CLUSTAL format seed alignment for MF_03007

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q4UE08_THEAN      ----------------------------MDFVNTKPHR--------------GFVGKSST
Q4N5I3_THEPA      ----------------------------MDFVNTKPHR--------------SLVGKSST
A7ANU3_BABBO      ---------------------------MMDFSVNKYSRVTPVRSPVMAPAVAPSLGSSVA
EIF3H_DICDI       -----------------------------MDIDEQIIQ-------------------DYS
D3BJY8_POLPP      -----------------------------MNIDQQIEA-------------------DFN
EIF3H_ARATH       ------------------------MATMARSFLQAISKD------------------EAV
D7U9M6_VITVI      -----------------------MANTMARSFLQVAAT-------------------EEV
A9THQ6_PHYPA      ----------------------------MRSFAQAAQT-------------------ETE
A9TIQ5_PHYPA      ------------------------MAAPLRSFAQAAQA-------------------EVE
A8JBC8_CHLRE      --------------------------------MEAIAP-------------------KPH
D0P2T1_PHYIT      ----------------------------MAWGLDTTPTP-----------------ARTP
H3H5C8_PHYRM      ----------------------------MAWGLDTTPTP-----------------ARTP
D0MZ23_PHYIT      ----------------------------MAWGLDTTRRR-----------------HGRP
B8C426_THAPS      ----------------------------MAAVFEADAPV-----------------TSVK
F4P532_BATDJ      ---------------------------------------------------------MLV
EIF3H_BOVIN       ----------------------------MASRKEGTGSSATSSSSTTGAAGKGKGKGGSG
G1NWX2_MYOLU      ----------------------------MASRKEGTGPATTSSSSATGAAGKGKGKGGAG
EIF3H_HUMAN       ----------------------------MASRKEGTGSTATSSSSTAGAAGKGKGKGGSG
F6UCC5_MACMU      --------------MYSRHAQRITPGNKMASRKEGTGSTATSSSSTTGGAGKGKGKGGSG
H0WZG7_OTOGA      ----------------------------MASRKEGAGSTATSSSSTTGAAGKGKGKGGSG
EIF3H_MOUSE       ----------------------------MASRKEGTGSTATSSGSAGGAVGKGKGKGGSG
EIF3H_RAT         ----------------------------MASRKEGTGSTATSSSSTGGAVGKGKGKGGSG
EIF3H_CHICK       ----------------------------MASRKEGSG---AAGGGFGASKGKGK-AATTG
EIF3H_TAEGU       ----------------------------MASRKEGSG---AAGGGFGSAKGKGK-AAAAG
EI3HA_DANRE       ----------------------------MASRKESAASGS-----------------NPL
EI3HB_DANRE       ----------------------------MASRKETPNG-------------------KTL
H3DP56_TETNG      ----------------------------MASRKETSSAPSAVMA----------SVGGSL
H3AZH6_LATCH      ----------------------------MATRREAASTTAG---------------SGTL
EIF3H_XENTR       ----------------------------MAARTRETGNTAT-----------------VA
C3YQB9_BRAFL      ----------------------------MA----------------------------VA
B7PKD6_IXOSC      ----------------------------MASSRDRRH--------------------TET
EIF3H_NEMVE       ----------------------------MAEGRSSKN--------------------SPS
EIF3H_AEDAE       ----------------------------MASRAQNRR------------------PAQEV
EIF3H_ANOGA       ----------------------------MASRG-NRA------------------RSQPV
EIF3H_BOMMO       ----------------------------MASRAGSAR------------------RAPEN
E0VY38_PEDHC      ----------------------------------MMR------------------LMDKN
EIF3H_DROME       ----------------------------MANRANRHAA-----------------RTEDS
EIF3H_DROPS       ----------------------------MANRGGRHA------------------RTEDS
E9GPS9_DAPPU      ----------------------------MANRNRRTN-------------------VPDV
B3S1H3_TRIAD      ----------------------------MSR--------------------------AEI
EIF3H_MONBE       ----------------------------MATRQPYQKKFQSRDQR------EQTSSQQAP
EIF3H_CAEBR       ----------------------------------------------------MSTAVTIT
EIF3H_CAEEL       ----------------------------------------------------MSTAVTIT
EIF3H_EMENI       -------------------------------------------------MAEKEV-----
EIF3H_ASPFU       -------------------------------------------------MAENE------
C0NJF2_AJECG      -------------------------------------------------MAEKD------
EIF3H_PHANO       -------------------------------------------------MADALK-----
C7YYH6_NECH7      -------------------------------------------------MGDAPK-----
EIF3H_NEUCR       -------------------------------------------------MAEVQK-----
EIF3H_SCLS1       ------------------------------------------------MADTTSK-----
D5GNQ2_TUBMM      -------------------------------------------------MADKSKIVLPA
EIF3H_YARLI       ------------------------------------------------------------
EIF3H_SCHPO       -----------------------------------------------MSDTTSLNVPELE
D6RJQ0_COPC7      ----------MAAPSMAAALAASLPAAPVAPVQVAPTYEALPSSMAKVIDIEAEIPLNV-
EIF3H_USTMA       ----------MSAAARIAPQSAAVAAPAPATTAASAIAKAPSADVQSELDRAALEALELD
Q5ADU3_CANAL      ------------------------------------------------------MASKYT
E3L0X1_PUCGT      --------------MSAKPMTAAAAIMASNANRQSAPSPTPAPATKTQANQASQLTELEP
G4V6S0_SCHMA      -----------------------------------------------------MDFQSKI
Q5CXR9_CRYPI      MIGKDGLIGLSSNPMEGATQTTKHVGWGISRQTEDKDSKEEVQQLSGSSGISGGKGSGYF
Q5KHC1_CRYNJ      ----------------MTSMAAALAASLPAAVSTQATPQPAAQQPSKVPQRLEGVVDVEA
Q23AY3_TETTS      -----------------------------------------------------------M
                                                                              

Q4UE08_THEAN      LSDYNNNNNPVQK-----------------------------------TQSYVEIDSLVL
Q4N5I3_THEPA      LSDYTNTNNPVQR-----------------------------------TQSYVEIDSLVL
A7ANU3_BABBO      PGDSASTNKPTSTF----------------------------------RDTYVEIDSLAL
EIF3H_DICDI       NSKLDVVQID----------------------------------------------GLVV
D3BJY8_POLPP      NPKLDVVQID----------------------------------------------GIVV
EIF3H_ARATH       APPLRVVQIE----------------------------------------------GLAV
D7U9M6_VITVI      ASPLRVVQIE----------------------------------------------GLVI
A9THQ6_PHYPA      ALPLRTVQIE----------------------------------------------GLVA
A9TIQ5_PHYPA      VQPLRVVQIE----------------------------------------------GLVA
A8JBC8_CHLRE      KELVKTVQLE----------------------------------------------GQVL
D0P2T1_PHYIT      AAAAPATSDA--SSSTVAALGPAPESTEAIDIFEGV-----------TPVTSVALEGVAL
H3H5C8_PHYRM      AAAAAPAPAAPVSSPTVAVLGPVPESAEAIDIYEGV-----------TPVTSVALDGVAL
D0MZ23_PHYIT      PLLHLPLPMP--------------------------------------------------
B8C426_THAPS      LEGLAA------------------------------------------------------
F4P532_BATDJ      NKKISSVELN----------------------------------------------ALAA
EIF3H_BOVIN       DSAVKQVQID----------------------------------------------GLVV
G1NWX2_MYOLU      DSAVKQVQID----------------------------------------------GLVV
EIF3H_HUMAN       DSAVKQVQID----------------------------------------------GLVV
F6UCC5_MACMU      DSAVKQVQID----------------------------------------------GLVV
H0WZG7_OTOGA      DSAVKQVQID----------------------------------------------GLVV
EIF3H_MOUSE       DSAVKQVQID----------------------------------------------GLVV
EIF3H_RAT         DSAVKQVQID----------------------------------------------GLVV
EIF3H_CHICK       DSAVKQVQID----------------------------------------------GLVV
EIF3H_TAEGU       DSAVKQVQID----------------------------------------------GLVV
EI3HA_DANRE       DFPVKQIQVD----------------------------------------------GLVV
EI3HB_DANRE       DTPVKQIQIE----------------------------------------------GLVV
H3DP56_TETNG      DSPVKQIQIE----------------------------------------------GLVV
H3AZH6_LATCH      DCAVKQVQID----------------------------------------------GLVV
EIF3H_XENTR       ETAVKQVQID----------------------------------------------GMVV
C3YQB9_BRAFL      GEQVKLVQID----------------------------------------------GLVV
B7PKD6_IXOSC      ESPVDYVQVD----------------------------------------------GLVV
EIF3H_NEMVE       -GQIDIVQVD----------------------------------------------GLTV
EIF3H_AEDAE       DNTISYVQCD----------------------------------------------GLAA
EIF3H_ANOGA       DNTISYVQCD----------------------------------------------GLAA
EIF3H_BOMMO       EATIQYVQCD----------------------------------------------GLAV
E0VY38_PEDHC      DSPIDYVQMD----------------------------------------------GLAV
EIF3H_DROME       DNTINYVQCD----------------------------------------------GLAV
EIF3H_DROPS       DNTINYVQCD----------------------------------------------GLAV
E9GPS9_DAPPU      DNTIDLVQVD----------------------------------------------GLVV
B3S1H3_TRIAD      DVPIKKVSID----------------------------------------------GQVI
EIF3H_MONBE       NSVVKQVTVD----------------------------------------------ALVV
EIF3H_CAEBR       APSVKHILLD----------------------------------------------SLVV
EIF3H_CAEEL       APSVKHILLD----------------------------------------------SLVV
EIF3H_EMENI       -TPLTAVKVEA----------------------------------------------LVV
EIF3H_ASPFU       -TPLTAVKVEA----------------------------------------------LVV
C0NJF2_AJECG      -ATLKAVQVEA----------------------------------------------LVV
EIF3H_PHANO       DVPFKTVQVDA----------------------------------------------LVA
C7YYH6_NECH7      DAPFQAVQVEA----------------------------------------------LVI
EIF3H_NEUCR       DAPIKSVQVEA----------------------------------------------LVV
EIF3H_SCLS1       EVPLHSVQVEA----------------------------------------------LVV
D5GNQ2_TUBMM      SGPLKSVQVDA----------------------------------------------LVV
EIF3H_YARLI       -MTTTRVCIDS----------------------------------------------SVA
EIF3H_SCHPO       SPPIERVELES----------------------------------------------LLV
D6RJQ0_COPC7      ------VQLDG----------------------------------------------MAV
EIF3H_USTMA       SDVITSVRLDG----------------------------------------------LAL
Q5ADU3_CANAL      PATLNTVHISS----------------------------------------------SVL
E3L0X1_PUCGT      ELPVESLKVDS----------------------------------------------LAV
G4V6S0_SCHMA      SKTIDRVQVE----------------------------------------------GKVF
Q5CXR9_CRYPI      QSQSGGQQISQGSLSSGTGHHQHYSFSSGNTIGNSGGSSHYKHLSTKTTVSSVEADISAI
Q5KHC1_CRYNJ      AREVENVSLSS----------------------------------------------LVF
Q23AY3_TETTS      ANQIDKVLIDE----------------------------------------------LVI
                                                                              

Q4UE08_THEAN      IKAIKHCKDN----------------------YPVPVNGQLLGLDFGD---------RLE
Q4N5I3_THEPA      IKAIKHCKDN----------------------YPVPVNGQLLGLDFGD---------RLE
A7ANU3_BABBO      IKALKHCKDN----------------------YPVPVNGQLLGLDVGD---------KLE
EIF3H_DICDI       LKIIKQCKEY----------------------LPELVPGQLLGLDIGT---------SLE
D3BJY8_POLPP      MKIIKNCKEY----------------------LPELVPGQLLGIDIGT---------SLE
EIF3H_ARATH       LKIIKHCKEF----------------------SPTLVTGQLLGLDVGS---------VLE
D7U9M6_VITVI      LKIIKHCKEF----------------------SPALVTGQLLGLDVGS---------VLE
A9THQ6_PHYPA      LKIVKHCKEC----------------------MPALVTGQLLGLDIGS---------ILE
A9TIQ5_PHYPA      LKIIKHCKEC----------------------MPALVTGQLLGLDIGS---------ILE
A8JBC8_CHLRE      LKIIQHCTEA----------------------LPQNVTGQLLGLDVGQ---------QLE
D0P2T1_PHYIT      LQIIKHCHES----------------------LPGGVAGSLLGVDNEQ---------VLE
H3H5C8_PHYRM      LQIIKHCHDS----------------------IPGGVAGSLLGVDSEQ---------VLE
D0MZ23_PHYIT      LLPLWRLWDR----------------------LPS----PLRPLTSSK---------VLE
B8C426_THAPS      LKIIKHCQES----------------------LPTMVTGSLLGLMIEDG--------VLE
F4P532_BATDJ      LKIIKHCKDG----------------------FPATCSGQLLGIDAVG---------KLQ
EIF3H_BOVIN       LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
G1NWX2_MYOLU      LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
EIF3H_HUMAN       LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
F6UCC5_MACMU      LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
H0WZG7_OTOGA      LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
EIF3H_MOUSE       LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
EIF3H_RAT         LKIIKHYQEE--------------------GQGTEVVQGVLLGLVV---------EDRLE
EIF3H_CHICK       LKIIKHYQEE--------------------GQGNEVVQGVLLGLVV---------DDRLE
EIF3H_TAEGU       LKIIKHYQEE--------------------GQGNEVVQGVLLGLVV---------DDRLE
EI3HA_DANRE       LKIIKHYQEE--------------------GQGSEVVQGVLLGLVV---------EDRLE
EI3HB_DANRE       MKIIKHYQEE--------------------GQGSEVVQGVLLGLVV---------EDQLE
H3DP56_TETNG      LKIIKHYQEE--------------------GQGSEVVQGVLLGLVV---------DDRLE
H3AZH6_LATCH      LKIIKHYQEE--------------------GQGSEVVQGVLLGLVV---------DDRLE
EIF3H_XENTR       LKIIKHYQEE--------------------GHGSEVVQGVLLGLVV---------DDRLE
C3YQB9_BRAFL      LKIIKHCEEE--------------------GAVGDLVQGVLLGLVV---------DDKLE
B7PKD6_IXOSC      LKIIKHCSEEA-------------------GGLLDVAQGVLLGLIN---------NNCVE
EIF3H_NEMVE       LKIIKHCEEE--------------------GSSGDLVQGVLLGLIQ---------DNRLE
EIF3H_AEDAE       MKMVKHCHEES-------------------RSNMEVAQGALLGLVV---------DDRLE
EIF3H_ANOGA       MKMVKHCHEES-------------------LNNMEVAQGALLGLVV---------DDRLE
EIF3H_BOMMO       MKIVKHCHEES-------------------CSNMEVAQGALLGLVV---------ENRLE
E0VY38_PEDHC      MKMVKHCHEES-------------------SGNFEIAQGALLGLVV---------ETRLE
EIF3H_DROME       MKMVKHCHEES--------------------SNMDLAQGALLGLVV---------DKCLE
EIF3H_DROPS       MKMVKHCHEES--------------------SNMDLAQGALLGLVV---------DKCLE
E9GPS9_DAPPU      AKIIKHCHEEG-------------------SSAVDVAQGVLLGLVA---------DTRLE
B3S1H3_TRIAD      LQIIRHCQSE--------------------RDSTDLAQGVLLGMLV---------DNCTE
EIF3H_MONBE       MKIIKHAREN----------------------PHEPVRGPLLGLSQLADASKPGEDALLE
EIF3H_CAEBR       MKIVKHVDSELHAGIS--------------EVSGDACAGVLTGLVFLE-------DSRLE
EIF3H_CAEEL       MKIVKHVDSELHAGIS--------------EVSGDACAGVLTGLVFLE-------DSRLE
EIF3H_EMENI       MKIIKHCSQVF---------------------PTTAT-GSIVGMDVDG---------VLE
EIF3H_ASPFU       MKIMKHCSQTF---------------------PTTAT-GSIVGMDVGG---------TLE
C0NJF2_AJECG      MKIIKHSSQAF---------------------PTIAT-GSLVGMDVRG---------TLQ
EIF3H_PHANO       IKIATASGKAF---------------------PSLAT-GSLVGMEKNG---------VLE
C7YYH6_NECH7      MKIAKHCSSAF---------------------PSVAT-GSIVGMDRDE---------LLE
EIF3H_NEUCR       MKIVKHCSTSF---------------------PTVAT-GSIVGMDNNG---------AIE
EIF3H_SCLS1       MKIVKACAATY---------------------PTTAT-GSIVGMDSNG---------TLQ
D5GNQ2_TUBMM      LKICKHASSAH---------------------PQVIT-GQLLGMDVDG---------ELQ
EIF3H_YARLI       LKIVRHCQESA---------------------PSIVA-GQLLGLDVDG---------ELR
EIF3H_SCHPO       MNIIKHCRDSF---------------------PNMGTIGQLVGIDIDG---------VLQ
D6RJQ0_COPC7      TKIIKHAREAP---------------------STTAH-GLLLGLDLDG---------VLE
EIF3H_USTMA       TKIVKHCRDAH---------------------PASAS-GALLGMDLGG---------TLE
Q5ADU3_CANAL      LSLLRHTSEHY----------------------PQLFSGALLGFEDES---------LID
E3L0X1_PUCGT      MKIIKHAREVAL------------------SSATSPASGQLLGIDSAG---------VLN
G4V6S0_SCHMA      LKMIKHYEEES-------------------VSSQNFVNGVLLGLAQGS---------QLE
Q5CXR9_CRYPI      LRIIKHCTENY---------------------SQMNATGQLLGMEYGN---------KLE
Q5KHC1_CRYNJ      LKMMKHSTDSLPAPPASVLQQDRNPPPSTELSSHVDALGVLLGLDLDG---------VME
Q23AY3_TETTS      LKILKHAKSSD----------------------DKTIIGQLHGFYADN---------IVE
                                                          :  .                

Q4UE08_THEAN      VTNCFPYPQKR-----DIY-------NSIIKDKNTNTLAENEIEEKADEEFVKYQELMTE
Q4N5I3_THEPA      VTNCFPYPQKR-----DIY-------NSIIKDKNTNTLAENEIEEKADEEFVKYQELMTE
A7ANU3_BABBO      VTNCLPYPQKR-----DIY-------NSLNRDSNTTNLTEKELEERADDEFVKYQDKMID
EIF3H_DICDI       VSNCFPFPP-R---------------DQEDENSES---------------IADYQLEMMR
D3BJY8_POLPP      VSSCFPFPNLR---------------DQEDDLNEGG--------------IAEYQLEMMR
EIF3H_ARATH       VTNCFPFPVR-----------------DDDEEIEAD--------------GANYQLEMMR
D7U9M6_VITVI      VTNCFPFPIR-----------------EEDEEIEAD--------------GANYQLEMMR
A9THQ6_PHYPA      VTNCFPFPVCG----------------EDEDELDTD--------------GANYQLEMMR
A9TIQ5_PHYPA      VTNCFPFPVK------------------DEDELDTD--------------GANYQLEMMR
A8JBC8_CHLRE      VTDCFAFPATV---------------ADDDSEAESA--------------GANYQLEMMR
D0P2T1_PHYIT      VTNSFPSPPSS---------------ERKK-------------------GADEYQLDMMK
H3H5C8_PHYRM      VTNSFPSPPSS---------------ERKK-------------------GADEYQLDMMK
D0MZ23_PHYIT      VTNSFPSPPSS---------------ERKK-------------------GADEYQLDMMK
B8C426_THAPS      ITHAFPFPEPL---------------DDKGDIVKTAEEAANADDEAAALDGHEFQLEMMK
F4P532_BATDJ      ITNAFPFTAEA---------------AVGEDVFDGT----------------DYQTQMLC
EIF3H_BOVIN       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
G1NWX2_MYOLU      ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_HUMAN       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
F6UCC5_MACMU      ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
H0WZG7_OTOGA      ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_MOUSE       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_RAT         ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_CHICK       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_TAEGU       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EI3HA_DANRE       ITNCFPFP---------QH-------TEDDVEFDEVQ----------------YQMEMMR
EI3HB_DANRE       ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
H3DP56_TETNG      ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
H3AZH6_LATCH      ITNCFPFP---------QH-------TEDDADFDEVQ----------------YQMEMMR
EIF3H_XENTR       ITNCFPFP---------QH-------TEDDVDFDEVQ----------------YQMEMMR
C3YQB9_BRAFL      ITNCFPFP---------RR-------S--DEDFDEVQ----------------YQMEMMR
B7PKD6_IXOSC      ITNCFPIPP--------RH-------AEEEE-ADDLE----------------YQMEMMR
EIF3H_NEMVE       ITNCFPFPS--------NK-------AGDDEDDDDVN----------------YQMEVMR
EIF3H_AEDAE       ITNCFPFP------------------KSSDETIDEEE----------------YQLNMMR
EIF3H_ANOGA       ITNCFPFP------------------KS-DETIDEEE----------------YQLNMMR
EIF3H_BOMMO       ITNCFPFP------------------KH-DDTMDEEE----------------YQLDMMR
E0VY38_PEDHC      ITNCFPFP------------------KH-DDSIDEEQ----------------YQLDMMR
EIF3H_DROME       ITNCFPFP------------------KSGDETMDEEM----------------YQLTVMR
EIF3H_DROPS       ITNCFPFP------------------KSGDETMDEEM----------------YQLTVMR
E9GPS9_DAPPU      VTNCFPFP------------------KNLDENFDEED----------------YQMEMMR
B3S1H3_TRIAD      VTYCFPFP---------EF-------TEADTDNDIEM----------------YQLDMMK
EIF3H_MONBE       VTNCFPTP---------RV-------SDDDDDSIVQQ----------------YQVQMMR
EIF3H_CAEBR       ITNCFPTVRNEPVIDDDAN-------AAQQYEEQKQQ----------------EMLDMLR
EIF3H_CAEEL       ITNCFPTVRNEPVMDDDAN-------AAQQYEEQKQH----------------EMLDMLR
EIF3H_EMENI       ITNTFPFPVVEVPPESHFD---NAAPNPAAAAPRAKA-------------NTVYQAEMIR
EIF3H_ASPFU       ITNSFPFPVVEVPPESHFD---NAAANPAAAAPRAKA-------------NTVYQAEMIR
C0NJF2_AJECG      VTNCFPFPVVDIPTESHFD---NASQNSAAVAPRAKS-------------NTVYQAEMIK
EIF3H_PHANO       ITNSFPYPEINTASADGQN---DTAANLSAAAPRAKQ-------------NIAYGNEMIK
C7YYH6_NECH7      ITNTFPFPTVDPATTDGHQ---NDASALAAAAPRQKA-------------NIAYQNEMIR
EIF3H_NEUCR       VTNSFQFPSVDVSSSDSH----SDASSLAAAAPRAKA-------------NIVYQNEMIR
EIF3H_SCLS1       ITNSFPFPTADVAASDSHPNDHMAASNIAAAAPRSKA-------------NIVYQSEMIK
D5GNQ2_TUBMM      VTNSFPFPSTDPSTSSNDPD--SNLASAAALAPRSKA-------------SAWYQTEMVR
EIF3H_YARLI       ISHAFAFPQNAAGGNPNSD---------DGLSLRLKA-------------VAKYQPEMID
EIF3H_SCHPO       VSSSFESPSVLENEESAVN-----------KSVSGKA-------------RQAHTEAMLN
D6RJQ0_COPC7      ISNSFPLPHAG-----------------DEAEKASKS-------------IARHQAAMLR
EIF3H_USTMA       ISNVFALPNPGRSNSERD----------EEEDRSSRN-------------ATRYTSDMVR
Q5ADU3_CANAL      VTHGFPYPYPD---------------QYEGGSFRSRS-------------GGQYQKDLLE
E3L0X1_PUCGT      VSDAFPLPSGS------------LGSNAEGEDKQASQK-----------STARYTASILP
G4V6S0_SCHMA      ITNCFPLPKTQ----------------EDDPNANEAL--------------VTYEANMIR
Q5CXR9_CRYPI      ITTSFQLPTREDLLPSLMSNYSGGKLDKSEKLDLEERLVE---------EVDKYQAAMVE
Q5KHC1_CRYNJ      VEDCYALP-------------------GGETSLGPNS----------------YSAKLLS
Q23AY3_TETTS      VTHTYPLAD------------------SSRISISQAD----------------YDHQMSK
                  :                                                        :  

Q4UE08_THEAN      LVHDVRVDCFAIGWYQTVNFGDLQSKD-AIDNLVIYQDVV--------------------
Q4N5I3_THEPA      LVHDVRVDCFAIGWYQTVNFGDLQSKD-AIDNLVIYQDVV--------------------
A7ANU3_BABBO      LLHDIRVDCFAIGWYQTLHFGDVQSKE-VIDNLVIYQEAV--------------------
EIF3H_DICDI       FLREVNIDSNTVGWYTPTYLNSFFNES-VIETQYNYQATIN-------------------
D3BJY8_POLPP      FLREVNIDSNTVGWYTPTYLNSFFNES-VIETQYKYQSAIN-------------------
EIF3H_ARATH       CLREVNVDNNTVGWYQSTVLGSYQTVE-LIETFMNYQENI--------------------
D7U9M6_VITVI      CLREVNVDNNTVGWYQSTLLGSFQTVE-LIETFMNYQENI--------------------
A9THQ6_PHYPA      CLREVNVDNNTVGWYQSTYMGSFQTVE-LIETFMNYQENI--------------------
A9TIQ5_PHYPA      CLREVNVDNNTVGWYQSTYMGSFQTVE-LIETFLNYQENI--------------------
A8JBC8_CHLRE      CLREVNVDNNTVGWYQSANMGTFQTVE-LIETFINYHENI--------------------
D0P2T1_PHYIT      SLREVGMDNNKVGWYQSVAMGTFCTAS-FIEHQFQYQRSLG-------------------
H3H5C8_PHYRM      GLREVGMDNNKVGWYQSVTMGTFCTAS-FIEHQFQYQKSLG-------------------
D0MZ23_PHYIT      SLREVGMDNNKVGWYQSVAMGTFCTAS-FIEHQFQYQKSLG-------------------
B8C426_THAPS      MLREVNVDNNCVGWYQSMYLGSYSTSS-LLENQLSYQTDLS-------------------
F4P532_BATDJ      CLRALNFDANSVGWYQSTYMGTYWNQA-IIDAQYNYQKNS--------------------
EIF3H_BOVIN       SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
G1NWX2_MYOLU      SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EIF3H_HUMAN       SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
F6UCC5_MACMU      SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
H0WZG7_OTOGA      SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EIF3H_MOUSE       SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EIF3H_RAT         SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EIF3H_CHICK       SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EIF3H_TAEGU       SLRHVNIDHLHVGWYQSTYYGSFVTRA-LLDSQFSYQHAI--------------------
EI3HA_DANRE       SLRHVNIDHLHVGWYQSTYYGSFVSRA-LLDSQFSYQHAI--------------------
EI3HB_DANRE       SLRHVNIDHLHVGWYQSTLYGSFVSRA-LLDSQFSYQHAI--------------------
H3DP56_TETNG      SLRHVNIDHLHVGWYQSTYYGSFVSRA-LLDSQFSYQHAI--------------------
H3AZH6_LATCH      SLRHVNIDHLHVGWYQSTIYGSFVSRA-LLDSQFSYQHAI--------------------
EIF3H_XENTR       SLRHVNIDHLHVGWYQSTFYGTFVSRA-LLDSQFSYQHAI--------------------
C3YQB9_BRAFL      SLRHVNIDHLHVGWYQSTVHGAFLNRA-LLDSQFNYQHAI--------------------
B7PKD6_IXOSC      QMRHVNVDHLHVGWYQSSNFGSFSNRP-LLESQFGYQTNI--------------------
EIF3H_NEMVE       RLRAVNIDHLHVGWYQSTYLGSYINRT-LLDSQYSYQKSI--------------------
EIF3H_AEDAE       RLRLVNVDHFHVGWYQSADVGNFLSLP-LLESQYHYQTSI--------------------
EIF3H_ANOGA       RLRHVNVDHFHVGWYQSADVGNFLSST-LLESQYHYQTSI--------------------
EIF3H_BOMMO       RLRRVNVDHFHVGWYQSADVGNFLSLS-LLESQYHYQTSI--------------------
E0VY38_PEDHC      RLRRVNVDHFHVGWYQSSDVGNFLSLP-LLESQYHYQISI--------------------
EIF3H_DROME       RLRRVNVDHLHVGWYQSSDVGNSLSMA-LLESQYHYQTSI--------------------
EIF3H_DROPS       RLRRVNVDHLHVGWYQSSDVGNSLSLA-LLESQYHYQTSI--------------------
E9GPS9_DAPPU      HLRKVNVDHLHVGWYQSTQQGAFLSTQ-FLESQFTYQTSI--------------------
B3S1H3_TRIAD      YLRSINMDHMQVGWYRASPFDLNVIKD-MLDSQYTYQKQI--------------------
EIF3H_MONBE       WLREVNVDHMNVGWYQAADMGTFFDED-VAAVQFQHQRHM--------------------
EIF3H_CAEBR       KFRTMNIDYEIVGFYQSHQFGAGFSHD-LVESMFDYQAMG--------------------
EIF3H_CAEEL       KFRTMNIDYEIVGFYQSHQFGAGFSHD-LVESMFDYQAMG--------------------
EIF3H_EMENI       MLREVNVDANNVGWYTSANMGNFVNMN-VIENQFFYQKEM-------------------N
EIF3H_ASPFU       MLREVNVDANNVGWYTSANMGNFVNMN-VIENQFFYQKEM-------------------N
C0NJF2_AJECG      MLREVNIDANNVGWYTSANMGNFVNLN-VIENQYYYQKEL-------------------N
EIF3H_PHANO       FLREVNVDANNVGWYTSTSMGNFVNLN-TIENQFYYQSQL-------------------N
C7YYH6_NECH7      HLKEVNVDANNVGWYTSATMGNFVNLS-FIENQFHYQKD--------------------N
EIF3H_NEUCR       HLKEVNVDANNVGWYTSATMGNFINMS-FIENQYHYQKE--------------------N
EIF3H_SCLS1       MLKEVNVDANNVGWYTSANMGNFINTS-LIENQFFYQKEP-------------------N
D5GNQ2_TUBMM      CLREMNVDANSVGWYQSANLGNFLNTN-FIDNQYFYQNAL-------------------N
EIF3H_YARLI       HLKEVNVDSNSVGWYQSTVLGRIYNAS-VIENLAVFQEK--------------------N
EIF3H_SCHPO       RLQYIGAVTGHVGWYLGAYVSSFLSSP-FFVETQYAYQKA-------------------N
D6RJQ0_COPC7      SLKEVQADDSVVGFYQATTLGAFFNQT-LLDTQAIHQDKL-------------------R
EIF3H_USTMA       LLRDVNADANPVGLYQGCFLGAFLNSS-VIDGLAAITGLVERDGAGS------------R
Q5ADU3_CANAL      NFKKLGYGIEFLGWFQSTVSGNFVTNQ-LIEGLAQQQLIN--------------------
E3L0X1_PUCGT      RLSALGADANVVGFYCSTVNGQHCATPGFIETLISMQIGAPPAANPKTKTVTSVRSKIAG
G4V6S0_SCHMA      NLRQLQTDYLNVGFYQAGPGGVSINRA-NIENIYQRQINL--------------------
Q5CXR9_CRYPI      LMHEIRSDCFVLGWYQLIRLDDFQDYG-VVSTLLSYYNNIE------------------S
Q5KHC1_CRYNJ      RLGTVSTPDSPVGIYLSTHNGGFATRV-SIELLSAVEKAAG------------------R
Q23AY3_TETTS      LSEEVHLDNNKVGWYHVSSKSDNFVASDSFEQQSNYQVNN--------------------
                      :      :*                                               

Q4UE08_THEAN      DKAIMLGFDPV-S-------------------TTGEVSFKAYRASDQLLSVYHSS----D
Q4N5I3_THEPA      DKAIMLGFDPV-S-------------------TTGEVSFKAYRASDQLLSVYHSS----D
A7ANU3_BABBO      DKAIMLGFDPM-S-------------------STGEISFKAYRASDQLLELYHSS----N
EIF3H_DICDI       QKCVVIVYDPIKT-------------------SQGTLSLKCYRLTQSFMELFKDQS--FS
D3BJY8_POLPP      QKCVLLVYDPIKT-------------------AQGTLSLRCYRLTTTFMELFRNHP--YS
EIF3H_ARATH       KRCVCIIYDPSKA-------------------DLGVLALKALKLSDSFMELYRGGN--FT
D7U9M6_VITVI      RRCVCIIYDPSRS-------------------NQGVLALKALKLSDSFMELYRNNN--FT
A9THQ6_PHYPA      KRCVCIIYDPLRS-------------------SQGVLALKALKLAEGFMELYRTQT--FS
A9TIQ5_PHYPA      KRCVCIIYDPVRS-------------------GQGVLALKALKLSEDFMELYRSQS--LS
A8JBC8_CHLRE      KKCVCIIYDPQRS-------------------SRGSIALKAIRLKESFIELSKEQK--LT
D0P2T1_PHYIT      PNAICLIYDSAET-------------------SKGSLSLRAVRLTKAFMDTYKTNS--FT
H3H5C8_PHYRM      PNAICLIYDSAET-------------------SKGSLSLRAVRLTKAFMDTYKSSS--FS
D0MZ23_PHYIT      PNAICLIYDSAET-------------------SKGSLSLRAVRLTKAFIDTYKTNS--FT
B8C426_THAPS      PNAVVILYDPMQT-------------------AHGNLVLKCYRLTEEAVQLKQSG-----
F4P532_BATDJ      PHAVMIIYDPSGT-------------------SQGNLSLKALRLSDTFMQVYETRK--FS
EIF3H_BOVIN       EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
G1NWX2_MYOLU      EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EIF3H_HUMAN       EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
F6UCC5_MACMU      EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
H0WZG7_OTOGA      EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EIF3H_MOUSE       EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EIF3H_RAT         EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EIF3H_CHICK       EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EIF3H_TAEGU       EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEVCKEK--DFS
EI3HA_DANRE       EESVVLIYDPLKT-------------------AQGSLCLKAYRLTPKLMEICKEK--DFT
EI3HB_DANRE       EESVVLIYDPIKT-------------------AQGSLCLKAYRLTPKLMEICKEK--DFS
H3DP56_TETNG      EESVVLIYDPIKT-------------------AQGSLSLKAYRLTPKLMEICKEK--DFT
H3AZH6_LATCH      EESVVLIYDPIKT-------------------SQGSLSLKAYRLTPKLMEICKEK--DFS
EIF3H_XENTR       EESVVLIYDPIKT-------------------GQGSLSLKAYRLTPKLMEVCKEK--DFS
C3YQB9_BRAFL      EESVVLVYDPQRT-------------------AGGSLCLRAFRLSPMAMEAYKEG--EFT
B7PKD6_IXOSC      TESVVLIYDPVRT-------------------TRGFLSLRAFRLTDPAMKLLGDN--EFS
EIF3H_NEMVE       EESVVLIYDPLRT-------------------SQGMLTLKAFRLSDEMMKLYKDG--EFS
EIF3H_AEDAE       EESVVVIYDTQKS-------------------ARGFLTLKAYRLTPQAIAMYKEE--KFT
EIF3H_ANOGA       EESVVVIYDTQKS-------------------ARGFLTLKAYRLTPQAIAMYKER--DFT
EIF3H_BOMMO       EESVVVIYDTKKS-------------------ARGFLTLKAYRLTPQAIAMYKEG--DYT
E0VY38_PEDHC      EESVVVIYDTQKS-------------------ANGFLTLKAYRLTPQAINMYKDN--EFT
EIF3H_DROME       EESVVVVYDTQKS-------------------SRGFLCLKAYRLTPQAIQMYKDG--DFT
EIF3H_DROPS       EESVVVVYDTQKS-------------------ARGFLCLKAYRLTPQAIQMYKDG--DFT
E9GPS9_DAPPU      EESVVLIYDPLKT-------------------KRGFLHLKAYRLTPQAVALYKDN--DFG
B3S1H3_TRIAD      HESVGLLFDPIKA-------------------AQGNLSMKAYRLSSKVMEMYGQGSTEFT
EIF3H_MONBE       AESVVLIYDPVLT-------------------LQGTLSLSAFRLSNKAMELFSTD--SFN
EIF3H_CAEBR       PENVVLIYDPIKT-------------------RQGQLSIRAWRLSTAALDLASKN--DWR
EIF3H_CAEEL       PENVVLIYDPIKT-------------------RQGQLSLRAWRLSTAALDLASKN--DWR
EIF3H_EMENI       ERTVALVHDPSRS-------------------AQGSLSLRAFRLSPKFMAAFKDNK--FT
EIF3H_ASPFU       ERTVALVHDVSRS-------------------SQGSLSLRAFRLSPKFMTAFKENK--FT
C0NJF2_AJECG      ERTVALVHDISRS-------------------SQGALALRAFRLSPQFMAAFKDNK--FT
EIF3H_PHANO       ERTVALIYDVSRS-------------------SQGTLNLRAYRLSPSFVTAYKEGK--FT
C7YYH6_NECH7      EHTVALVYDASKS-------------------SQGNLTLRAFRLTPAFMTAYKENK--FT
EIF3H_NEUCR       EKTVALVHDVSRS-------------------SQGALSLRAFKLSPEFMTAYKEAK--FT
EIF3H_SCLS1       ERTVALVHDVSRS-------------------AQGALSLRAFRLSPNFMTAYKEGK--FT
D5GNQ2_TUBMM      ERTVALVHDTARS-------------------AQGALSLRAFRLTPQFMAVQKEGK--FT
EIF3H_YARLI       PDSVVLVYDVAGSEVVSDTDPSSTGPQGHTTTTPSGFNLRAFRLSEEYLNVRKSGK--FD
EIF3H_SCHPO       PNSIAFLYDLSQS-------------------SNGTLYMRAYQLTPEFMAAHEEKT--WT
D6RJQ0_COPC7      HGGIVIVHDLSQT-------------------ARGNASFRAFRLTVAFLDAYKRSN--FS
EIF3H_USTMA       GKGVLIVHDLAQS-------------------AQGNTSVKAYRLSPSFVDAHKKGK--FH
Q5ADU3_CANAL      SNAFILINNLSSV--------------------GQEVSIKALRLSTGFMNAYVDGK--WK
E3L0X1_PUCGT      GKGVALVYDLASA-------------------TEGTVHLKAYRLSKEFIETYKSGK--FD
G4V6S0_SCHMA      PESVLLTYDPTRT-------------------SRGQIGLKAYRLSDDVLAARSEAEDRFR
Q5CXR9_CRYPI      KNAILLSIDPDLLIQ------------------GKKNAFKAFTLNSEYASKLKDDE----
Q5KHC1_CRYNJ      GKAILVVHDASRS-------------------NGGDVSVKAYRLADGAREAAKLGR--WD
Q23AY3_TETTS      PNCIYLIYDNLEAL------------------RGVNNPYKAYRVSDKYIDLSEQSK--VS
                     . .  :                               .                   

Q4UE08_THEAN      PDVRKFNALKGT------------EILEE-VPIVIKNSILSEVFLSQYFSDSLIQN----
Q4N5I3_THEPA      PDVRKFNALKGT------------EILEE-VPIVIKNSILSEVFLTQYFSDSLIQN----
A7ANU3_BABBO      GDITNFNSLKGT------------QILVE-VPIVVKNSILSECFLSQYVFDNPAQN----
EIF3H_DICDI       RERLDQANLSFN------------DIFEQ-IPIKIHNSQLINALLYEFDG----------
D3BJY8_POLPP      RERMDNAALSFA------------DIFEQ-IPIRIHNAQLINALLYELRD----------
EIF3H_ARATH       GEKLREKNFSWM------------DIFEE-IPIKVSNSALVSAFMTELET----------
D7U9M6_VITVI      GEKLREKNLSWV------------DIFEE-IPIKVSNSALISAFMTELEA----------
A9THQ6_PHYPA      GEKLREKNLTWK------------DIFEE-IPVKICNSALVSSMMTELEP----------
A9TIQ5_PHYPA      GEKLREKNMAWT------------HIFEE-IPVKISNSALVSSLMTELEP----------
A8JBC8_CHLRE      LKGFREANLSWR------------DIFVE-LPIRIRNSNLVQALVADLMP----------
D0P2T1_PHYIT      KEIFAKADIRSA------------TVVEE-IPIEIRNSDIITCWLQQTAH----------
H3H5C8_PHYRM      KESFAKADIRSA------------TVVEE-LPVEIRNSDLITCWLQQTAH----------
D0MZ23_PHYIT      KEIFAKADIRSA------------TVVEE-IPIEIRNSDIITCWLQQTAH----------
B8C426_THAPS      ----KNNYINPR------------KIFEE-VPVTLSNPGLVRSLLRDVGDG---------
F4P532_BATDJ      TENILEHKLTPG------------SVFET-IPLKISSSHLLNTALLEVSNQSNLSSTTCS
EIF3H_BOVIN       PEALKKGNITFE------------HMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
G1NWX2_MYOLU      PEALKKGSITFE------------HMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
EIF3H_HUMAN       PEALKKANITFE------------YMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
F6UCC5_MACMU      PEALKKANITFE------------YMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
H0WZG7_OTOGA      PEALKKANITFE------------HMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
EIF3H_MOUSE       PEALKKASITFE------------HMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
EIF3H_RAT         PEALKKANITFE------------HMFEE-VPIVIKNSHLINVLMWELEKKSAVAD----
EIF3H_CHICK       PEALKKANIAYE------------NMFEE-VPIVIKNSYLINVMLWELEKKSAVAD----
EIF3H_TAEGU       PEALKKANIAYE------------NMFEE-VPIVIKNSYLINVMLWELEKKSAVAD----
EI3HA_DANRE       PEGLKKAAVAYE------------HMFEE-VPIFIKNSHLINVLMWDLQEKSTLAD----
EI3HB_DANRE       SEGLKKASVGYE------------HMFEE-VPIVIKNSHLINVLLWELEEKSTAAD----
H3DP56_TETNG      PEGLKKASIGFE------------NMFERGYPIIIKNSH-ISVLMWELEDKSTVSD----
H3AZH6_LATCH      PEGLKKANIGFE------------NMFEE-VPIVIKNSHLMNVLMWKLDENSTIAD----
EIF3H_XENTR       AEGLKKANIAFE------------DMFEE-VPIIIKNSHLINVLAWELDKKAPVTE----
C3YQB9_BRAFL      SESFKKHGLGYE------------NLFEE-ISVVIKNSNLINVLCCELIEKAPRTQ----
B7PKD6_IXOSC      ADSFKAARCSFE------------NMFEE-IPVVIRNSHLVNILLCELTESTPVDV----
EIF3H_NEMVE       ADKLSKAGISFH------------SMFQE-IPLVIKNSSLMNVLLCELDENTPTPS----
EIF3H_AEDAE       PEALRNLKVGYE------------NLFIE-IPIVIKNSALCNIMMSEMKEMVPEEE----
EIF3H_ANOGA       PEALRNLKVGYE------------NLFIE-IPIVIKNSALCNIMMSELTELVPEEE----
EIF3H_BOMMO       PEALRNLKIGYE------------NLFIE-VPIVIRNSPLTNIMISELTEMIPEEE----
E0VY38_PEDHC      PEALRNLKIGFE------------NLFTE-IPIEVRNSPLTNIMLSELTEMVPEEE----
EIF3H_DROME       PEAFRTLKVGYE------------NLFAE-IPIVIKNSPLTNIMMSELNELLPEDK----
EIF3H_DROPS       PEAFRTLKVGYE------------SLFAE-IPIVIKNSPLTNIMMSELNELLPEDK----
E9GPS9_DAPPU      ADNIKTHHLSFE------------SLYQE-IRLVIHNSHLVNALLCELSEMVPSYE----
B3S1H3_TRIAD      VNSILAAGLSYE------------NIFEE-IPVEIRNSSLCNVYLAQL-KLNHSSA----
EIF3H_MONBE       PKAVREAGLTYR------------TVFEK-VPVTIRASSMARLLIPELSANLDQSE----
EIF3H_CAEBR       PELVKSAGLTYQ------------NMFEE-LPIIIKSSYLNNVLMSELALSKSYSSD---
EIF3H_CAEEL       PELVKAAGLTYQ------------NMFEE-LPIIIKSSYLNNVLMSELSLAKSCSSD---
EIF3H_EMENI       SDELQKSNLKYQ------------DILVE-LPVEIHNSHLITSFIHQLQNQTQATPAEIP
EIF3H_ASPFU       SEELQKSGLRYQ------------DIFVE-LPVEIHNSHLITSFIHQLQTPNIPAPTELP
C0NJF2_AJECG      SEQLQKSNLRYQ------------DILVE-LPVQIHNSHLLTSYLHQLPTPTPSEPLDFP
EIF3H_PHANO       TESLQKSSLRYQ------------DILVE-LPVTVHNSHLLTSLLHQLPSEAPKEELSFP
C7YYH6_NECH7      TENLQKTKLTFK------------DIIAE-VPINVHNSHLLTTFLHQIPSAPVSGDIQQP
EIF3H_NEUCR       TESLRNSKLTYK------------DIFVE-LPVNVHNSHLLTSFLHQIPAPPKSAEIPMP
EIF3H_SCLS1       TENMQKSKLTYK------------DILVE-LPIIVHNSHLLTSFLHQMPVELPKKELDFP
D5GNQ2_TUBMM      SESLAKHNLTYR------------DILIE-LPVSVHNSHLLTTFLHQLDTPP------IP
EIF3H_YARLI       TATLTENNLTYH------------DVLVE-LPVEIKNSNLATLLLYQLGQQYPN------
EIF3H_SCHPO       ASSLNSHNLTPS------------NVIRE-LPIVIHNSHLATCLLHSLSEPP----TPAS
D6RJQ0_COPC7      TPSLISHRLTFS------------SILEE-VPLKIRTNPLLSSFLGTLTETRK------E
EIF3H_USTMA       TQSLIDHKLTFS------------NILIE-IPVSLRNTALLDAFLSSISTPSAPGPSIVQ
Q5ADU3_CANAL      SKDLESNKISYL------------NIFEE-LNLEISNQKLVDVYLSSLSLKPSTES----
E3L0X1_PUCGT      SQNLANHKLTTS------------NFLQE-IPLNIQSSALLTAFLATLIAPSKTGGQSGS
G4V6S0_SCHMA      LMGHKGPEVPWECEAASSVGRSSFTRVLEEIPVVIHNSHLVNILLTEIVDNQ--------
Q5CXR9_CRYPI      DNFHIFKNASFE------------DILVE-VPIYIKYPVLSEAFLLDWITSDVLQS----
Q5KHC1_CRYNJ      GQVLIEQGITAS-------------TLLTSIPITVTSPSLVNAFISTLNTPSPSETS---
Q23AY3_TETTS      VTDLKQFNTKTD------------KIFIP-IPVEIRRNPLAAALISEYTKQISKKY----
                                                  : :                         

Q4UE08_THEAN      --------------------TYVFDVLDAYH------NNYLEKNLEFLSQSLEALCDNQE
Q4N5I3_THEPA      --------------------TYVFDVLDAYH------NNYLEKNLEFLSQSLEALCDNQE
A7ANU3_BABBO      --------------------VSVFDILDADH------NKYLAHNLEFISHSLEALSDNQE
EIF3H_DICDI       ---------------ASNNLTNSFDRLNISN------NIYLEKVVEGMTDCLESLNQELN
D3BJY8_POLPP      ---------------DS---ISNFDRLNIGN------NLYLEKVVEGMTDCVDSLSQEVS
EIF3H_ARATH       ---------------DTPVSQGDYDRLHSST------TPFLENNMEFLIKCMDDLSMEQQ
D7U9M6_VITVI      ---------------DTPVTQCDYDRLQLST------NPYMERNLEFLIECMDDLSMEQQ
A9THQ6_PHYPA      ---------------DVQATQCDFDRLVLST------NPFMEKNLEFLIECMDDLSMEQQ
A9TIQ5_PHYPA      ---------------EAPATQCDFDRLVLST------NPFMEKNLEFLIECMDDLSMEQQ
A8JBC8_CHLRE      ---------------APTATQADVERLNLSS------APFLERNIQSLLECVDDIVAEQQ
D0P2T1_PHYIT      --------------AKDSATASSFERLDLAT------NAYLESSLKNMTLWADELAQEHY
H3H5C8_PHYRM      --------------ANDSAAASSFERLDLAT------NAYLESSLKNMTLWADELAQEHY
D0MZ23_PHYIT      --------------ANDSAPASSFERLDLAT------NAYLESSLKNMTLWADELAQEHY
B8C426_THAPS      --------LHGSYDAEGTGADTTFDRLDLST------NPYLEKHLEFLCSWVDDLAAEQY
F4P532_BATDJ      AFSFPSFQFASHLSSDAAPLTPNFDNLELSS------ETYLEKHLERMVESVEEHGQEQW
EIF3H_BOVIN       ----------------------KHELLSLAS------SNHLGKTLQLLMDRVDEMSQDIV
G1NWX2_MYOLU      ----------------------KHELLSLAS------SNHLGKTLQLLMDRVDEMSQDIV
EIF3H_HUMAN       ----------------------KHELLSLAS------SNHLGKNLQLLMDRVDEMSQDIV
F6UCC5_MACMU      ----------------------KHELLSLAS------SNHLGKNLQLLMDRVDEMSQDIV
H0WZG7_OTOGA      ----------------------KHELLSLAS------SNHLGKNLQLLMDRVDDMSQDIV
EIF3H_MOUSE       ----------------------KHELLSLAS------SNHLGKSLQLLMDRVDEMSQDII
EIF3H_RAT         ----------------------KHELLSLAS------SNHLGKNLQLLMDRVDEMSQDII
EIF3H_CHICK       ----------------------RHELLSLAS------SNHLGKSLQLLMDRVDEMSQDIV
EIF3H_TAEGU       ----------------------RHELLSLAS------SNHLGKSLQLLMDRVDEMSQDIV
EI3HA_DANRE       ----------------------KHELLNLSS------SNHLEKSLQLLMDRVDDMSQDIV
EI3HB_DANRE       ----------------------KHELLSLSS------SSHLEKSLQMLMDRVDDMSQDIV
H3DP56_TETNG      ----------------------KHELLNLSS------SNHLEKSLQLLMDRVDDMSQEIV
H3AZH6_LATCH      ----------------------RQELLNLSS------SNHLEKSLQLLMDRVDEMSQEIV
EIF3H_XENTR       ----------------------KHELLNLSS------SNHLEKSLQLLMDRVDELSQDIV
C3YQB9_BRAFL      ----------------------ESDFLSLAA------SGSLSRQLHCLMDCVDDLNQETT
B7PKD6_IXOSC      ----------------------GKQLLDMST------AFVLEKNLQAMMGCVDALNQETN
EIF3H_NEMVE       ----------------------ADQFLTLST------GSYLEKNVRVLMESVDELCQDSN
EIF3H_AEDAE       ----------------------GTHFLDLGT------ASVLENHLRCLMDRVDELNQEAN
EIF3H_ANOGA       ----------------------GTHFLDLGT------ASVLENHLRCMMDRVDELNHEAT
EIF3H_BOMMO       ----------------------GSKFLDLGT------ASVLEGQLRSLMERVDELNQEAI
E0VY38_PEDHC      ----------------------GNNFLDLGT------ASVLEGQLRAMMYRVDELNQEAI
EIF3H_DROME       ----------------------GHNFLDLGT------ATVLENQMRSLIERVDELYQEAV
EIF3H_DROPS       ----------------------GHNFLDLGT------ASVLENHMRSLIERVDELYQEAV
E9GPS9_DAPPU      ----------------------GSQYLDLGT------ASVLEKHLRSLTDNVDELLQDTN
B3S1H3_TRIAD      ----------------------PTSYLTLGT------DSHLEKSLRLLSESLDELHQEAG
EIF3H_MONBE       ----------------------IFDRMDLNA------TSFMSRNIKLLMEGIDDLSQEAY
EIF3H_CAEBR       --------------------KYSTRHFDLGS------KKSLEKSVRAMMANVDELNKSIQ
EIF3H_CAEEL       --------------------KYSTRHFDLGS------KKSLEKSVRAMMANVDELNKSIQ
EIF3H_EMENI       TSLATLESSPF---AKQTILAPNFDNLSLSI------DPFLEKNCDLLLDSIETHHTETS
EIF3H_ASPFU       SSLAALESGPF---VKSSILAPNFDNLALSI------DPFLEKNCDLLLDSIETHHTETN
C0NJF2_AJECG      PSLDALTSGPY---SSSSLLTPNFDSLSLSI------DPFLEKNCDLLLESIETHHTENN
EIF3H_PHANO       PNLAALQQDPN---TPLPPLFPNYDALDLSI------DPFLEKTCDLLLESIENHHTELN
C7YYH6_NECH7      SSLADLERDG-----VKPPLYPSIDSLDLAI------DPFLEKTCDLLLESIESHYTDLN
EIF3H_NEUCR       ASLDDIRRDP-----VQIPAHPGFESLDLSI------DPFLEKTCDLLLDSIESHYTDLN
EIF3H_SCLS1       ASLADLTRNT-----PPTPLYPNLESLDLSI------DPYLERTCDMLLDSIETHYTELN
D5GNQ2_TUBMM      NPFNPFSQPS------STPLFPNFDSLDLSI------DPFLEKNCDLLLDSIETHYTELN
EIF3H_YARLI       ----------------SPFAESSFSNLNVSV------DPFLEKNIEAIFDSVDDFHYDQG
EIF3H_SCHPO       TLTAEAALEDC---ESNLPLTETFSNFEVSL------GTRYRKNIELLLESTDEFHYEQG
D6RJQ0_COPC7      PVQDATL-------PSGSALAPSFSVLDLGT------AGT-TRNLEQIVEALESYRTEEG
EIF3H_USTMA       PSTSDLLRN-----PPSAALAPSYTSLNLAL------EPVLASSLESTLEIMDEHAAEAG
Q5ADU3_CANAL      ----------------------ELDVLNLLSN-----QNATGQLLESLSGQVDSFNYDQN
E3L0X1_PUCGT      VSNGSWGQTSTGSTCKLVDFLPSYSPLGTPSSSCADSPLSLSESLAATIASIDTHNTALS
G4V6S0_SCHMA      ----------------------ELSRSELSTN-----SSMLDLAPPLPKDHPGRYSTLNL
Q5CXR9_CRYPI      --------------------TIDYSELSINTKTP---LDINDKALLNLAESIDVLSLEQE
Q5KHC1_CRYNJ      ---------------APSLTNPSVPLPPSFAPLINPLPGSLTAYLQNTLDALTLHSHEAN
Q23AY3_TETTS      ---------------------ENQYHSSLNI------SSLLQKNAHYLNESVEQLHEANT
                                                                              

Q4UE08_THEAN      KFIRYQRDYTKLVQQQKQLLERRRLENEQCKLKGEPLLPMPEFDNTLLKKIEAPS-----
Q4N5I3_THEPA      KFIRYQRDYTKLVQQQKQLLERRRLENEQCKLKGEPLLPMPEFDNNLLKKIEAPS-----
A7ANU3_BABBO      KFFRYQRELAKLTHQHKQLVERRRLENEQGRLKGEPILPMPELDLSSLKKVEKPS-----
EIF3H_DICDI       KVYINQRNIQTQ---KTNYIQQKFLEGQ--KVDEDE--LASMI-----KPLNP-----PS
D3BJY8_POLPP      KVANYQRQYQQQQFIRNSFIQKKTLEGQ--KVEEEE--IAAHVASMVNKPLHA-----PS
EIF3H_ARATH       KFQYYYRNLSRQQAQQQAWLQKRRTENMARKSAGEEPLPEEDPSNPIFKAIPE-----PS
D7U9M6_VITVI      KFQFYYRNLSRQQGQQQAWLQKRRAENMARKTAGEDPLPEEDPANPIFKPIPE-----PS
A9THQ6_PHYPA      KFQYYYRNLSRQQVQQQTWLQKRRTENAARRAAGEEPLPEEEPNNPIFKTLPE-----PS
A9TIQ5_PHYPA      KFQYYYRNLSRQQAQQQAWLQKRRTENAARRASGEEPLPEEEPNNPVFKILPE-----PS
A8JBC8_CHLRE      KVTMYHKNVARQQQAYAVWLAKRRQENQQRQADNQEPLPEEDPN--LFKPIPE-----PS
D0P2T1_PHYIT      KFQGYERALSKQRAAYQQWQNRQREENKVRRENGEELVPEEDPT--FFKSVNQ-----PS
H3H5C8_PHYRM      KFQGYERALSKQRAAYQQWQNRQREENKVRRENGEEPVPEEDPS--FFKSVNQ-----PS
D0MZ23_PHYIT      KFQGYERALSKQRAAYQQWQNRQREENKVRRENGEELVPEEDPT--FFKSVNQ-----PS
B8C426_THAPS      KFQHYTRSLRSSVGDNRKGRKAKEEMAQAIEEG--------------WTRSEA-----PK
F4P532_BATDJ      RWQGWQRSFNKEQIRSQHHISQMNADNAAAIAAGNPPIHHEEDLKVPLSSFAKVASNEPS
EIF3H_BOVIN       KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQPPAR-----
G1NWX2_MYOLU      KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPAR-----
EIF3H_HUMAN       KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPAR-----
F6UCC5_MACMU      KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPAR-----
H0WZG7_OTOGA      KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPLQPPAR-----
EIF3H_MOUSE       KYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQAPAR-----
EIF3H_RAT         KYNTYMRNSSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQAPAR-----
EIF3H_CHICK       KYNTYLRNVSKQQQQKHQYQQRRQQENLQRQSRGEAPLPEEDINKLFKPPQPPAR-----
EIF3H_TAEGU       KYNTYLRNVSKQQQQKHQYQQRRQQENIQRQSRGEPPLPEEDINKLFKPPQPPPR-----
EI3HA_DANRE       KYNTYCRNLSKQQQQKQQYQQRRQQENAQRQSRGEPPLPEEDISKMFKAPQAPPR-----
EI3HB_DANRE       KYNNYSRSLSKQQQQKHQYVQRRQQENAQRQSRGEPPLPEEDLTKMFKPPQPPPR-----
H3DP56_TETNG      KYNTYSRNLSKQQQQKHQYLQRRQQENTQRQSRGEPLLPEEDISKMFKPPQPPPR-----
H3AZH6_LATCH      KYNTYSRNLSKQQQQKHQYQQRRQQENAQRQSRGEPPLPEEDLTKLFKPPLPPPR-----
EIF3H_XENTR       KYNTYLRNISKQQQQKHQYTQRRQQENLQRQSRGETSLPEEDVNKLFKPPVPPSR-----
C3YQB9_BRAFL      KFNNYQRNLAKQAQAKNQYLQKRQLENAARQAKGEPPLPEEDVTKIFKPIAPPPR-----
B7PKD6_IXOSC      KFINYQRQVMRQQQQKAQFLQKRAQENSTRIQKGEPPLPEEDINKLFKPIPAPSR-----
EIF3H_NEMVE       KYHNYQRSVIRQQQQKENYLQRRQQENQSRIQRGEDPLPDEDLSKMFKPLPVPSR-----
EIF3H_AEDAE       KFNKYQQTVIRQEQDKHRMLAKHAQENAARIAKGEAAIPDEEVQKLFRPLPVPSR-----
EIF3H_ANOGA       KFNKYQQAAIRQEQEKHRMLAKHAQENAARIAKGEQAVPEEEVNKLFRPIPVPTR-----
EIF3H_BOMMO       KFNRYQQLVVRQQQDKHRWMVKRAQENAARAAKDETPLPEEDVNKLFKPHPVPPR-----
E0VY38_PEDHC      KFNRFQQQVIRQQQDKHRLLQKRAVENSARQAKDEPLLPEDDINKMFRPIPTPPR-----
EIF3H_DROME       RYNKYQQVVFKQDTEKHRALAKLAAENAVRTSKGEPTVPEEEVIKQFRPMTAPNR-----
EIF3H_DROPS       RYNKYQQVVFKQDSDKNRALAKLAAENAVRTSKGEPTVAEEEVIKQFRPMPVPAR-----
E9GPS9_DAPPU      KFNIYQRQVVKQQQEKQKYVQKRNLENTARQARGEAALPEEDVTKVFKPIPVPPR-----
B3S1H3_TRIAD      KLSVYHKTLRMHHQKQQSLLKKRGDNAKAR---------DDDDSKQNRPPPAPYR-----
EIF3H_MONBE       KFQQYHRNATKAKASLDAQLEARRAENEQLRAKGLPEKSEAELVANHKTPTPPSR-----
EIF3H_CAEBR       SLTKYTIDKQRHDNMVFSLTQKRQQENESRLARGDPPLPMDDIKRIKAPQLQTRNG----
EIF3H_CAEEL       SLTKYTIDKQRHDNMVFSLTQKRQQENESRVARGDPTIPMDDIKRIKAPQLQTRNG----
EIF3H_EMENI       NFQYYQRSLAREQAKITAWQAKRKAENATRATLKQPPLPEDEWQRLFKLPQEPSR-----
EIF3H_ASPFU       NFQYYQRSLAREQQRISAWQQKRKQENATRAALKQPLLPEDEWQRLFKLPQEPSR-----
C0NJF2_AJECG      NFQFYQRSLAREQAKIAQWQAKRKAENATRTQLKQPLLPEDEWQRLFKLPQEPSR-----
EIF3H_PHANO       NYQYYQRQLAREQTKITAWQQKRKAENAARTASKQPLLPEDEWQRLFKLPAEPSR-----
C7YYH6_NECH7      NFQFYQRQLGREQAKITQWQTKRKAENAQRAAAKQTLLPEDEWQRLFKLPQEPSR-----
EIF3H_NEUCR       NHQYYQRQLTREQFKITQWQAKRKAENAARLAAKQSPLPEDEWQRLFKLPQEPSR-----
EIF3H_SCLS1       NFQYFQRQLTREQAKVTAWKTKRAAENASRATQKLAPLPEDEWERLFKLPTEPSR-----
D5GNQ2_TUBMM      NSQYYQRQLAREQTKIAAWLTKRKQENILRAAAKQPLLPENEWTRLFKPPVEPSR-----
EIF3H_YARLI       NYNYYQRQMTREQAKITQWQQKRKAENAAREKDGRPALPTDEWKRLFKLPTEPSR-----
EIF3H_SCHPO       NLGFHQRQLAREQAKIQQWIAKRKAENANRAAENLQPLPLDDWKRIFKLPAEPRL-----
D6RJQ0_COPC7      NLSYLSRQIARERAKAEAYIAKRKEENQVRIAQGLAPLPEEDVSRMFKIPPEPSR-----
EIF3H_USTMA       NVGFQARQLAREKAKADAYLARKKAENAAREAQGLAPLPIEDVNRLFKIPAEPSR-----
Q5ADU3_CANAL      NFNYYQRQYQKEQSKIQQWKQQRKLENLERAKKGEKELDTEEWKTIFKLPNEPSR-----
E3L0X1_PUCGT      TLSFQIRQLARDRARLESVINKRKAENETRAQQGLPPLPPSAEEASLKEPSR--------
G4V6S0_SCHMA      SMASSLEQQLRSLLAGLETVHDYQYSYQRSLSKSQATVAGKTATETRNRELAPIR-----
Q5CXR9_CRYPI      KLYKGYRDYNKQQYLIKQMAERRRIENEQRKLKGETPLPIDTESIKKVDPPNP-------
Q5KHC1_CRYNJ      NIAFLTRQIAREKTKHEQAIRDREEENARRRKMGLSEFPSIPQEIRGGTKEPSR------
Q23AY3_TETTS      NMNLEFMKKSKESKYEKDIDPLNW------------------------------------
                                                                              

Q4UE08_THEAN      QLSTIIMSNECTTHTKDINSLCFDNIAKMYLLYHRLHSKQ--------------------
Q4N5I3_THEPA      QLSTIIMSNECTTHTKDINSLCFDNIAKMYLLYHRLHDKQNLFIFEPNINKFSPRSKDHF
A7ANU3_BABBO      QLSTIVMSNECTTHTKDVSALCFDNIAKMSLLFHRLSTNSEHR-----------------
EIF3H_DICDI       KLTSLLLTNQINNYTDQIHSFSGNSLTKLSLLKDLQK-----------------------
D3BJY8_POLPP      KVTSLLLTNQINNYCDQLSSFCGGSLTKLSLYRELTNK----------------------
EIF3H_ARATH       RLESFLITNQVSNFCGQINGVAGQNFSRLYLTKALHDN----------------------
D7U9M6_VITVI      RLDSFLITNQISNYCNQINGVAGQSFSRLYLMKALHEN----------------------
A9THQ6_PHYPA      RLDSYLITNQISNYCSQVNGFAAQSFSKLYLMDAFHDE----------------------
A9TIQ5_PHYPA      RLDSYLITNQISNYCSQVNGFAGQSLSKLYLMDAFHED----------------------
A8JBC8_CHLRE      MLDNYLVTNQIATYCDQVNVAAGETIQKLFLMEGMQKAGL--------------------
D0P2T1_PHYIT      RLESLLITKQMSTYCEHINRYAGKSFQKLFLAAKIHQNE---------------------
H3H5C8_PHYRM      RLESLLITKQMNTYCEHINRYAGKSFQKLFLAAKIHQKE---------------------
D0MZ23_PHYIT      RLESLLITKQMSTYCEHINRYAGKSFQKLFLAAKIHQNE---------------------
B8C426_THAPS      RMESLLMSNQIRTYCDQVEKFTGDGFGKLFLTSGLHTEEGEKKKAAA-------------
F4P532_BATDJ      RLETLIISNQLDTYCKQINQFAGPTLTKMFVAKSFQPQK---------------------
EIF3H_BOVIN       -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNS--------------------
G1NWX2_MYOLU      -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNS--------------------
EIF3H_HUMAN       -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN--------------------
F6UCC5_MACMU      -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN--------------------
H0WZG7_OTOGA      -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN--------------------
EIF3H_MOUSE       -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN--------------------
EIF3H_RAT         -MDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYSN--------------------
EIF3H_CHICK       -MESLLIAGQINTYCQNIKEFNAQNLGKLFMAQALQDYNN--------------------
EIF3H_TAEGU       -MESLLIAGQINTYCQNIKEFNAQNLGKLFMAQALQDYNN--------------------
EI3HA_DANRE       -MDTLLIAGQINNYCQNIKEFTSQNLGKLFMAEALQSNSS--------------------
EI3HB_DANRE       -MDTLLIASQINTYCQTIKEFTSQNLGKLFMAEALQGPSS--------------------
H3DP56_TETNG      -MDTLLIAGQVNNYCQNVKEFTSQNLGKLFMVEALQGHN---------------------
H3AZH6_LATCH      -MDSLLIAGQINTYCNNIKEFTSQNLGKLFMAEALQDHTS--------------------
EIF3H_XENTR       -MDSLLIAGQINTYIQHIKEFTSQNLGKLFMAEAMQDPTI--------------------
C3YQB9_BRAFL      -LDALLLSGQLASYCKQITDYAAHSFGKVFMAKALQEDTQGSAAQPPSL-----------
B7PKD6_IXOSC      -LESVLHCGQVNSYCQQVAQFSTQNLGKLFMAEALQLEHKPSGLLS--------------
EIF3H_NEMVE       -LDNLLLSEQVNTYCQHVHQFSTQSFGKFFLAQALQDKKE--------------------
EIF3H_AEDAE       -LNPMIVSGQINTYAQHISQFCSQSLAKLYMTQALQGAKENKQ-----------------
EIF3H_ANOGA       -LNPMIVSGQINTYAQHISQFCSQSLAKLYMTQALQNAKDNKQ-----------------
EIF3H_BOMMO       -LNPMIVAGQIDTYSQHISQFCSQSLAKLYLTQALQNAKEAKQNN---------------
E0VY38_PEDHC      -LNPMIVSGQVNAYGQAITQFCAQSLAKLYVTQALQNAKEGKFLIEKKDRERIQDFVF--
EIF3H_DROME       -LTATITSGQINTHAQHIAQFCSQSLAKLFITESLQIAKEAKETK---------------
EIF3H_DROPS       -LTATITSGQINTHSQHIAQFCSQSLAKLFITESLQNAKEAKEIK---------------
E9GPS9_DAPPU      -LEPMVLSAQIAAHCQQVSLFCSQALGKLFLSEALQQPQSSQQQTVLKGSSKTTQ-----
B3S1H3_TRIAD      -LDNLLVANQTNKFCQELNQYVSQSFSKLFLAEALENNES--------------------
EIF3H_MONBE       -LGSLLVTAQINTFCKQVSDFSGQSFGKLYIAKATQPEAEE-------------------
EIF3H_CAEBR       LLDELLASFDTNALADFSKTVTSENITKLFIAEAVAEEKVVGTKDRTLSSVSSTR-----
EIF3H_CAEEL       LLDELLASFDTNALADFSKTVTSENITKMFIAEAVAEEKVAGTKDRTLSSVSSTR-----
EIF3H_EMENI       -LDSMLNSRQVEQYARQIDSFVSSTTGKMFAVKGNLLPSEIAK-----------------
EIF3H_ASPFU       -LESMLNSRQVDQYARQIDSFVSSTTGKMFAVKGNLLPGETAK-----------------
C0NJF2_AJECG      -LETLLNTRQVEQYSRQIDGFVAATTGKMFAVKGNLLPGESQV-----------------
EIF3H_PHANO       -LETLLNSRQVEQYSRQVDGFAAGVTSKMFAVKSNLLPGE--------------------
C7YYH6_NECH7      -LEGMLNAKQVEQYSKQVDGFTANVSAKMFAVRENLLPK---------------------
EIF3H_NEUCR       -LEGMLNARQVDQYARQVDAFTANITAKMFAVRGNLLPE---------------------
EIF3H_SCLS1       -LEGMLNARQVDQYSRQVDGFTASITGKMFAVKSNLLPEQS-------------------
D5GNQ2_TUBMM      -LETLLNSRQIEQYAKQVDGFTASVTAKMFAVNGGLSKTQEQLQL---------------
EIF3H_YARLI       -QDNLLISAQLNEHCSVIEEFGAAVNSKLFATQGGLL-----------------------
EIF3H_SCHPO       -LDSLLISSQIMK-STQIDEQSSAFLSKLAGVRNAYAS----------------------
D6RJQ0_COPC7      -LESLLLLGQIDGYAKNLESTASMGLVKMYGAKAGSA-----------------------
EIF3H_USTMA       -LEATLLLGQIDSSARRLAETAALGVIQLNAAKTGAV-----------------------
Q5ADU3_CANAL      -YNNMLYSSAIDVLADDILKKCDEELTKSFAIERKLTASE--------------------
E3L0X1_PUCGT      -LESMCALSGVDSAAKKLTESSGLNVVRAFGAKAGVAN----------------------
G4V6S0_SCHMA      -LDTALVSAQLDFYCNSLAQMAGQTIGKLMLTQAVQKTSSSGAPKSQKI-----------
Q5CXR9_CRYPI      -LPVILVSKYVESQCNEINFNSKESLTKVLIRNIKNDM----------------------
Q5KHC1_CRYNJ      -LEMVCLGGTVEGIAKGMAAEAGKGLVRAYL-----------------------------
Q23AY3_TETTS      -IDNLLLLERVHTLADNINDQSKFVSESTSALKHIS------------------------