CLUSTAL format seed alignment for MF_03009

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EIF3J_YEAST           ----------------MSWDDEAIN--------GSMGN-DDAVLMDSWDAEIGDDEPVMQ
C5DQS6_ZYGRC          ----------------MSWDEDVIG--------GSATNGDDAVLMESWEDGL-DDEPVLD
W1QKP4_OGAPD          ----------------MSWDDEDFE-------YPTASN---AQVSESWEDQLEDDEPVLD
EIF3J_CANAL           ----------------MSWDDEDFD--------IPSNS--KKTVAASWEDEE-DDGPVLE
EIF3J_EMENI           -------------MPPSKWDEEEE-----EGVSPPP-----VAARRRFDDEE-D-GDVLD
EIF3J_ASPFU           -------------MAPSKWDDEED-----SSPPPPPP----VVARRKFDDEE-E-EDVLD
C0NAA8_AJECG          -------------MAPSKWDDEEE-----STPPSSPPLVSTTTQRRKFDDEE-DSDDVVD
Q0UWF4_PHANO          -------------MAPGKWDDEEE-----DSTPPSSPVNKPIARRSKFDDEE-DDSDVLE
EIF3J_NEUCR           -------------MSGKKWDEEE------EESSAPN-SPVLAPGRRRFDDEEGNESDVLD
A7EFI2_SCLS1          --------------MPDKWDEESSS----EESSDPTPAQAAASTRRKFDDEE-DDDEVLD
C7YJZ3_NECH7          -------------MPPKKWDDEESDDSSSSSSPAAAAAAAAVAARRKFDDEEDDSDASLD
D5GKJ7_TUBMM          ------------MAPPKKWSGEEES---SSGEEGVGPIAPRVAIKKKWDDED-SEEKVLD
EIF3J_DICDI           ---------------MSDWSDLQKD----KWINEN---------------REV--EEV-D
F1A0Q3_DICPU          ---------------MSDWSELNKE----QWAEEG---------------RAV--DDLKD
D3AWC8_POLPP          ---------------MSAWDADDYD--DSRWANEK---------------VGVDDDDVAE
Q9C8D8_ARATH          ---------------MDDWEDEKIA--PLPAKVE---LK------SNWDDEDVDENEIKD
Q8GRX2_ARATH          ---------------MDDWEAEDFQ--PLPSKVE---LK------SNWDDEDVDENDIKD
D7U206_VITVI          ---------------MEDWEDEPIT--PLGKKEE---PK------NKWDDEDLDDDNVKE
C5XT21_SORBI          ---------------MEDWDSEDFQ--PVAPVVKAEPLK------NQWADEDVEEDDVKE
A9TBZ8_PHYPA          --------------MDDDWDAEDFT--PLPPVLAK------------------EATQVKS
A9S6K9_PHYPA          --------------MDDEWDADDFV--PLPPVSAK------------------DEPKTTS
A0A2I3HVU7_NOMLE      ----MAAAAAAAAGDSDSWDADAFS--VEDPVRKVGGGG--TAGGDRWEGEDEDED-VKD
EIF3J_PONAB           ----MAAAAAAAAGDSDSWDADAFS--VEDPVRKVGGGG--TAGGDRWEGEDEDED-VKD
EIF3J_HUMAN           -----MAAAAAAAGDSDSWDADAFS--VEDPVRKVGGGG--TAGGDRWEGEDEDED-VKD
EIF3J_BOVIN           -------MAAAAAGDSDSWDADTFS--VEDPVRKVGGGG--TAGGDRWEGEDEDED-VKD
EI3JA_MOUSE           --MAAAAAAAAAAGDSDSWDADTFS--MEDPVRKVAGGG--TAGGDRWEGEDEDED-VKD
EI3JB_MOUSE           MAAAAAAAAAAAAGDSDSWDADTFS--MEDPVRKVAGGG--TAGGDRWEGEDEDED-VKD
EIF3J_RAT             ----MAAAAAAAAGDSDSWDADTFS--MEDPVRKVAGGG--TAGGDRWEGEDEDED-VKD
EIF3J_CHICK           -----------MAAEADSWDADTFE--VVEPVAKRLVPA--GVAGDRWAGEDEEDD-VKD
EIF3J_XENTR           ------------MAENDSWDADDFE--PEVSNQKGAVSGPPPAGRDRWEGEDEEED-VKD
EI3JA_DANRE           ------------MADADSWDADSFE--PEEPIKKAAVH-------DKWEGEDEDDD-VKD
EI3JB_DANRE           ------------MADSDEWDADNFE--PNEPIKIATAGR-----LDRWEGEDEEED-VKD
EIF3J_NEMVE           ------------MAD---WDDEKFE--PGE----VPADG----VTDKWEGEDEDDD-IKE
EIF3J_AEDAE           --------------MEEDWEQL-----SEQEKVPIPAKK---PDVNKWDGEDEEEE-VKD
EIF3J_ANOGA           --------------MEDDWEAL-----AEQKAEQLFAK----ADVNKWAGEDEDD--VKD
EIF3J_BOMMO           --------------MDVSWD-------ADNFEPKLPTTL---AASNKWEGEDEDDN-VKE
E0VQW2_PEDHC          --------------MDVEWDAENFE--PPNLKQSNAISL---AAGYKWEGEDEDDD-VKD
EIF3J_DROME           --------------MADDWESA-----ADSEVVIRPTAA---ASVNKWEGEDEDED-IKD
EIF3J_DROPS           --------------MADDWESA-----ADSEIILQ-NAA---STVNKWEGEDDDDD-VKE
E9GGI0_DAPPU          ------------MEAEADWDAE--D--FEPSVPVPVTTA---IISDKWEGEDEDEP-VKD
B3RRU4_TRIAD          ---------------MSNWDDEDFE--PPKAVTKNEWDD----------EDADNDN-VKD
A8P4D5_COPC7          -------------MADWDASSDEEV--KAKSVPAPKPIV-PVRVAKKWEGEDEDDK-PAS
Q5KGC7_CRYNJ          -------------MSDDDWDADETI--APAAPAVTLP---PKVPAKKWADEDAEDNDSDD
E3JV36_PUCGT          ---------------MSDWEASDHE--EAANAGISVAAGVSAIKKNKWADEDADED-VKD
A0A0D1DWZ4_USTMA      ---------------MSDWENDDEPQQPVAPPKLSAAGR------KKFDDEDVEDE-VKD
EIF3J_YARLI           ---------------MASWDDEDFEVPAAATPAVPANWD------------DDEEEDVMD
G4VEX2_SCHMA          ---------------MGDWDDEDES--------------DFVAKQVKVDWDDEEDNAVPD
F4NYS5_BATDJ          --------------MSGNWDDSEED---VVSTPIAVP--------GKWDDEDVEDN-VKD
H3GX76_PHYRM          ---------------MDSWDDDEFE-----------------------VPSVTETQQVAA
A2D9N1_TRIVA          ----------------MLLDADDLDLSGSGSGSENEDKSEDNAWDAPAAVPTKKEEPVFE
EIF3J_SCHPO           ---------------MDSWEDFLVEDPAKPAEFDFPLGK-----------DSQSSSKPKK
                                                                                  

EIF3J_YEAST           SWDAEE----------EEKKP------APKPKKEQPKKVKKGKES--SADRAL-------
C5DQS6_ZYGRC          SWDKDEG---------EEKKPQASSESAKKTAAASNKKKNGGKKEKESSEPPK-------
W1QKP4_OGAPD          SWDMDSD---------DEKAKQEK-KPAPKAAPKAAKPVKAGKKK--TADKKL-------
EIF3J_CANAL           SWDVDPEE--------EEKKKKEAKLQEAKRKAELKAKEDAEKAKKDAKRKEL-------
EIF3J_EMENI           SWDAAD--------DSEVEREKAAKAAEAKAKAEAEAAANKKSKAQRIAEHK----TRRK
EIF3J_ASPFU           SWDAAE--------DSEVEREKAAKAAAAAAKAEAEAAAKKKSKAQRIEERK----QERK
C0NAA8_AJECG          DWEAAE--------DSEVEREKAAKAAAAKAKAEAEAAANKKSKTQRIQERKE---QRRH
Q0UWF4_PHANO          SWDAAE--------DSEVEREKAKKAADAKAKAEAEAKANKKSKAQRIEEHRE---ANRL
EIF3J_NEUCR           SWDAAE--------DSEVEREKAKKAAEAKAKAEAEAAANKKSKAQRIAERQ----AERA
A7EFI2_SCLS1          SWSAAE--------DSEVEREKAKVEAERKAKADALAAANKKSKKERVAEKQ----AERA
C7YJZ3_NECH7          MMPRALWRLARLTRPSSPEREKERKAAEAKAKAAEAAAAAKKPKGQRIAEHQ----ADRA
D5GKJ7_TUBMM          SWDAED---------SEEERKKARAKQAAAENAAAEAAANKKSKAQRIAERQAQNAAQRE
EIF3J_DICDI           AWDASS--EDEVEKVEEEIKE---PPKPVVKQLTKKQALQRAIELKEKELK---------
F1A0Q3_DICPU          AWDD----EEEVEEVEEEKVEEKKPEKPAVKQLTKKEALKKAIELKEKEEK---------
D3AWC8_POLPP          AWDAE---EEDTPKTETPASQ---PSKPAPKS---KQTLKKLIEAREKAEA---------
Q9C8D8_ARATH          SWEDDDD-EPAQPPVINPAPE----KAPKKAAPKTVEKKGKAVEVPKEAPK---------
Q8GRX2_ARATH          SWEEED--VSAPPPIVKPASE----KAPKKPAVKAVEKKVKTVEAPKGTSR---------
D7U206_VITVI          SWEDED--EPAPAPVIQPPAE----KPPKKPVEKATEKKGKAVEAVTEVT----------
C5XT21_SORBI          SWEEEEEEKPKPAPVEKAAAK----PSTKAPAKKGKQQASTSAAEPDEPP----------
A9TBZ8_PHYPA          QWDDED-AEEEPVEE-KPKVV----AVPKPKAEKKKEKPKKATSDEGVLS----------
A9S6K9_PHYPA          QWDDED-VEDELKEEAKPEPV----IAPKP-----KKKFKKNIDDEGDLS----------
A0A2I3HVU7_NOMLE      NWDDDDDEK---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EIF3J_PONAB           NWDDDDDEK---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EIF3J_HUMAN           NWDDDDDEK---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EIF3J_BOVIN           NWDDDDDEK---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EI3JA_MOUSE           NWDDDDDEN---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EI3JB_MOUSE           NWDDDDDEN---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EIF3J_RAT             NWDDDDDEN---KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKR---------
EIF3J_CHICK           NWDDEEEEEE--VKEAEVKQEPKVSEKKKIAEKIKEKEKQQKKKQEELKKR---------
EIF3J_XENTR           NWDDEEEAEAATKQEAQKTVEPKVSEKKKLLEKIREKEKLHKKRQEEVNQQ---------
EI3JA_DANRE           NWDDDEEEEKEEE--EEKKTEAKPTEKKKLSEKIKEKENLQRKKQEELRKQQ--------
EI3JB_DANRE           NWDDEEEEKEEEKKVEQKIAEVKPPEKKKLSDKIKEKELLQKKKQEELKKN---------
EIF3J_NEMVE           SWDDDDEDEK--KEDEAKNTEAAAPKKKKTLKQILKEKEEQKLLEEKRKAEEK-------
EIF3J_AEDAE           SWEDEDELEEKKDEE---KVET---PKAKPKKTLQQKIADKEKLKQE-EAERR-------
EIF3J_ANOGA           NWEDDDEEEEKKDAP---KQED---TPTKNAKP--KKAAQQKKLKKE-DLERL-------
EIF3J_BOMMO           SWED--EEEEKKDEE---KTEAAPPPQPKPKKKIHDKIAERERQERE-KAERL-------
E0VQW2_PEDHC          NWED--EEEEKKDEE---KQEEVKAIQVKRKKKIAEKIEEKERKDRE-EAARK-------
EIF3J_DROME           SWED---EEEKKDEE--KPTKTEAPAKPKPNKALKAKLEQQALLEEE-AEAKR-------
EIF3J_DROPS           SWED---EEEKKDEENEKPTITDVPVKTKPSKALKAKLEEQARLEEE-KEAKR-------
E9GGI0_DAPPU          SWED--EETENKPAE---VKAAAAATKKKSSKRLEEKIAEKEKKSRE-EAEAR-------
B3RRU4_TRIAD          NWDDEEEQKAKNDSAETKTTATAPPKKKK---SLKERIAEKEKERMERRKA---------
A8P4D5_COPC7          DWEDSSSEE--------EEVKPAVVAPPKKKGTLKAKLAEKEAMKAQKAANGE-------
Q5KGC7_CRYNJ          DWDKSEDEKP-------QATKVAAVAPAKKKGTLKQKLAEKERLAKEAKEKG--------
E3JV36_PUCGT          DWEASE-----------SEDEKSKNEPAKPKGPVRNKGITKMKIAEKEAEEAL-------
A0A0D1DWZ4_USTMA      DWEEED--------SEPEAAKTPVVLPPRKKKSVKQKIAEKEEEERLRREQG-------L
EIF3J_YARLI           SWDAEE----------PTKAPGPKTTVAAPKKAQRQQIAKIEREMAAMKLK---------
G4VEX2_SCHMA          SWDAEP-------PKDSVTSKPAAPAKLSLSERLKLKEEQKRKGKEEKLRRE--------
F4NYS5_BATDJ          SWDASDDEKETLAKTVAATVKPTTVAPVKVNKKKALAQKIAERKEEERRKTQE-------
H3GX76_PHYRM          NWDDEEEEEE--KPIVAAKSEPAAPKGPLKPKQLKKMKLKEIEEKQKMEIALT-------
A2D9N1_TRIVA          SWEDAPDYEELERQKKEAEERAAREKQEAIEAEKRRKEEKKAFREAAKARLME-------
EIF3J_SCHPO           RFDDEEDEDEEENKESLQNDSHSVSQKSSSSSQNDQGSNKMTRIQQKIQERN-------F
                                                                                  

EIF3J_YEAST           --------LDIDTLDEKTRKELIKKAEMESDLNNAADLFAGLGVA----------EEHPR
C5DQS6_ZYGRC          --------LAIDELDPKTRQELMKKAELESDLKNASDLLGELELA----------GEHPR
W1QKP4_OGAPD          --------LDIDLVDEKTKKEMLKEAELNSDLNNAADLFGGLGVA----------NEHPR
EIF3J_CANAL           --------EQFDQLDERTRKELLKKAELNADLNNAADLFGGLGVADDNDDDDFDINEHPR
EIF3J_EMENI           --AAEDEEDDESDEDEAEKRARLRRTEKDSDLKHAEDLFGDIDLN---------------
EIF3J_ASPFU           KLAEANESDEDSEEDEAARRARLRRTEKEGDLKHAQDLFEDIDLN---------------
C0NAA8_AJECG          EQLSSDDDDDDDDEDEAAVRARLRRTEKDADLAHAQDLIGDIDLN---------------
Q0UWF4_PHANO          RRETGDFDSDE-DETEEERRIRLRQQEIDGSRAQAEELFGDLALS---------------
EIF3J_NEUCR           RQLAED--SDAEEETEAERRERLRREQKESDLKHAEDLFAGIGIS---------------
A7EFI2_SCLS1          RQLAEN--SDESSEDEATRRERLRRTEQESDLKHAEDLFGNIGIN---------------
C7YJZ3_NECH7          KQKANAASVQVVEETEAEKRERLRRTEQEADLAHAADMFGDIGIS---------------
D5GKJ7_TUBMM          ATAAARESSNMEDETPAERRVREEQMRIEGDLAHATDLFGTVGVG---------------
EIF3J_DICDI           ----E----PQGDFDIYLEEKRKKELQEASDLENSKNLFSGLSVK---------------
F1A0Q3_DICPU          ----ESRNNPASEFDIYMEEKRRKELQEAADLENSRTLFSGVSVR---------------
D3AWC8_POLPP          ----T--EGEVHEMDPYLEKKRKQELQEAADLENSRTLFGNLAVA---------------
Q9C8D8_ARATH          ----E------KPLDPIAEKLRQQRLVEEADYRATAELFGVKD-----------------
Q8GRX2_ARATH          ----E------EPLDPIAEKLRMQRLVEEADYQSTAELFGVKT-----------------
D7U206_VITVI          -------------LDPVAEKIRQQRLIEEADYKSTTELFAKRG-----------------
C5XT21_SORBI          -------------LSPTSEKIRQQRLVEEADFKSTTELFAKKGG----------------
A9TBZ8_PHYPA          --------------DPLAEKLRQQRLVEEADYQNTSELFGGKTR----------------
A9S6K9_PHYPA          --------------DPIAEKLRQQRLVEEADYQNTSELFGDKSR----------------
A0A2I3HVU7_NOMLE      -LEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_PONAB           -LEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_HUMAN           -LEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_BOVIN           -LEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EI3JA_MOUSE           -LEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EI3JB_MOUSE           -LEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_RAT             -LEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_CHICK           -LEAPEEHKELTPEEQLADKLRLKKLQEESDLELAKETFGV-------------------
EIF3J_XENTR           -EKE-GTAPELSPEEQLAEKLRLKKLQEDSDLELAKEAFGD-------------------
EI3JA_DANRE           -LEETKRDTPLTPEDELAEKLRVKQLQEDSDLELAKEAFGV-------------------
EI3JB_DANRE           --QETAASESLTLEEQLAEKARLKKLQEEADMELAREAFGVDPAAA--------------
EIF3J_NEMVE           -QKLEEEDKELTPEEQMAEKLRRQKIVEESDLLVAMDTFGVG------------------
EIF3J_AEDAE           -RLEKEE-EDMTPEQKLAEKLRLQKLQEESDLKNALDTFGVT------------------
EIF3J_ANOGA           -QREEEEFANMTPEQQLAEKRRLQKLQEENDLKTAMETLGIT------------------
EIF3J_BOMMO           -VTEKTA-EEMTPEQKLAEKLRQQKLQEESDLRLAMETFGVT------------------
E0VQW2_PEDHC          -LAAKEAMKKLTAEEKLAEKLRQQRLQEEADLQVTKETFGII------------------
EIF3J_DROME           -L------ANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVT------------------
EIF3J_DROPS           -L------ASLTPEEKLAEKLRLQKIQEDSDLNHALDTFGVTR-----------------
E9GGI0_DAPPU          -KILQE--ANMTPEERIAEKLRRQKLVEESDFEMAKETFGITG-----------------
B3RRU4_TRIAD          ---AQEAAKELTEEEKTAKKLEDQQAVEDADMENIQDTFGIN------------------
A8P4D5_COPC7          -FDYDSDDVLDPREK--ARR--DKEKELKADLNNAADLLGAAALG---------------
Q5KGC7_CRYNJ          -VDDDNDLMYTMTEQ--ERRRLAREKEQEADLAVASDLMGAVDLG---------------
E3JV36_PUCGT          -RLAEQEALAQQAADPVLRKKLEQTRTIQSDMENARGLFGDAVVS---------------
A0A0D1DWZ4_USTMA      DTDEEEEEEEDWDADPIAKRRMEREAQLKSDVENAANLLGTAKLS---------------
EIF3J_YARLI           ------------PEDASTKRDRQRQAELDSDMMNASELFGGTGGI---------------
G4VEX2_SCHMA          ---------EELRLSQPVTELQREKLAEEAELGLLKDTFGPSTVQ---------------
F4NYS5_BATDJ          --SSNPTNDVVSAESDQQRKELLARSVRESDLENARALLGDLALT---------------
H3GX76_PHYRM          ----KARLAAQAEETDDQRRAREKASIEEADFEMAIDAFAGAPPK---------------
A2D9N1_TRIVA          --------SSSDDEGGLFDIEAAHEQEKHQDFAVAMDMLGATNEK---------------
EIF3J_SCHPO           EKAIKASEAAAKEESLESSKEAMRQAEIDSDLANAMDLFDIVDKN---------------
                                                    .       :                     

EIF3J_YEAST           ARALQKEQEEQALKRPA--FTKDTPIETHPLFN-AETKREYQDLRKALTAAITPMNKKSP
C5DQS6_ZYGRC          AQAAKRKEEEDLFAKLATPLTKDTPIGDHPLFQQAETKKDYQELRKSLATAITPLNEKSS
W1QKP4_OGAPD          AKAL---AAEQASKASTPKLDKNTPISAHPLFE-VETKQDFERLRKAISPALTDLAKKSQ
EIF3J_CANAL           ERITKQQLAAAAASKRP-ALTKDTPLEEHPLFQ-PTNKQEYEKLRKTVGTSLTRLNEDSS
EIF3J_EMENI           -RNRGK-NKTIVVHDASGDPTQAVDLSAMPLFK-PATKEQFTTLSNTLVPLLTAQSKKP-
EIF3J_ASPFU           -RNRGT-PKAIVISDSA-DPTQAVDLSAMPLFK-PTTKDQFTRLTSTLIPLLTAHSKKP-
C0NAA8_AJECG          -RTRSTIPKAAVVIGDKSDPTKSIDLSAIPLFK-PGTKTQFAELTDALIPLLTAQSKKP-
Q0UWF4_PHANO          -NKRAG--KAVTITDES-DPTKAIDLSSLHIFN-PNTKNQFTKLRETLTPLLAQNAKKG-
EIF3J_NEUCR           -NDRKVVSKGTIVQIDPKDPNNTIDISTLALFN-PTTKTQFETLRTTLGPMIGKLSPKP-
A7EFI2_SCLS1          -S-RKSTSAANAVQVDEKNPAATVDLTTLPLFD-PRTKPQFEKLRETLVPLITNNVKKA-
C7YJZ3_NECH7          -AGRAK-TRTAAVIVDSADPTNTVDISKLPLFQ-PQTKAQFENLRTVLGPILSANAKNP-
D5GKJ7_TUBMM          -AGSGGTKGKPITTGDPEDPTKSIDLSSLPLFA-PKGKDEFTRLREVLVPLLVANSKKA-
EIF3J_DICDI           ---------------------ESSSGEPISTFI-PKTEKDFEQYSQIVSDYLLKYDSS--
F1A0Q3_DICPU          ---------------------ETTPSEPIGSFV-PKTEKEFEKYADIVSDYLTKYDSS--
D3AWC8_POLPP          ---------------------KDTTQSPLDTMD-PKTEKEFEQYAASVSTYITKHEKS--
Q9C8D8_ARATH          ------------------------DDKNLDMFI-PKSESDFLEYAEMISHRIKPYEKS--
Q8GRX2_ARATH          ------------------------EEKSVDMLI-PKSESDFLDYAELISQRLVPFEKS--
D7U206_VITVI          ------------------------DEKTLDSFI-PKSESDFVEYAELISHKLRSYEKS--
C5XT21_SORBI          ------------------------EQKSLDTFI-PKSESDFAEYAELIANKLRPYEKS--
A9TBZ8_PHYPA          ------------------------GGRSLEDFI-PKSEDDFLEYAELLAQKIRPFEKS--
A9S6K9_PHYPA          ------------------------TGHSLEYFI-PKSEEDFLDYAELIAQKIRPFEKS--
A0A2I3HVU7_NOMLE      ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EIF3J_PONAB           ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EIF3J_HUMAN           ----------------------NNAVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EIF3J_BOVIN           ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EI3JA_MOUSE           ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EI3JB_MOUSE           ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EIF3J_RAT             ----------------------NNTVYGIDAMN-PSSRDDFTEFGKLLKDKITQYEKS--
EIF3J_CHICK           ----------------------NNAC-GIDAMN-PSSKDDFTEFGKLLKEKITQYEKS--
EIF3J_XENTR           ----------------------NVTVTGIDAMN-PSSREDFTEFGKLLKEKITQYERS--
EI3JA_DANRE           ---------------------VSNNVTGIDAVS-PSSKDDFTEFERLLKEKISPYEKS--
EI3JB_DANRE           ---------------NASTTVNTTNASGIEAMC-PSSKDDFVTFEKLLKEKITQFEKS--
EIF3J_NEMVE           -------------------TQEEASRTGLDSMI-PSTKEEFTEYSKLLVEKLTKFETN--
EIF3J_AEDAE           ---------------------SIV--GGIDGMH-PTNKEEFIELSDAICKKLSNYKND--
EIF3J_ANOGA           ---------------------PMSTGNGIDGMH-PTTKEEFTELAEAISKKLANYRAS--
EIF3J_BOMMO           ---------------------EGNI-GKLDNFH-PTTKEEYTEFADLLTKKITFYKAK--
E0VQW2_PEDHC          ---------------------ETS--ESIDSMN-PKTQEEFNHFSEALMKKLMPLSTS--
EIF3J_DROME           -----------------------STCGGLDAFN-PETKEEFKEFGATLSWKVGQFRES--
EIF3J_DROPS           ---------------------AETNGNGLDSFN-PETKEQFKEFGSALSWKVGQYRES--
E9GGI0_DAPPU          ---------------------SLPTEGSIDEAN-PLSKEEFSEFKNNLVKKLQSLSTK--
B3RRU4_TRIAD          -------------------------KKNIYNMN-PKTTSEFSEFAEAIVERLTIHEKS--
A8P4D5_COPC7          -------------------GTSSSELDSIISAQ-PRTKEDFQKLSTQIYEYIIKRHSTK-
Q5KGC7_CRYNJ          -------------------DEGD-ALKSVLSAH-PSTKNDFSELSKNIYTSIIKKHESN-
E3JV36_PUCGT          ----------------------NPNSSEDPMKMDPKTKADFESMSSALAQLIVSKHGNK-
A0A0D1DWZ4_USTMA      ----------------------DDELSSLKTAN-PSSKEDWEKLSTSIFTELIKKHASKP
EIF3J_YARLI           ----ADSAAKAEAAPAPAAPAAPMKLSDLAIFH-PKEKKDFTNLKETLAPILTDLNKTSP
G4VEX2_SCHMA          ----------------------SNDKETIDSCC-PKTKEDFNHLHSLLAAKITTIQKSP-
F4NYS5_BATDJ          -------------------GGLSTTEGAIESFH-PESRGEFDDFVKVIMKKFSTLEDQV-
H3GX76_PHYRM          -----------------PTVAAGDDADAAVSALRLLSLADHEHLGDVVSSRLATSNSK--
A2D9N1_TRIVA          -----------------------VTVDDYMNFV-PRVVSDFNGLRQKLVEVLKQKVDFKS
EIF3J_SCHPO           --------------------SASANRSKQADQRQLKTKADYAAFQADILKKVKNCQTTA-
                                                             :       :   .        

EIF3J_YEAST           LNYSSSLAIDLIRDVAKPMSIESIRQTVATLNVLIKDKEREERQARLA-----RVRGGTA
C5DQS6_ZYGRC          LNYSSSLAIDLIRDISKPMAIESIRQTVATLNILIKDKEKQERQARLA-----KVKGGTA
W1QKP4_OGAPD          LHYSTSLAIDLIRDLCGPMSVENTRKVVSTLNAMITQKVKEERQARLA-----KT-GGTS
EIF3J_CANAL           LLYASSLAVDLIRDLSQPLSVENLRKVISTLNVVIKDKERQERQARLK-----KA-GGTA
EIF3J_EMENI           --QYALWLPEFAKQLAKELPSGDIKKVASALTTLSNEKMKEER--------------AAD
EIF3J_ASPFU           --HYALWAQEFTKQLVKELNSGDVKKIASALTTISNEKMREER--------------AAD
C0NAA8_AJECG          --QYAMWAQDFAKKLVKELPSGDIKKIASALTAVGNEKLKEEK--------------AAD
Q0UWF4_PHANO          --QYSLFLQEFCKQIAKDLPSEQIKKIASALTTLSNEKMKEEK--------------AAE
EIF3J_NEUCR           --HYTLFLQEFSKQLAKDLKSDEIKKIASTLTALSNEKLKEEK--------------AAE
A7EFI2_SCLS1          --QYIIFLQEFTKQISKDLPSDQIKKIASTLTALSNEKMKEEK--------------AAE
C7YJZ3_NECH7          --QYSLFLQDFTKALAKEMPSEQIKKLASTITALGNEKMREEK--------------AAD
D5GKJ7_TUBMM          --HYSLFLQEFVRQLGKDMSSEQVRKVASGLTTLANERQREEK--------------AAE
EIF3J_DICDI           -IHYATFFKSLMKKVLVNVSSSDMNDISKTLTVLINEKLKNEK-S--------------G
F1A0Q3_DICPU          -IHYASFFKHLIKKSLANVPSNELNDISKALTVVINEKIKNEK-A--------------G
D3AWC8_POLPP          -YHYPHLLKTVLKNATQNMGSKELNEIVKSLTVIVNEKIKDEKNA--------------A
Q9C8D8_ARATH          -YHYIALLKTIMRLSLTNMKAADVKDVASSITTIANEKLKAEKEA--------------A
Q8GRX2_ARATH          -FHYIGLLKAVMRLSVANMKAADVKDVASSITAIANEKLKAEKEA--------------A
D7U206_VITVI          -FHYIGLLKAVMRLSMASLKAADAKEIASSVTAIANEKLKAEKEA--------------N
C5XT21_SORBI          -FHYMALLKNVMRLSMTSLKGADAKEISSSVTAIANEKIKAEKEA--------------A
A9TBZ8_PHYPA          -FHYMTLLRAIMRHSVANMKASDAKEIASSMTVIANEKLKAERDA--------------T
A9S6K9_PHYPA          -FHYMTLLRALLRHSVAAVKASDAKEFASSMTVIANEKLKAEKDA--------------T
A0A2I3HVU7_NOMLE      -LYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_PONAB           -LYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_HUMAN           -LYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_BOVIN           -LYYANFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EI3JA_MOUSE           -LYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EI3JB_MOUSE           -LYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_RAT             -LYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_CHICK           -LHYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQ---------------S
EIF3J_XENTR           -LFYPGFLEVLVREVCVSLEVDDLKKINNSLTVLCFEKQKQEKQQ--------------S
EI3JA_DANRE           -IHYSGFLETLFRDLCLSLEVEDLKKINNSLTVLLSEKQRQEKAN--------------K
EI3JB_DANRE           -VHYPSFLESLFRELCISLEVDDLKKISTSLSVLLTEKQKQEKEK--------------K
EIF3J_NEMVE           -PEYIPFLEATLREICVSLDPEDIKKLSSTLNMLQSEKLKAQKGK--------------K
EIF3J_AEDAE           -TEYCAFLEDLVTKLFASLPSANIRKVKGILDNLYLEKQKLEKGD--------------K
EIF3J_ANOGA           -TEYQGFLEELLLKLFASLSSNNIRKAKTTLDNLYLEKQKVEKGD--------------K
EIF3J_BOMMO           -DEFPGFIDDLVKNILVQMSSADIRRIKLTVDNLYIEKQKAEKND--------------K
E0VQW2_PEDHC          -LHFPLFMENFLRDISATLNLANVKRLKTTLDSVFMEKQKAEKAE--------------K
EIF3J_DROME           -EHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEKAN--------------A
EIF3J_DROPS           -AEFPQFVEDLVRGLCIHLSAADIKKVKMSVEILHSEKLKMEKAI--------------A
E9GGI0_DAPPU          -ACYNDFIEDFIKDVCIGLEVEVLRKVSLTSKSLHEEKLKMVKA---------------A
B3RRU4_TRIAD          -PHYPTVLEYIYRNCCLEVDPDEIKKLASSLNAVASEKLKIQKAK--------------T
A8P4D5_COPC7          -PLYASFVEHLAREMAQPLKDVEVRKVASGLTTLANEKQKEQRDR--------------A
Q5KGC7_CRYNJ          -PLYAHFVEQLAKDISAALTAVQTRKVSSALSVLGNTKQQEEREK--------------A
E3JV36_PUCGT          -PLYPLFVEHFFRQLSEPLSDVQTRKTASILTTIANEKQRAAKDA---------------
A0A0D1DWZ4_USTMA      -GFEKHFVPHFYKTLASTMRDVDIRKASTMLKTYAEEKVKAEKEA-------------KK
EIF3J_YARLI           -LAYPDFAITFTKALAEPLKVEQLRKLISTLNAYQNEKIREEK----------------A
G4VEX2_SCHMA          --HFTAFAESLIRDLVIEMEVDALRTVNTVINALINEKQKLVKSK---------------
F4NYS5_BATDJ          --QYTYFVESLIRELVIPINVEDTRRISSSLTAMINEKQRVLKES---------------
H3GX76_PHYRM          --YALECIKVILTKASVNLTADDMKEITTIVNVIKNDKIASAKPK--------------G
A2D9N1_TRIVA          -KEAPQLLAYFIRCLIDDYKGEQMKTLDSELIKIINEKLQQTRAK---------------
EIF3J_SCHPO           --EYNNFVQDLIPLLLTGLNATNLKAVQKSVNKLVVNKEQQEKTQSKRGAAAPAAKPVST
                                              .            :    :                 

EIF3J_YEAST           TGGAGKKKVK--GKTNLGGAFK-KDQDFDLDGPDDF-EFGDDDFM
C5DQS6_ZYGRC          TGGAGKKKAK--AKTNLGGSFK-KDQDLDIGGELDLGDFNDDDFM
W1QKP4_OGAPD          TGGAGKKKAK--GQVNIGSSFK-KDNYDDFLPDDDL---GDDDFM
EIF3J_CANAL           TGGAGKKKAKPLARPNVGGGFK-KDAFDDMD-DGQFDDLDDDDFM
EIF3J_EMENI           KGSKKTKAAKTKVSLVASRS----DKIETTAYDDDG--LDDDDFM
EIF3J_ASPFU           KGNKKTKAAKTKVSLVASRD----NKIDATPYDDDG--LDDDDFM
C0NAA8_AJECG          KGGKKSKAAKTKTSVVVGRDVGGARGADLTAYDGDD--LGDDDFM
Q0UWF4_PHANO          KGGKKTKAAKTKTVLNASRDVG--TRADTAAYDED---FGDDDFM
EIF3J_NEUCR           KGGKKSKAAKTKTSLAGVGRGGAIAEAHDTYDDDA---FGDDDFM
A7EFI2_SCLS1          KGGKKSKAQKTKTTLNASR--DAISHKDTQAYDDD---FGDDDFM
C7YJZ3_NECH7          KGGKKTKAAKTKTSLVTGRA----NAADTSHYDDDGGDFGDDDFM
D5GKJ7_TUBMM          KGGKKTKAAKGKTTLATGKE---ADKFDTTDYLEPAGYDGFDDFM
EIF3J_DICDI           KGGNKTKTKVAPKK---IHMGN---EL------QNYDDFDDDDFM
F1A0Q3_DICPU          KG-KKTTKATAKKS---LQMGS---EL------ENYDDFDD--FM
D3AWC8_POLPP          GGKKKTTKAAATKK---TLQVD---NE------MNYEDFGDDDFM
Q9C8D8_ARATH          AGKKK-GGKKKQLI---VDKAN---DDLVAG---PYDAMDDFDFM
Q8GRX2_ARATH          AGKKK-SGKKKQLH---VDKPD---DDLVSG---PYDAMDDDDFM
D7U206_VITVI          TGKKKIGAKKKQLH---VDKPD---DDVVVN---AYDDIDDYDFM
C5XT21_SORBI          AGKKKQGAKKKQLH---IEKGD---DDFIPGRGGGYDDPDEYDFM
A9TBZ8_PHYPA          AGKKKTGAKKKQLI---VDKPD---DDGMGG--VSYDAVDDYDFM
A9S6K9_PHYPA          AGKKKTGAKKKQLM---VDKPD---DDGLGG--GSYDPIDDYDFM
A0A2I3HVU7_NOMLE      KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGGYVQDYEDFM
EIF3J_PONAB           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGGYVQDYEDFM
EIF3J_HUMAN           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGGYVQDYEDFM
EIF3J_BOVIN           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGGYAQDYEDFM
EI3JA_MOUSE           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYEGGYVQDYEDFM
EI3JB_MOUSE           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYEGGYVQDYEDFM
EIF3J_RAT             KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGGYVQDYEDFM
EIF3J_CHICK           KAKKKKKGVVPGGG-LKATMKD---DLADYGGYDGEYVQEFEDFM
EIF3J_XENTR           KAKKKKKGVVPGGG-LKANMKN---DLEDYGGMDEGYGREYDDFM
EI3JA_DANRE           G-KKKKKGVLPGGG-LKAKMKD---DLADYGGFDGGYAQDYEDFM
EI3JB_DANRE           ANKKKKKGVVPGGG-LKANMKD---DFADYGGFDGGYGNEYDDFM
EIF3J_NEMVE           AKSKATKKATLTGG-AKMGRKD---E-MDYS--YGDLGNEYDDFM
EIF3J_AEDAE           PKKKAGGKIKARLR-MDGENQN---FDEYAPKYDDF--DEYDDFM
EIF3J_ANOGA           PKKTKGIKVKAKLR-VEGENTT---LNEYETKYDDY--DDYDDFM
EIF3J_BOMMO           TKKATKGKGKAKLK-LEGDNAH---LNQYESYGNFD--DDYDDFI
E0VQW2_PEDHC          TKKNKG-KGKVSLK-VEGEN------EYSAYSVGDY--DDYDDFI
EIF3J_DROME           KKPAGKGKGKVTLR-TENDD-----IDGYQKYGNDFT-EDYDDFM
EIF3J_DROPS           KKAAGKNKGKATLR-TESDD-----IDDYKKYGNDFS-EDYDDFM
E9GGI0_DAPPU          TKGGKKGKTKVALK-MDKGM--------VDNFGDDFGGGDYDDFM
B3RRU4_TRIAD          KKGKKKGGVSK----------------ESNTLYEDTVYDEYDDFM
A8P4D5_COPC7          SGKKKKASAKPALGGAKSAKSV---DTTVYDEALDDFGNDPNDFM
Q5KGC7_CRYNJ          SGKKK-AASKPKLGAAKVLSKV---DTEAYDDVLGD-----DDFM
E3JV36_PUCGT          KKGKGKLKPTLGGGVVSGASKGGRGVNADLEVYDQALDDEFDDFM
A0A0D1DWZ4_USTMA      AGGQKTKLAAAKPKMVGTSSAK---NVIDTNVYGDEALDDDLDFM
EIF3J_YARLI           ARGKKKKPGLAAASAKINDDKD--------TSTFNDNFDDFDDFM
G4VEX2_SCHMA          TKKKTKGKLLVERE-----------NDYQYGVDDDALPDEYDDFM
F4NYS5_BATDJ          QNKGKKKAAKQVLKTAPAGRGD--------TTNYDDVYDDFDDFM
H3GX76_PHYRM          KKKKQTGKQGYANVERNVGNGG---AGGKSYAGFEDTYDDYDDFM
A2D9N1_TRIVA          QGKNTKKKTSTKVYMNIKDDGK----------------DNDDDFM
EIF3J_SCHPO           AAPSKKGGKPTVNVNSKKTVADKSAYEDYIEDEYDDYADDFDDFM
                                                                 *: