PVHLTLDTSLT---GARMGIKAYVCVSLGVPGGK---
W5J565_ANODA      VIHEYYARECSN-----------PIHMTLDTSLT---GARMGLKAYVCVSLGVPGGK---
EIF3F_AEDAE       VIHEYYARECNN-----------PIHLTLDTSLS---AARMGIKAYVCVSLGVPGGK---
EI3F1_DROGR       VIHEYYARECNN-----------PVHLTVDTSLQ---GGRMGLRAYVCIQLGVPGGK---
EI3F1_DROME       VIHEYYARECNN-----------PVHLTVDTSLQ---GGRMGLRAYVCIQLGVPGGK---
EI3F1_DROPS       VIHEYYARECNN-----------PVHLTVDTSLQ---GGRMGLRSYVCIQLGVPGGK---
E0W3F6_PEDHC      VIHEYYARECNN-----------PIHMTLDTTLQ---GDRMGLRAYLCVPIGVPGGK---
EIF3F_BOMMO       VIHEYYSRECRE-----------PVHVTLDTSLA---GGRMGLRAYVCVPLGVPNGK---
E9H7Q2_DAPPU      LIHEYYSRESSN-----------PVHITVDTTLQ---DTRMGIKAYVSVPMGITGKT---
EI3F2_DROME       LIHDYYVRECCEGQ---------PLHLLVDAALK---NQRLSTRLYCAVEMGVPGGT---
EI3F2_DROPS       ELHEYYERQCHNGQ---------PLHLLMDTSLR---GQRMNTRIFCAVATGVPGGT---
EI3F2_DROGR       ALHAYYARECADAQ---------PLHLLVDLKLR---GGRLNTRLYCGVPIGVPGGT---
B3RIH4_TRIAD      AMQALFSRVIESSYV------AFPIHLLVDTNLT---DSHMGIQASVYHRYGVPGND---
EIF3F_ARATH       LIHDFYAREVPN-----------PIHLTVDTGFT---NGEGTIKAFVSSNLSLGDRQ---
D7TMG2_VITVI      LIHEFYSREVQN-----------PIHLTVDTTFR---NGEATIKAFVSVSLSLGERQ---
A9TT42_PHYPA      LIHDFYGREVAN-----------PVLLTVDTAFA---EEKVNIKVFVSTLLTLGERQ---
A9RVP0_PHYPA      LIHDFYGREVAN-----------PVLLIVDTAFA---EEKVNIKVFVSTLLTLGERQ---
A8J9A9_CHLRE      LIQEFYSKESQH-----------PVHMVVDTTLR---DEKFNISAYTSRTLALGDKQ---
D0NBC1_PHYIT      LIHQFYNSVCEL-----------PVHLVVDTSLQ---NDKLDVSAYVSAPLEVVDTA---
A9UW93_MONBE      FIHRTLCEDSMN-----------DVHLWIDTSLD---TGKLGIYAFTTASEGVPRLVDEE
EIF3F_ASPFU       LIQNFYSGQGD------GTWPHPAVHLTVSTE----PGKDIETRAYISAPVGVTAERAAD
C8VRX6_EMENI      LIQNFYSGQGD------GTWPHPAVHLTVSTE----PGKDIETRAYISAPVGVTAERAAD
C0NQU7_AJECG      LIQNFYGGSGD------GTWPHPAVHLTVSTA----PGKDIETRTYISAPVGVTAERAAD
EIF3F_PHANO       LIQNFYSQQGD------GTWPHPAVHLTVSTV----PGQDIESRTYISAPIGVTAERAAD
EIF3F_NEUCR       LIQNFFASPET------GTFPHPAVHLTIGTE----AGATIDTKTYISAPVAVSPERAAE
C7YRJ2_NECH7      LIQNFFGSPDT------GTFPHPAIHMTISTE----PGEDIQTRCYISAPVAVNAERAAD
A7EZP9_SCLS1      LIQNFFASPET------GTFPHPAVHLTVSTE----AGKEIEAKAYISAPVGVNAERAAE
D5G918_TUBMM      LIQNFYASNGD------GTFPHPAVHLTMSTA----PGQDISIRTYISSAVGVHPDRLAD
EIF3F_SCHPO       LIQNLYASPAEPGTAPLGTYPHPCVHLTVNTD----VSSPLAIKTYVSSPVGIT-ERLAD
EIF3F_YARLI       LIHDYYTQLDG----------TPAIHLTVEAAN---LADTLLPRTYVASAVGIDPSKNSG
EIF3F_USTMA       LIQDFYSRETA---------PHQAVHLTMDTTIDGSKPSGLGIKSYISSPLGATP-KAEN
A8NYF3_COPC7      LIQNFYSQETA---------PHQAVLVSVNTGVEQGQE--AGVTAYVSSPVGVSP-KPEN
E3K2R2_PUCGT      LIQDFYNLEAI---------PLPAVHLTLDPVT-------LTFKTFVSSPIGLSTLQTLN
EIF3F_CRYNJ       IIQEYFSFETN---------PYPAVHLTVDTDIEESGK-GLGVKGWVSQPLGLTS-KSEC
EIF3F_CAEEL       IYHDYYVRVITEASAR--RESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPH
                    :                     : : :                               

EIF3F_DICDI       -----LGSYFSQLPLEILTFE-AENAGLESIA--------------------QTKYDQQS
F0ZV65_DICPU      -----LGSYFSQLPLEILTFE-AENAGLESIA--------------------QTKYDQQS
D3B645_POLPP      -----LGSYFTPLPLEILTFE-AENAGLDALTAADRSLTATIVDATATADAEQQQQQQQS
EIF3F_HUMAN       -----MGVMFTPLTVKYAYYD-TERIGVDLIMKTCFS-------------------PNRV
EIF3F_PANTR       -----MGVMFTPLTVKYAYYD-TERIGVDLIMKTCFS-------------------PNRV
M3Z9H6_NOMLE      -----MGVMFTPLTVKYAYYD-TERIGVDLIMKTCFS-------------------PNRV
H0WMC2_OTOGA      -----MGVMFTPLTVKYAYYD-TERIGVDLIMKTCFS-------------------PNRV
E1C050_CHICK      -----MGVMFTPLTVKYVYYD-TERIGVDLIMKTCFS-------------------PNRV
EIF3F_MOUSE       -----MGVMFTPLTVKYAYYD-TERIGVDLIMKTCFS-------------------PNRV
Q4SVD2_TETNG      -----VGVMFTPLSVKYVYYD-TERIGVDLLQRTRAM-------------------PSRT
C3XZD8_BRAFL      -----MGTMFTPLQLKITSYE-AEKVGVSLIQQGKTA-------------------PNST
B7P2T8_IXOSC      -----VGTMFSPCKVEVVGYD-AEMVGLKVTQGTKNN-------------------KQRS
A7SIV6_NEMVE      -----EGTMFSQIPCEVKLTG-PEKVGVDVLQRTKST-------------------PKKA
EIF3F_ANOGA       -----SGCMFTPINVEVTSYE-PEIVGLQLCMKTIGVQS--------------NPSRPRT
W5J565_ANODA      -----SGCMFTPINVEVTSYE-PEVVGLQLCMKTIGLQT--------------NPNRPRT
EIF3F_AEDAE       -----TGCMFTPINVEISSYE-PEVVGLQLCSKTIGVQQ--------------NASRPRT
EI3F1_DROGR       -----TGCMFTPIPVELTSYE-PETFGLKLLQKTVGV-S--------------PAQRPKT
EI3F1_DROME       -----SGCMFTPIPVELTSYE-PETFGLKLLQKTVGV-S--------------PAHRPKT
EI3F1_DROPS       -----TGCMFTPIPVELTSYE-PETFGLKLLQKTVGV-A--------------PANRPKT
E0W3F6_PEDHC      -----AGSMFTPIPVEVVCYE-PEIVGIKLCQKTVGT-------------------KEIT
EIF3F_BOMMO       -----QGCMFTPVDVTLTCYE-PEIVGLQVCQKTVSG----------------GGRGSSG
E9H7Q2_DAPPU      -----MGCMFAPVSVEIACYD-PETIGLNACQKTKTS-------------------VKRQ
EI3F2_DROME       -----KGLMFSLVPL-EISNENSDLVALRCIEKQSQQQ-----------------ASKQM
EI3F2_DROPS       -----KGLMFSLLPM-DIYFGSPDIVAMRHMGRQCAQ------------------PTKDA
EI3F2_DROGR       -----KGLMFTLLPLLKMGTEIDDSVALRVMQNYALN------------------PAKQP
B3RIH4_TRIAD      -----NGSIFTPIRYAMGYYP-EEMSASQLFQRNLAI--------------------GGI
EIF3F_ARATH       -----LVAHFQEIPVDLRMVD-AERVGFDVLKATSVDK----------------------
D7TMG2_VITVI      -----LAAQFQEIPLDLRMVE-AERVGFDILKTTMVEK----------------------
A9TT42_PHYPA      -----LAAQFHEVQLDLRLIE-AERIGFDVLKKTMVEK----------------------
A9RVP0_PHYPA      -----LAAQFHEVQLDLRLVE-AERIGFDVLKKTMVEK----------------------
A8J9A9_CHLRE      -----LATEFVEIPCETIFGD-VERVGGAAAGSALLQEG--------------RVGARQA
D0NBC1_PHYIT      -----LVNQFKQIPVTQKVSE-PEAIALNAMAPKDGEN--------------------KA
A9UW93_MONBE      QDIYMPDQTFVPIACDVLVHE-PERVALGLLNKGLEGG--------------------SS
EIF3F_ASPFU       S------AAFIPVPYEIRYGE-AEKSGLEAIASAKDAESRA-------------------
C8VRX6_EMENI      S------AAFIPVPHEIRYGE-AEKSGLEAIAAARDSEERS-------------------
C0NQU7_AJECG      S------AAFIPVPYEIRYGD-AEKNGLEAIAAARDSENRT-------------------
EIF3F_PHANO       S------CLFIPVPHEIKYGE-AEKSGLELISSAKDREDRS-------------------
EIF3F_NEUCR       S------CLFIEVPHKLLFTD-AERGALGSVAAAADAESRS-------------------
C7YRJ2_NECH7      S------CLFIQVPHKVLYGD-ADRSALETIASAKDAESRT-------------------
A7EZP9_SCLS1      S------CLFIPVPYEIRYGE-SEKSGLELISGAKDSESRA-------------------
D5G918_TUBMM      S------CLFVPVPYEIKYAD-AERSGLELISSAKNSENRS-------------------
EIF3F_SCHPO       S------CAFVPTPFTIRDDE-AVRSGLKAVAAPKNDPSRL-------------------
EIF3F_YARLI       N------CVFVPISNEVKFNDSADRAALEAISSARESPERS-------------------
EIF3F_USTMA       -------CVFLPLPTNLLHST-PEHSSLSLLASQNISS----------------------
A8NYF3_COPC7      -------CVFVPVPVELKFHE-AERSGVDLLTGTAASSTSTS------------------
E3K2R2_PUCGT      -------LLFKPIPCSLSIPT-PERTTMELLTKPILDSTAAN------------------
EIF3F_CRYNJ       -------SVFVPVPVSIKYAD-SERAALDLLTAPQPTPSP--------------------
EIF3F_CAEEL       C------AIFNPLRVELAAFP-GELVAMQLIEKALDSRR-------------------RE
                           *                                                  

EIF3F_DICDI       TSLLSEL---------------------ESLQGSLTKLDEMLESITSYIESVEK--GEIQ
F0ZV65_DICPU      TSLLSEL---------------------ESLQSSLKKLDEMLDSICSYIEAVEK--GEIQ
D3B645_POLPP      ISLLSEL---------------------ESLQGSLGKLDQMLDSVAQYIAAVEK--GEIQ
EIF3F_HUMAN       IGLSSDL---------------------QQVGGASARIQDALSTVLQYAEDVLS--GKVS
EIF3F_PANTR       IGLSSDL---------------------QQVGGASARIQDALSTVLQYAEDVLS--GKVS
M3Z9H6_NOMLE      IGLSSDL---------------------QQVGGASARIQDALSTVLQYAEDVLS--GKVS
H0WMC2_OTOGA      IGLSSDL---------------------QQVGGASARIQDALSTVLQYAEDVLS--GKVS
E1C050_CHICK      IGLSSDL---------------------QQVGSASARIQDTLGMVLQYAEDVLS--GKVA
EIF3F_MOUSE       IGLSSDL---------------------QQVGGASARIQDALSTVLQYAEDVLS--GKVS
Q4SVD2_TETNG      KGLTSDL---------------------SQVAGSAARIQDMLSTVLAYIEDVLS--GKVA
C3XZD8_BRAFL      ISMLPDL---------------------SAVGNQAAKLQELLTTVIAYVDDVLA--GKVT
B7P2T8_IXOSC      VECIADF---------------------DSVSKAAKEMREMLEVVITYVDDVLT--GKTP
A7SIV6_NEMVE      VSLISDM---------------------QHVTGATDRLLEMLETVITYVEEVLA--GSVP
EIF3F_ANOGA       VSPMLDL---------------------AQVTDASDKLLALLSDVLAYVEDVLS--EKQQ
W5J565_ANODA      VNTMLDL---------------------AQVTDASDKLLTLLGEVLGYVEDVLS--EKQQ
EIF3F_AEDAE       VSPMLDL---------------------AQITEASDKLLTLLGEVLNYVEDVLA--EKQQ
EI3F1_DROGR       VPPMLDL---------------------AQISEASQKLQSLLDLILKYVDDVIA--HKVT
EI3F1_DROME       VPPMLDL---------------------AQISEASTKLQSLLDLILKYVDDVIA--HKVT
EI3F1_DROPS       VPPMLDL---------------------AQISEASTKLQSLLDLILKYVDDVIA--HKVT
E0W3F6_PEDHC      VEPMQDL---------------------AQVAEATNKLRDLLDQVLSYVDDVLA--AKIP
EIF3F_BOMMO       VAAGSDL---------------------AQVMSAASSLESLLEQALQYADGAAA--G-AP
E9H7Q2_DAPPU      AGIASDL---------------------TQIVEASQQMENMLDTILAYVDDVMS--GSKT
EI3F2_DROME       ERFVPEL---------------------AQVVDATRDMQHRLDLVLRYINDVLA--RKKK
EI3F2_DROPS       GRLLPEL---------------------EQVVDATKDIQQKLDLVLRYINDILN--RKRR
EI3F2_DROGR       GRILPEL---------------------MSVLEITLALEEKLDLLLRYIKDVLA--RKRL
B3RIH4_TRIAD      APVHNDM---------------------QHVIATSTKIDELLDEVLKYVEDVTA--GNTP
EIF3F_ARATH       --LPNDL---------------------EGMELTMERLLTLINDVYKYVDSVVG--GQIA
D7TMG2_VITVI      --LPSDL---------------------EGMEASMERLLALIDDVYKYVDSVVE--GQVV
A9TT42_PHYPA      --LPNDL---------------------EGLEATIERLQDMIDRVFRYVDDVVE--GQVQ
A9RVP0_PHYPA      --LPNDL---------------------EGLEATIERLQEMIDRVFRYVDDVLE--GQIE
A8J9A9_CHLRE      AALVVDL---------------------THRKASMARLAELVGRAAEYVEAVNS--GKVT
D0NBC1_PHYIT      VALPKEL---------------------EALEETMEQLYKCIDGASLFVGDVVA--GKQT
A9UW93_MONBE      VKLVSDL---------------------NHVAEATTNLQDKIQDALTYVDKVLN--GSVE
EIF3F_ASPFU       TNIFTDI---------------------EALERAIEEVLGMIDRVSRYVESVID--EEAP
C8VRX6_EMENI      TSLFTDI---------------------EALERAIEEVLGMIDRVSRYVESVID--EEAP
C0NQU7_AJECG      ANLFTDI---------------------EALEKAIEDVLGMIDRVSKYVESVMD--EEAP
EIF3F_PHANO       QEIMTDL---------------------DSLERAVQHVLDMLERVSNYVNNVLD--EEAE
EIF3F_NEUCR       APVVSDI---------------------ENLAQALETVSDLLERVSGFVGEVLD--EERD
C7YRJ2_NECH7      APLVSDI---------------------EGLGRSIEQTINLLDRASEWINGVLD--EDEE
A7EZP9_SCLS1      APVVSDI---------------------EGLERAVDQTLDLLERVSEYVSSVLD--EERE
D5G918_TUBMM      AEVTTDI---------------------HALEKALEEVLEMLDRVSEYVARVVA--GNTQ
EIF3F_SCHPO       ASLFTDL---------------------QQLRRSTLELLSMIERVSDYVQNVID--GSSP
EIF3F_YARLI       INLTSDL---------------------ANLENSLTQVLDMLERVQTYVARVISGEESSE
EIF3F_USTMA       --PLTDL---------------------DALAVSLKQVQSQLDRVLTYVRAVIS--GEKE
A8NYF3_COPC7      AQPIADL---------------------EIIERSIQSTLGMLDRVLNYVQAVLA--GEKK
E3K2R2_PUCGT      QNIESDLKNQQQKIMAQLKEPLKTDLPMQHLHQLLTKLKNMLDQVYEYVEKVNK--GQIK
EIF3F_CRYNJ       --ALPPL---------------------PTLSNSLSQLSSLIDQCLAYVQSVNN--GSQT
EIF3F_CAEEL       ATLESGL---------------------EQLETSTAQMIEWLERMLHYVEDVNKN-GEKP
                        :                                  :     :            

EIF3F_DICDI       GDPRLGRFLAKTIQALPKANAQV--------------MDKVINNSVKDLLMIVYLSSLTR
F0ZV65_DICPU      GDPHLGRFLAKTIQALPKANAQV--------------MDKVINNSVKDLLMIVYLSSLTR
D3B645_POLPP      GDPRIGRFLAKTIQALPKSNTHV--------------MEKVINNSVKDLLMIVYIASLTR
EIF3F_HUMAN       ADNTVGRFLMSLVNQVPKIVPDD--------------FETMLNSNINDLLMVTYLANLTQ
EIF3F_PANTR       ADNTVGRFLMSLVNQVPKIVPDD--------------FETMLNSNINDLLMVTYLANLTQ
M3Z9H6_NOMLE      ADNTVGRFLMSLVNQVPKIVPDD--------------FETMLNSNINDLLMVTYLANLTQ
H0WMC2_OTOGA      ADNTVGRFLMSLVNQVPKIAPDD--------------FETMLNSNINDLLMVTYLANLTQ
E1C050_CHICK      ADNTVGRFLMDLINQVPKISPED--------------FETMLNSNINDLLMVTYLANLTQ
EIF3F_MOUSE       ADNTVGRFLMSLVNQVPKIVPDD--------------FETMLNSNINDLLMVTYLANLTQ
Q4SVD2_TETNG      ADNSVGRFLMDLVNKVPTISPED--------------FENMLNSNINDLLMVTYLANLTQ
C3XZD8_BRAFL      ADNVVGRLLMQLVAKIPQMEPEE--------------FQSMLNNMMKDLLMVVYLANLTD
B7P2T8_IXOSC      PDNHVGRMLLDIIQSVPQMDHEK--------------FQNMLNSNMKDLLMVVYLSQLTK
A7SIV6_NEMVE      ADNVVGRDLTSFVNSVPKMTAEE--------------FEAMLNSNMQDLLMIVYLSSLCK
EIF3F_ANOGA       PENTVGRALLDLIHSVPNMTGDQ--------------FAQMFNSNVKDLLMVVTLSQLIK
W5J565_ANODA      PVNTVGRALLDLIHSVPNMSGDQ--------------FAQMFNSNVKDLLMVVTLSQLIK
EIF3F_AEDAE       PDNSVGRALLDLIHSVPNMTSDQ--------------FAQMFNSNVKDLLMVVTLSQLIK
EI3F1_DROGR       PDNAVGRQLLDLIHSVPHMTHEQ--------------FTQMFNANVRDLLMVITLSQLIK
EI3F1_DROME       PDNAVGRQLLDLIHSVPHMTHEQ--------------FTQMFNANVRNLLLVITLSQLIK
EI3F1_DROPS       PDNAVGRQLLDLIHSVPHMSHEQ--------------FTQMFNANVRNLLMVITLSQLIK
E0W3F6_PEDHC      AKAAVGRALLDMIYSVPKMNPQE--------------FESMFTSNIKDLLMVMTLTQLTK
EIF3F_BOMMO       ADAEAGRALLQLAHSAPDLAKDT--------------FSDAFASSVKDLLMVVTLAQLIK
E9H7Q2_DAPPU      ADNTFGRSLLDMVHSVPKMTPDE--------------FEEMLNSNRKDLLMVLYLSQLTK
EI3F2_DROME       PDNVVGRSLYAALTAVPLLDSDK--------------FRVMFNTNLRDMLMAITLSTMIK
EI3F2_DROPS       PDNTVGRALHDVLTSVPMVEAER--------------FRHMFNTNMRDLLMSLTLSSMIK
EI3F2_DROGR       PDKRVGRALYEALTSVPMMDAES--------------FRLMFNTNVRDILLSITLSTMIK
B3RIH4_TRIAD      FDSKIGRSLSDAIMAVPQIDQSV--------------FKDMMNNSTQDLLMVTYLGSLVR
EIF3F_ARATH       PDNNIGRFIADAVASLPKLPPQV--------------FDNLVNDSLQDQLLLLYLSSITR
D7TMG2_VITVI      PDNDIGRFIADTVASIPKISPPA--------------FDRLVNDSLQDHLLLLYLSSITR
A9TT42_PHYPA      PDNSVGRFLADTMASVPRISSDA--------------FDKLFNDSVQDLLLVLYLANLTK
A9RVP0_PHYPA      PDNSIGRFLADTMSAVPRISSDA--------------FDKLFNDSVQDLLLVLYLANLTK
A8J9A9_CHLRE      GDPAIGRYLADTLALVPHLARPD--------------FERLFNESVQDNMMVTFLSDLLR
D0NBC1_PHYIT      ADAKLGREIADALAAIPMLREEQ--------------FDQLFNTGLQDLLMVSYLSGLTQ
A9UW93_MONBE      ADERIGRYLRDTVAAVPKIDPDQ--------------FEAMFNDTIQDLLMVGYLSNLAQ
EIF3F_ASPFU       ASTALGQFLLNALALAPKVEPAD--------------IERDFNNHIQDVLVVSYLANTIR
C8VRX6_EMENI      ASTALGQFLLNALALAPKVEPAD--------------IERDFNNHIQDVLVVSYLANTIR
C0NQU7_AJECG      ASTALGQFLLNALALAPKVNPAD--------------IENDFNNHIQDVLVVSYLANTIR
EIF3F_PHANO       PSSALGQFLMNALSLAPKVDPAD--------------IERDFNNHIQDVLVVSYLANTIR
EIF3F_NEUCR       GNHALGQYLMNALSLAPKVSNLA--------------IENDFNNHIQDVLMVSYLANTIR
C7YRJ2_NECH7      PNNAIGQYLMNALSLAPKVDPEQ--------------IEHDFNNHIQDVLMVSYLANTIR
A7EZP9_SCLS1      PSNALGQFLMNALSLAPKVDAQD--------------IERDFNNHIQDVLVVSYLANTIR
D5G918_TUBMM      ASVAIGKFLMNTLSLAPKVSPAD--------------VERMFNTHIQDVLLVAYLANTIR
EIF3F_SCHPO       ANVAVGRYLMKCFSLIPCVEGQD--------------FEKIFSSHLQDVLVVVYLANTLR
EIF3F_YARLI       KAQQVGKQLLSTLTLTPSLDAQN--------------LEALFNSHLQDVLMVVYLANTVK
EIF3F_USTMA       GDKAVGRFLNDTISVVPAGLDDNK-------------LETLFNAHLQDVLMVSYLANVVR
A8NYF3_COPC7      GDAAIGRYLMDTLGASTDDLE-----------------KSGFNSSLQDTLMISYLANLVR
E3K2R2_PUCGT      GNNQVGRLLLDTMGSLPLGLLRSQTGSASKGGDVHSQFEDDFQSHIADVLMVSYVAALVR
EIF3F_CRYNJ       PDVEIGRYLLEGLGRWSASGNED---------------EGGVKAGLQDTLTVEYLSSLVR
EIF3F_CAEEL       GDAQIGRQLMDIVTASSNNMQPEK-------------LDTLVKNTLRDYVMVSYLAKLTQ
                       *: :       .                        .     : :    :     

EIF3F_DICDI       SQLAVATKISHSLSN---------------------------------------------
F0ZV65_DICPU      SQLAVAEKVRQSLN----------------------------------------------
D3B645_POLPP      SQLAVAEKVRQSLNF---------------------------------------------
EIF3F_HUMAN       SQIALNEKLVNL------------------------------------------------
EIF3F_PANTR       SQIALNEKLVNL------------------------------------------------
M3Z9H6_NOMLE      SQIALNEKLVNL------------------------------------------------
H0WMC2_OTOGA      SQIALNEKLVNL------------------------------------------------
E1C050_CHICK      SQIALNEKLLSL------------------------------------------------
EIF3F_MOUSE       SQIALNEKLVNL------------------------------------------------
Q4SVD2_TETNG      AQISLNEKLVLL------------------------------------------------
C3XZD8_BRAFL      TQIQLHEKLSVKMS----------------------------------------------
B7P2T8_IXOSC      TQLALNEKLSML------------------------------------------------
A7SIV6_NEMVE      TQLALGEKLNAIL-----------------------------------------------
EIF3F_ANOGA       TQLQLNEKLTSLTSFLN-------------------------------------------
W5J565_ANODA      TQLQLNERLTSLTSFLN-------------------------------------------
EIF3F_AEDAE       TQLQLNEKLTSLTSFIN-------------------------------------------
EI3F1_DROGR       TQLQLNEKLTFLPTA---------------------------------------------
EI3F1_DROME       TQLQLNEKLTFLPTA---------------------------------------------
EI3F1_DROPS       TQLQLNEKLTFLPTA---------------------------------------------
E0W3F6_PEDHC      TQLQLNEKLTMLTTL---------------------------------------------
EIF3F_BOMMO       TQLQLNEKLTLLTSPVNTTIYKGRPNV---------------------------------
E9H7Q2_DAPPU      TQLSLNEKLTLLTI----------------------------------------------
EI3F2_DROME       TQLEISEKLSCMQDQ---------------------------------------------
EI3F2_DROPS       TQLQLSERLSNMVDA---------------------------------------------
EI3F2_DROGR       TQLELSEKLSHLPNH---------------------------------------------
B3RIH4_TRIAD      TQLALAEKLNTIL-----------------------------------------------
EIF3F_ARATH       TQLSLAEKLNTAAQML--------------------------------------------
D7TMG2_VITVI      TQLSLAEKLNTAAQIP--------------------------------------------
A9TT42_PHYPA      TQLILAEKLNTAAQIV--------------------------------------------
A9RVP0_PHYPA      TQLTLAEKLNTAAQIL--------------------------------------------
A8J9A9_CHLRE      AHVALAERLGTAALPIM-------------------------------------------
D0NBC1_PHYIT      AQLSMAEKLINT------------------------------------------------
A9UW93_MONBE      TQVAIQDKLNDALATEI-------------------------------------------
EIF3F_ASPFU       TQMELSNRLATAQLTLGGE--------GASA-----EAGAQR----GQRGG---KGGRGG
C8VRX6_EMENI      TQMELSNRLATAQLTLGGES-------GNAE-----QGGAQR----NQRG----KGGRGG
C0NQU7_AJECG      TQMELSNRLATAQLTLGGESTGAAAAGGAAG-----ETGGQR----SGRGG---GRGRGG
EIF3F_PHANO       TQIDLSNRLATAALTMGGTD----ALAGDGQ-----KDGGDR----KQGGD---RRNKGR
EIF3F_NEUCR       TQIELSQRLATAKLDEGKEGGEKKDGEGAEGDKKTDGQRGQRGQGGKRGGRSGGAGGRGG
C7YRJ2_NECH7      TQIDLSQRLAVANLTS-----PEKEGEG-----KTEEKGGQR--GGKRGGR---GGGRGG
A7EZP9_SCLS1      TQIDLSQRLATATLTMGGSDVLATSGSGEGG--EKSEQRGQR--GGKRGGR---GGGRGG
D5G918_TUBMM      TQIDLSNRLASANLGTATPT---------------PAAAATN------------PTATGT
EIF3F_SCHPO       TQVDIASRLNLLP-----------------------------------------------
EIF3F_YARLI       TQLQLSAKLTTLV-----------------------------------------------
EIF3F_USTMA       AQAEVSSRLTLLT-----------------------------------------------
A8NYF3_COPC7      AQAEVSSRLALASAP---------------------------------------------
E3K2R2_PUCGT      DQVEISSRLNLLVS----------------------------------------------
EIF3F_CRYNJ       SQVELAGRLSLLQQPVAQQ-----------------------------------------
EIF3F_CAEEL       TQLQVHERLVSA------------------------------------------------
                   :  :  ::                                                   

EIF3F_DICDI       --------------------
F0ZV65_DICPU      --------------------
D3B645_POLPP      --------------------
EIF3F_HUMAN       --------------------
EIF3F_PANTR       --------------------
M3Z9H6_NOMLE      --------------------
H0WMC2_OTOGA      --------------------
E1C050_CHICK      --------------------
EIF3F_MOUSE       --------------------
Q4SVD2_TETNG      --------------------
C3XZD8_BRAFL      --------------------
B7P2T8_IXOSC      --------------------
A7SIV6_NEMVE      --------------------
EIF3F_ANOGA       --------------------
W5J565_ANODA      --------------------
EIF3F_AEDAE       --------------------
EI3F1_DROGR       --------------------
EI3F1_DROME       --------------------
EI3F1_DROPS       --------------------
E0W3F6_PEDHC      --------------------
EIF3F_BOMMO       --------------------
E9H7Q2_DAPPU      --------------------
EI3F2_DROME       --------------------
EI3F2_DROPS       --------------------
EI3F2_DROGR       --------------------
B3RIH4_TRIAD      --------------------
EIF3F_ARATH       --------------------
D7TMG2_VITVI      --------------------
A9TT42_PHYPA      --------------------
A9RVP0_PHYPA      --------------------
A8J9A9_CHLRE      --------------------
D0NBC1_PHYIT      --------------------
A9UW93_MONBE      --------------------
EIF3F_ASPFU       QQRTQERASEEVRA------
C8VRX6_EMENI      QQRNQERGAEEGRA------
C0NQU7_AJECG      QQRNQERVAIEA--------
EIF3F_PHANO       QQRTQEA-------------
EIF3F_NEUCR       REQREPREPREAAE------
C7YRJ2_NECH7      GQQREPREPREPAE------
A7EZP9_SCLS1      GQTREPREPREPREPREPVE
D5G918_TUBMM      TTTAGGK-------------
EIF3F_SCHPO       --------------------
EIF3F_YARLI       --------------------
EIF3F_USTMA       --------------------
A8NYF3_COPC7      --------------------
E3K2R2_PUCGT      --------------------
EIF3F_CRYNJ       --------------------
EIF3F_CAEEL       --------------------