CLUSTAL format seed alignment for MF_03010

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q4UE04_THEAN      ---------------------------MQTDLASVVRSNAESLLDTPSAQFKLSSLPTLI
Q4N5I7_THEPA      ---------------------------MQTDLASVARSNAESLLDTPSAQFQLSSLPTLI
A7ANU7_BABBO      ---------------------------METDATTDARKNAEAVLASPALQYNISGIPALT
EIF3K_BOVIN       ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
G1PFG2_MYOLU      ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
G1LUE5_AILME      ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
EIF3K_HUMAN       ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
H0Y1U1_OTOGA      ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
EIF3K_MOUSE       ------------------------------MAMFEQMRANVGKLLKGIDRYNPENLATLE
EIF3K_XENTR       ------------------------------MASFDQMRANVGKLLRGIDRYNPENLATLE
H3BH15_LATCH      ------------------------------MASFEQMRANVGKLLKGIDRYNPENLSTLE
EIF3K_DANRE       -----------------------------MATTFEQMRANVGKLLRGIDRYNPENLATLE
C3YGW5_BRAFL      --------------------------------MAEAMRASVAELLHGIDRYNPENLATLE
EIF3K_AEDAE       --------------------------MVHYVKMEDGKVMPIQDMLKSIERYNPEHLKVIE
EIF3K_ANOGA       --------------------------MVHYVKMEDGKVMPIQEMLKSIERYNPEHLKVIE
EIF3K_DROME       --------------------------MSHLVKMENGQSQTIQEMLGCIERYNPDHLKTLE
EIF3K_DROPS       --------------------------MSHLVKMENGQSQTIQEMLGCIERYNPDHLKTLE
EIF3K_BOMMO       ----------------------------MTDTMAETMKQTVASILKSIERYNPANLEILE
E0VVK8_PEDHC      --------------------------------MGEAIRQTIASMLRGIERYNPENLPTLE
E9H0D0_DAPPU      --------------------------------MAEKMKTEIASMLQGIERYNPDNLQKLE
EIF3K_NEMVE       --------------------------------MAAEMRVTVSQLLKGIDRYNPENLKVLE
B3SCB7_TRIAD      ---------------------------------------------MDIPKYNPENLTVLH
EIF3K_CAEBR       -------------------------------MSFERLQRDLHEAIEGVNRYNPENVAELA
EIF3K_CAEEL       -------------------------------MSFEKLQKELHEAIEGVNRYNPENVADLA
A9UW43_MONBE      -----------------------------MSEELRELEERFGGIIGTIERYNPSNLGFFA
EIF3K_DICDI       MENDQDQQQQQQQSQQQQPQQEEQEQVDVDLSSLQGQERIEYINTLIADSYNIAIAKKLE
F0ZSE2_DICPU      -------------------------MIDVDLQSLSSSDRIEYISTLIADSYNIAIAKKLE
D3B6R0_POLPP      ---------MSDTEQEQIQQDDHNQLLDVDLSTLSTPEKMELITNIIADSYNINIAQKLE
C5WVR8_SORBI      ----------------------------MATEQAAEN--YTVEDLVALNPYNPDILNDLE
D7TC95_VITVI      --------------------------MGIPKQQPQQQ--YTVEQLLALNPYNPDILPDLE
EIF3K_ARATH       --------------------------MGVEIQSPQEQSSYTVEQLVALNPFNPEILPDLE
A9RDQ6_PHYPA      ----------------------------MPGAQAPQQI-FTIEQLVALNPYNPDILPDLE
A9T5D2_PHYPA      ----------------------------MPGAQAPQQI-FTIEQLVALNPYNPDILPDLE
A8JHW7_CHLRE      ----------------------------------------MSLIVTGADRYSPDKLPQLE
D0MYZ2_PHYIT      ----------------MPAFQQQTIVDFVTADNASATQQQLQAVHNSRGFCEEASVKVLE
H3GXI5_PHYRM      ----------------MPAFKQQTIVDFVTAESASATQQQLQAVHNGRGFCEQASVKVLE
EIF3K_EMENI       --------------------------MGVAIDKCETRPANIEAILSGLDRYNPETTTVFQ
EIF3K_ASPFU       --------------------------MGVAFDKCDTRPAHIDAILNGLDRYNPETTTVFQ
C0NGT3_AJECG      ---------------------------MAAFDKCKTRPQHIDVILNGLDRYNPETTTIFQ
EIF3K_PHANO       --------------------------MGAPYDFAPERPDHIQQILDGLDRYNPETTGVFQ
EIF3K_SCLS1       --------------------------MGVPFDYAPERPEHIDAILNGLDRYNPETTNIFQ
D5GGJ4_TUBMM      ----------------------------MTFDTST-RPEHIQGILSSLDRYNPETVTIFQ
C7YPB6_NECH7      ----------------------------MNGEDPPERPNEIADIINGLERYNPEAVGALE
EIF3K_NEUCR       ----------------------------MNGEDPQERPDFIRAIINGLERYNPEAAGTLE
EIF3K_YARLI       --------------------------MDTLSKKPEQRPEEITAILSSLDRYNPEKISILQ
A8PZL8_MALGO      ----------------------------------------------MPDRYSPQSRDILL
EIF3K_USTMA       --------------------MASETASASQWVSPSSRPQHIEQLISGVDRYNPQNLDVLH
A8N1Y1_COPC7      --------------------------MSSSWTKPASRPDLIHDLVSGVDRYNPSNVGILE
EIF3K_CRYNJ       ------------------MVTAVSPENLKEWHTPSTRPDVIHELIHGVDRYNPSNLPFME
Q4XW53_PLACH      -----------------MASTPLQPCHPFFFSEFFLIFTICIHIYILYIFLFSIFLEVLS
Q7RFX1_PLAYO      ------------------------------MDXNSIIEEVQAIKAYPHMMFNASKLKVLS
B3L493_PLAKH      ------------------------------MDVKSIIEEVQAIKVYPHMMFNASKLKILS
A5KBB9_PLAVS      ------------------------------MDVKSIIEEVQAIKVYPHMMFNASKLKTLS
Q9NFE6_PLAF7      ------------------------------MDINNIMEEVQAIKVLPHMMFNASKLKVLS
G4LUZ0_SCHMA      ----------------------------------MDRKAVIKSKLQGIESYNPEHIAALE
F4NRP5_BATDJ      --------MPSSNTDVDGLTGEETTINKFSTLRPSYRPEEIHLVVETVDRYNPQNMAILE
E3L1E7_PUCGT      --------------MAANPANINNHLVTHTWSSPPERPEAIQVLILGVERYDPTQVQVLE
Q5CU68_CRYPI      --------------------------------<MAQVDQKITSLLNSASRYDVSNLDIFE
S7UXN8_TOXGG      ------------------------MSGAASATTPPLAAQVQALLQAPELRYDPSSLTLLC
B8BVJ5_THAPS      ------------------------------MTVSQIPTHGEIQALLSTSAYDPAIVSKLE
                                                                            : 

Q4UE04_THEAN      EFLNFQLNDINL-------YSLANNVGILKIYLLY--------------PEASDVLVIQK
Q4N5I7_THEPA      EFLNFQLTDINL-------YSLANNVGILKIYLLY--------------PDVSDVLVIQK
A7ANU7_BABBO      AYLDEQMEKANA-------YSLDNNVAILKIYTLF--------------PHIADPLVIQK
EIF3K_BOVIN       RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
G1PFG2_MYOLU      RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
G1LUE5_AILME      RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
EIF3K_HUMAN       RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
H0Y1U1_OTOGA      RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
EIF3K_MOUSE       RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
EIF3K_XENTR       RYVETQAKENA--------YDLEANLAVLKLYQFN--------------PAFFQTTVTAQ
H3BH15_LATCH      RYVETQARENA--------YDLEANLAVLKLYQFN--------------PAFFQTSVTAQ
EIF3K_DANRE       RYVDTQARENA--------YDLEANLAVLKLYQFN--------------LAYFQTTVTAQ
C3YGW5_BRAFL      RYVDLHARRTR--------LRPGGQ------------------------PGCAETSGKKK
EIF3K_AEDAE       AYVEEQARDNQ--------YDLEANLACLKLYQFN--------------PQLMNLDVTYV
EIF3K_ANOGA       AYVEEQARENQ--------YDLEANLACLKLYQFN--------------PHLLNLDITYI
EIF3K_DROME       SYVQDQAKNNT--------YDLEANLAVLKLYQFN--------------PHMLNFDITYT
EIF3K_DROPS       AYIQDQAKNNT--------YDLEANLAVLKLYQFN--------------PHMLNFEITYT
EIF3K_BOMMO       RYVEMQSRENT--------YDWGANLAVLKLYQFN--------------PEKFNADITCQ
E0VVK8_PEDHC      NYVERQAVENS--------YDLEANLAVLKLYQFN--------------PHLYKVDITCL
E9H0D0_DAPPU      RYVELQAQENM--------YDLEANLSVLRLYQFG--------------PNFYRSNIVNL
EIF3K_NEMVE       HYVHLQVHENA--------YDLDANLAVLKLYQFN--------------PAYSQTSVISQ
B3SCB7_TRIAD      AYVEQQAQEGT--------YDVEANLAVLKLYQFN--------------PSLFQSNIVSL
EIF3K_CAEBR       ACVQAMVAENK--------YDKDIVLTILKLYQLN--------------PERYDENVVRQ
EIF3K_CAEEL       ACVQAMVNENK--------YDKDIVLTILKLYQLN--------------PEKYDEAVVRQ
A9UW43_MONBE      EYFEKTLEENY--------YDLDVCLAILKLYQFN--------------PTYFNLPTACT
EIF3K_DICDI       EFLDIQINENT--------YLFQANSTLLKLYQFN--------------PTHLNKDSIAK
F0ZSE2_DICPU      EFLDIQINEDV--------YLFQANSTLLKLYQFN--------------PTHLNKDAIAK
D3B6R0_POLPP      QFLDIQINENI--------YHFQANSTLLKLYQFN--------------PSALNKDYIAK
C5WVR8_SORBI      KFVNEQVSSQT--------YNLDANLSLLRLYQFE--------------PERMSIQIVAH
D7TC95_VITVI      NFVNEQVSSQT--------YSLDANLCLLRLYQFE--------------PERMSTQIVAR
EIF3K_ARATH       NYVN--VTSQT--------YSLEVNLCLLRLYQFE--------------PERMNTHIVAR
A9RDQ6_PHYPA      SYVEEQVATQT--------YSLDCNLCLLRLYQFQ--------------PARMNVHIIIK
A9T5D2_PHYPA      SYVEEQVATQT--------YSLDCNLCLLRLYQFY--------------PARMNVHLIIK
A8JHW7_CHLRE      AYVDEQVANRS--------WSLDANVTLLRFYQFS--------------PASVKPAIVAK
D0MYZ2_PHYIT      TYLAEQLQSKT--------VDIDANLALLKLYQVY--------------PATTNAENVAK
H3GXI5_PHYRM      TYLAEQVQNST--------VDIDADLALLKLYLVY--------------PATVNAENVAK
EIF3K_EMENI       DYVVQQCEDRT--------FDCYANLALLKLYQFN--------------PHLLQPETVTN
EIF3K_ASPFU       DYVVQQCEERT--------FDCYANLALLKLYQFN--------------PHLLQPETVTN
C0NGT3_AJECG      EYVVQQCEDRT--------FDCYANLALLKLYQFN--------------PHLLHTETTTN
EIF3K_PHANO       DYVMQQCESQT--------YDCYANLALLKLYQFN--------------PHLSRDETVTN
EIF3K_SCLS1       EYVTLQCEEKT--------YDCYANLALLKLYQFN--------------PHLTKDETITN
D5GGJ4_TUBMM      DYVQQQCENRT--------YDSLANLALLKLYQFN--------------PHLTRDETITN
C7YPB6_NECH7      TYLQDQCEGKF--------TDCNANRTLLKLYQLN--------------PDRIKDEVITN
EIF3K_NEUCR       AYLTQQCEEKF--------CDCNANRALLKLYQLN--------------PDRIKDEVITN
EIF3K_YARLI       EYATTQCADQH--------SDIEANLALLKLLQFQQQ------------PNPNKEDIICN
A8PZL8_MALGO      QYLENQLENGT--------NDILANLAILKLFQLN--------------PSDFSLDTAVL
EIF3K_USTMA       DYLAQQLDDGS--------YDLLANLAILKLYQFN--------------PADFNYVVVIN
A8N1Y1_COPC7      DYLYHQIRSEE--------YDCLANLAILKLYQFN--------------PDLYNPDVVIN
EIF3K_CRYNJ       DYLATELKEGQ--------YDLFGNLAILKLYQFN--------------PQHSNPDVIIN
Q4XW53_PLACH      DYVDIAFENNEY-------FDNEVMLTLLRLFCLY--------------PHCYDKSVIKK
Q7RFX1_PLAYO      DYVDIAFENNEY-------FDNEVMLTLLRLFCLY--------------PHCYDKSVIKK
B3L493_PLAKH      DYVDIAFGNNEH-------FDNEVMLTLLRLFCLY--------------PHCFDKIVIKK
A5KBB9_PLAVS      DYVDIAFGNNEY-------FDNEVMLTLLRLFCLY--------------PHCFDKIVIKK
Q9NFE6_PLAF7      DYVNVAFENNEY-------YDNDVMLTLLRLFCLY--------------PHCYDKDIIKK
G4LUZ0_SCHMA      EHLSWQIINND--------YDFEANLALLRLYQFY--------------PERFNAECARL
F4NRP5_BATDJ      EYISSQLKTNN--------YDRTACLALLKLYQLN--------------HADANVYVIAS
E3L1E7_PUCGT      DYLTQQCNQAF--------YDPLANFATLKLYQFNPDLVPLAAENPSNPIEAIHDSITIK
Q5CU68_CRYPI      NCVRDQIIKGQ--------YSILNNLVVLLQYSIY--------------PKRTNLEIVQD
S7UXN8_TOXGG      QYTEEQVAKNT--------YDQEACLAVLKLYLLY--------------PQCFSVDLARK
B8BVJ5_THAPS      AYVRAQVSSVASSLESDAQYSFEANRTLVKLYQFFPHL-----------EGELGMTVTAL
                                                                              

Q4UE04_THEAN      ILVLSLTQVPA-PDFTVCLSQIPLYLHN--------------------------------
Q4N5I7_THEPA      ILVLSLTQVPA-PDFTVCLCQIPLHLHN--------------------------------
A7ANU7_BABBO      ILVQCLTQLPA-NDFNICFAQVPLPTQE--------------------------------
EIF3K_BOVIN       ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
G1PFG2_MYOLU      ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
G1LUE5_AILME      ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
EIF3K_HUMAN       ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
H0Y1U1_OTOGA      ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
EIF3K_MOUSE       ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
EIF3K_XENTR       ILLKALTNLPH-TDFTLCKCMIDQAHQE--------------------------------
H3BH15_LATCH      ILLKALTNLPH-TDFTLCKCMIDQTHEE--------------------------------
EIF3K_DANRE       ILLKALTNLPH-TDFTLCKCMIDQTHQE--------------------------------
C3YGW5_BRAFL      KQRKP----TQ-KAIGICQSHR----QE--------------------------------
EIF3K_AEDAE       ILLKALTNFPH-TDFVLCKCLLLPAQMN--------------------------------
EIF3K_ANOGA       ILLKALTNFPH-TDFVLCKCLLLPAQMN--------------------------------
EIF3K_DROME       ILLKSLTSLPH-TDFVMAKCLLLPQQMK--------------------------------
EIF3K_DROPS       ILLKSLTNLPH-TDFVMAKCLLLPQQMK--------------------------------
EIF3K_BOMMO       ILLKALTNFPH-TDFTLCKCLLLESVVE--------------------------------
E0VVK8_PEDHC      ILLKALTNLPH-TDFVLCKCLLTKAQCQ--------------------------------
E9H0D0_DAPPU      ILLKAMTNLPH-TDFLLCKCLLTQDRLE--------------------------------
EIF3K_NEMVE       ILLKALMNLPN-ADFIMCRCVIDDAIQQ--------------------------------
B3SCB7_TRIAD      ILLKALTNLPS-NDFSLCRCLME----E--------------------------------
EIF3K_CAEBR       VLLKTLMVLPS-SDFALAKCLIDTNRIG--------------------------------
EIF3K_CAEEL       VLLKTLMVLPS-SDFALAKCLIDTNRLG--------------------------------
A9UW43_MONBE      VLLKALTGMPD-NDFFLCASLLTVESQQ--------------------------------
EIF3K_DICDI       MLAKALMNFPC-NDFLFLSYMIPSIIQK--------------------------------
F0ZSE2_DICPU      MLAKALMNFPC-NDFLFLSYMIPSTIQK--------------------------------
D3B6R0_POLPP      MLAKALMNLPS-NDFLFLSYMIPFSMQK--------------------------------
C5WVR8_SORBI      ILIKALMAMPA-PDFSLCLFLIPEHVQM--------------------------------
D7TC95_VITVI      ILVKALMAMPA-PDFSLCLFLIPERVQM--------------------------------
EIF3K_ARATH       ILVKALMAMPT-PDFSLCLFLIPERVQM--------------------------------
A9RDQ6_PHYPA      ILVKALMALPA-TDFSLCMFLIPERLQM--------------------------------
A9T5D2_PHYPA      VLVKALMALPA-TDFNLCMFLIPERLQM--------------------------------
A8JHW7_CHLRE      VLIKAIMQAPA-QDYKCCITLLPERLLQS-------------------------------
D0MYZ2_PHYIT      VLVKGVMSLPS-TFFTGASTMVPESVHEDAN-----------------------------
H3GXI5_PHYRM      VLVKGVMALPS-TFFTGASTLVPESIREDAS-----------------------------
EIF3K_EMENI       ILVKALTVFPS-PAFSLCLALLPAYTQPFPSSEAEATAAQ--------------------
EIF3K_ASPFU       ILAKALTVFPS-PAFSLCLALLPAHTQPFPT--ADTDASQ--------------------
C0NGT3_AJECG      ILAKALTVFPS-PAFSLALALLPAYTQPFSASTSSSLPMQ--------------------
EIF3K_PHANO       ILVKALTMFPS-PDFALGLSLLPSHLLAPLNSSAHNPAAG--------------------
EIF3K_SCLS1       ILVKSLTVFPS-PDFSLALHLLPPHILTPISSSSALPAAG--------------------
D5GGJ4_TUBMM      ILVKALTVFPS-ADFGLCLHLLPANALTEPPID---------------------------
C7YPB6_NECH7      ILVKTMTQFPS-SQFSLALHLINPS-----SVATG-------------------------
EIF3K_NEUCR       ILVKAMTQFPS-PQFDLALHLLSPSQSNPGPNSSS-------------------------
EIF3K_YARLI       ILSMALANFLT-SDFTTALHVLPSYVLDSPAADT--------------------------
A8PZL8_MALGO      ILIKALTATPF-PDFHLCISLLGEAPVRTLSIHDTTQAST--------------------
EIF3K_USTMA       ILLKALVAAPL-PDFNLCISLLGEAPLPTVPVKAEKEATTTDADNAGSLSGDDDDDEVVE
A8N1Y1_COPC7      ILLKALTATPM-PDFNLCISLLDERP-PTASLDEPDPLPT--------------------
EIF3K_CRYNJ       ILIKALAATVSGPDFNLCLEMLREPSAILHDIESADEALV--------------------
Q4XW53_PLACH      ILVCVLYNINT-VDMNIYLSLINPNLYD--------------------------------
Q7RFX1_PLAYO      ILVCVLYNINT-VDMNIYLSLINPNIYD--------------------------------
B3L493_PLAKH      ILVCVLYNIND-IDMNIYLSLINPNLYD--------------------------------
A5KBB9_PLAVS      ILVCVLYNINE-VDMNTYLSLINPNLYD--------------------------------
Q9NFE6_PLAF7      ILICVLYNINN-VDMNMYMSLINSSLYD--------------------------------
G4LUZ0_SCHMA      VLLKAIISMSH-SDFTLCKYLIHLEHLN--------------------------------
F4NRP5_BATDJ      VLALALSALPE-SDFTLCMYLLREEWLA--------------------------------
E3L1E7_PUCGT      ILLLSIVHRPFDSDFNLCLSLCGDRMSSLLTPQAT-------------------------
Q5CU68_CRYPI      ILLLSIIRGPLSSDFLSCTYQIPLSVQN--------------------------------
S7UXN8_TOXGG      ILVKGIMNLPN-EDCAVFVGMLQQQPGKKD------------------------------
B8BVJ5_THAPS      AAFLALLQFPE-TDFMALGCLIPERVQS--------------------------------
                                                                              

Q4UE04_THEAN      ------------EEPVSKVINLHNLLQNCMFLRFWETANSELES------------VPGK
Q4N5I7_THEPA      ------------QEPVSKVINLHNFLQNCMFLRFWESANLELES------------MPGK
A7ANU7_BABBO      ------------HPVIAKVVALHNLLQNCLFHKFWEEARHNMMD------------NDDR
EIF3K_BOVIN       ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
G1PFG2_MYOLU      ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
G1LUE5_AILME      ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
EIF3K_HUMAN       ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
H0Y1U1_OTOGA      ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
EIF3K_MOUSE       ------------ERPIRQILYLGDLLETCHFQAFWQALD-----------------ENMD
EIF3K_XENTR       ------------ERPIRQILYLGDLLETCHFQSFWQALD-----------------ENLD
H3BH15_LATCH      -------------RPIRQILYLGDLLETCHFQSFWQALE-----------------ENMD
EIF3K_DANRE       ------------ERPIRQILYLGNLLETCHFQSFWASLE-----------------ENRD
C3YGW5_BRAFL      ------------EEMITRVTFLADLLETCQFKNFWKEIA-----------------LTPE
EIF3K_AEDAE       ------------DDTVKEIIYLADILEKCDFTLFWSRVA-----------------KNPP
EIF3K_ANOGA       ------------DETVKEIIYLADILEKCDFSLFWSRLA-----------------KHPE
EIF3K_DROME       ------------DENVQTIIDLADILERADFTLFWQRAE-----------------VNRN
EIF3K_DROPS       ------------DENIQTIIDLADILERADFTLFWQRAE-----------------VNRT
EIF3K_BOMMO       ------------NETISQIKYLADILEQCDFAQFGNRVH-----------------QMPE
E0VVK8_PEDHC      ------------EVPIIHIIFLADILERCDFQTFWNKVL-----------------SMSD
E9H0D0_DAPPU      ------------EPQVSRVMVLADLLETCKFKQFWEELA-----------------KCGD
EIF3K_NEMVE       ------------DLTIKKVILLAERLETCAFTSAWQFIK-----------------EEAS
B3SCB7_TRIAD      ------------DEQISRIFYLGELLETCNFITFWEELA-----------------QNKD
EIF3K_CAEBR       ------------SQELRRIFDLGAVLESCNFAVFWKLMKGTYKPTTNPNEPFKVPAEISK
EIF3K_CAEEL       ------------SQELRRIFDLGAVLESCNFAVFWKLVKGAYKPTTNPNEPFKVPGEVPK
A9UW43_MONBE      ------------QRPIQQLMYLHQLLESCRFAEFWVRCGR--------------PAITRP
EIF3K_DICDI       ------------EEPLLKLFILNNFLETCKFKEAWTHI------------------NSHS
F0ZSE2_DICPU      ------------EEPLLKLFVLNNYLETCRFKEAWTHI------------------NAHS
D3B6R0_POLPP      ------------EEPLLKLFVLNNLLETCKFKEAWEHIQ-----------------NNQA
C5WVR8_SORBI      ------------EEQFKTLIVLSHYLETARFSQFWDEAA-----------------KNRH
D7TC95_VITVI      ------------EEQFKTLIVLSHYLETARFRQFWDEAA-----------------KNRH
EIF3K_ARATH       ------------EEQFKSLIVLSHYLETGRFQQFWDEAA-----------------KNRH
A9RDQ6_PHYPA      ------------EETFLTLATLAHFLETSRFREFWDEAN-----------------RNRD
A9T5D2_PHYPA      ------------EETFLNLATLAHFLETSRFREFWDEAN-----------------RNRD
A8JHW7_CHLRE      ------------DESVYKVVQLANALETSRFGDFWNAAN-----------------TCRD
D0MYZ2_PHYIT      ---------------VTAVLHTGFMLQSCLFEEFWKESVAFA------------------
H3GXI5_PHYRM      ---------------VTAVLHTGFLLQSCLFEDFWKEEVTFA------------------
EIF3K_EMENI       --------MSDFVESVQKLARLSSLLESAQYAQFWSTLNSDD--------------LYAD
EIF3K_ASPFU       --------TSDFVESIQKLARLSTLLESAQYAQFWSTLNSDD--------------LYAD
C0NGT3_AJECG      --------TSDFIESIQKLARLNTLLESAQYTLFWSTLNSDD--------------LYAD
EIF3K_PHANO       --------DAPLSEAVQKLNELRNLLEGADYATFWSTLDSDD--------------LYAD
EIF3K_SCLS1       --------DAPLSEAVQKLAVLNTLLSSANYSQFWSTLDSDD--------------LYAD
D5GGJ4_TUBMM      ----------PFAEAVLKLFSLSRLLEACEYREFWMTLESDD--------------LYAD
C7YPB6_NECH7      ----------DLGEAITKLRSLNGELEGAQYARFWADLD-DD--------------MVAD
EIF3K_NEUCR       ----------ELTEAVSKLRALNAQLEGAEYARFWATLDSDD--------------LYAD
EIF3K_YARLI       -----------LAESIQKLFHLYTLLDGCRFPEFWAVYERDD--------------AHAD
A8PZL8_MALGO      --------GKITEPIIVRLSTLSELLFQTKFVQFWNLYSSDE-----------YKDVRS-
EIF3K_USTMA       KPKDVASAGHLTDPLIVRLSQLSTLLFQARFREFWSTLASES-----------YSDVRD-
A8N1Y1_COPC7      --------------LLPLLRNLQNLLYRCRFPAFWQTYNSDE-----------YENLRDN
EIF3K_CRYNJ       -------------IVMPYLQRLHELSRTCQFTKFWQEINSDSEA---------AKILRTR
Q4XW53_PLACH      -------------DNIKGVVYLHDLIKECQFKKLWDCINNK-SEENN--------NYDYS
Q7RFX1_PLAYO      -------------DNIKGIVYLHDLIKECQFKKLWNCINNK-SEENS--------NYDYS
B3L493_PLAKH      -------------DNIKSIVYLYDLIKECHFIKMWNCIKNNQWMDDR--------TCDYS
A5KBB9_PLAVS      -------------EHIRSVVYLYDLIKECHFIKLWSCINNNQGMDNR--------SCDYS
Q9NFE6_PLAF7      -------------DNIKSVIYIYELIKNCQYKKLWNCINNNIGNEYN--------NCDYS
G4LUZ0_SCHMA      ------------EEPLSQVVKLGLFLETCRFSEFWTKVK-----------------ENPK
F4NRP5_BATDJ      ------------DPLIAHLVHMHELLGQAQFSEFWAYLESEE--------------SVRE
E3L1E7_PUCGT      ------------LNLIELLSKLSRTLQTRQFIKFWADLGSAEYE------------PLGA
Q5CU68_CRYPI      ------------DPNIKQIIQLNDLLTSCRYANMWNLLKTND--------------QLRS
S7UXN8_TOXGG      ------------WKKVQEAIHLWELLEKCRFKQVWEFLKE----------------PAMA
B8BVJ5_THAPS      ------------MEPCATLVRCAELLESCQFSEFWPEFRKLGIPEYGARDNETVVSDDRK
                                                :                             

Q4UE04_THEAN      TVLDVSG---LSDSVRKFVLDVLPLVYNQMAVPEVRKLLNFTSNCQEFEQLLSLCGWAFD
Q4N5I7_THEPA      TVLDVSG---LSDSVRKFVLDVSPLVYNQMTVPELRKLLNFQTNSQEFEQLLSVCGWSFD
A7ANU7_BABBO      TFLDVPG---LRESIRRFILDVVPLVYLQMSVPELRSMLDYPSNCEEFEQLLKSYKWTLE
EIF3K_BOVIN       LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTD-SQLKVWMSKY----G
G1PFG2_MYOLU      LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTD-SQLKVWMSKY----G
G1LUE5_AILME      LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTD-SQLKVWMSKY----G
EIF3K_HUMAN       LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSD-SQLKVWMSKY----G
H0Y1U1_OTOGA      LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSD-NQLKVWMSKY----G
EIF3K_MOUSE       LLEGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTD-NQLKVWMSKY----G
EIF3K_XENTR       LIDGITG---FEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSE-PQLRVWMSKY----G
H3BH15_LATCH      LLDGIIG---FEDSVRKFICHVVGITYQHIDKWLLAEMLGDLSD-AQLKTWMSKY----G
EIF3K_DANRE       LIDGITG---FEESVRKFICHVVGITYQNIEYRLLAEMLGDPLD-TQVKVWMNKY----G
C3YGW5_BRAFL      VIEGVSG---FEDSVRKFICHVVSITYQRIDKQTLLELLGDIDD-QQLKQWMNKY----G
EIF3K_AEDAE       FFKKISG---FFDSIRKFVCHVVGITFQSIEKQYLVRLLGDVDD-NVLRAWVKKN----N
EIF3K_ANOGA       NYQKISG---FHDSIRKFVCHVVGITFQTIERGYLMQLLGNVEE-KVLLSWLKRY----G
EIF3K_DROME       MFRHITG---FHDSIRKFVSHVVGTTFQTIRKDLLKELLGGIED-STLESWIKRN----G
EIF3K_DROPS       MFRHISG---FHDSIRKFVSHVVSITFQTIKKDLLKELLGGIED-STLESWIKRN----G
EIF3K_BOMMO       LCSRISG---FHDSIRKFVCHVVGITFQTIDKNNLANLLGGIDD-VTLKHWVKKY----G
E0VVK8_PEDHC      LCNRITG---FHDSIRKFVCHVVGITYQTVDKNTLQLLLGGVYP-EELKMWINKY----H
E9H0D0_DAPPU      LIITVQG---FEDAIRKFVAHVVNITYQTIEVPVLKELLGNVND-QVLKQWVGKC----S
EIF3K_NEMVE       LVDGVTG---FHDAIRNYITYVIGVTYQTIEESLASELLGGLQG-AQLQDWIKAK----G
B3SCB7_TRIAD      LSSTVNG---FEESIRDFICYVLNITYQTIEASLVAKLLGDVNE-TELNAIISAK----N
EIF3K_CAEBR       MIKPMAG---FEDAIKHYACRVISVTFQNIEKKLLSSLLGGASD-KEVTALAKKF----G
EIF3K_CAEEL       MIKPMVG---FEDAVKHYACRVISVTFQKIEKKMLSRLLGGASD-KEVTALAQSF----G
A9UW43_MONBE      LFVTVVG---FVETIREYAAYIIQSTYQHVSVDVVREMTNIKDA-AALEEFAKSH----E
EIF3K_DICDI       FFSEIPS---FIDNIRNFISGVLSITYQNISITMLGELLNLSDR-TQLVDYIQSKQ--PT
F0ZSE2_DICPU      FFSEIPA---FTNNIRNFISGVLSITYQNISLSMLGELLNLPSQ-EQLVEYIKTKQ--TT
D3B6R0_POLPP      FFSVIPS---FVDSVRNFVSNVLSITYQTITITMLVELLNIQ-Q-GGLDEFMSTK---PS
C5WVR8_SORBI      ILEAVPG---FEQAIQSYAIHVLSLTYQKVPRPILAEAINIE-G-LALDKFLEYHAANSG
D7TC95_VITVI      IVEVVPG---FEQAIQAYAIHVLSLTYQKVPRTVLAEAINIE-G-LSLDKFLEHQVANCG
EIF3K_ARATH       ILEAVPG---FEQAIQAYASHLLSLSYQKVPRSVLAEAVNMD-G-ASLDKFIEQQVTNSG
A9RDQ6_PHYPA      ILEVVPG---FEQAIQGYAIHVLSITYQRLPRTLFAEAINVE-G-LSLDKVLEHQVNNNG
A9T5D2_PHYPA      ILEVVPG---FEQALQGYAIHVLSITYQRLPRSILAEAINME-G-LSLDKFLEHQVNNNG
A8JHW7_CHLRE      LLGGIPG---FYESVRGFIAHTLVHTYGRVTKRTLADCLKLE-G-ATLEQYLSEKCKSAG
D0MYZ2_PHYIT      --EKVPG---FLESVRAYILTAISRSHSAISTEVFKAKLNVSD---KEVAEIVAAE---K
H3GXI5_PHYRM      --KKVPG---FLESVRAYILTAISRSHSAISTEVFKAKLNVSD---KEVADIVAAE---K
EIF3K_EMENI       LVADVAG---FEELVRIRIAVEVGKAFREVNAEVLEQWLDVRNS-EALEKFVTEVC---S
EIF3K_ASPFU       LVADVAG---FEELVRIRIAIEVGKAFREINAEVLEQWLDLRSR-EALEKFVTEVC---S
C0NGT3_AJECG      LVADVAG---FEELVRVRIAVEVGKAFREIGADVLAQWLDLNGL-EALEKFVVDVC---G
EIF3K_PHANO       LIADVSG---FEELMRVRIAATVSQAVREVDRSILESWLNLEG--SDFEHFVGSVC---G
EIF3K_SCLS1       LIADVSG---FEELIRIRIASTISQSVREIPSSELENWLGMNG--EAFEKFIKEVC---G
D5GGJ4_TUBMM      LITDCAG---FEELIRLRIASTTAQSNREINRELLEGWLNLTA--DGFESFIKGSC---G
C7YPB6_NECH7      LIADIPD---FEDLIRHRIALLVSQAFRELKLSHLESWLGLDNE-EATKKFVTEVA---G
EIF3K_NEUCR       LTTDIAG---FEDMIRVRIAQLVGQSYREIQFPVLESWLGLNNS-EATTQFITETC---G
EIF3K_YARLI       ITADVAD---FENLVRISITRAVDISSQAIHKDVFRSWLNLSD--NKFADYVKEL----G
A8PZL8_MALGO      YTSKVAH---FEDDIRKVALYSVKGAFRTISESRLSGYLHLEG--EALARFIENQR---E
EIF3K_USTMA       YAAKISE---FENAARRVALNSVKGSFTSISEKRIANYLNLSG--SQLAEFINAQ-----
A8N1Y1_COPC7      YTVEVVG---FENAIRQIAIRAVTATFTHITSQRLGSYLNLDG--EDLAEYIQQL-----
EIF3K_CRYNJ       YLPQHAS---PLDDFRFIFSASIASCFRRISLSQLSRWLDIPS--DKVGEWCSKV-----
Q4XW53_PLACH      FLQNYNN---FTCNIRKYILNSITLSFEKISIKQI-EYLNMENA-EEIEKLLSEN----K
Q7RFX1_PLAYO      FLQNYNN---FTCNIRKYILNSITLSFEKISIKQISEYLNMENV-EEIEKFLNEN----K
B3L493_PLAKH      FLANHEI---FITNIRKYIINCITLSFENISLENMAAYLNFQDM-NELEAFLNEN----K
A5KBB9_PLAVS      FLANHDS---FICNVRKYILNCITLSFENISLQNMATYLNYKDM-NELEKFLNEN----K
Q9NFE6_PLAF7      YLKNDKN---FICNIRKYILNTISISFESIYLKNMSEYLNIQDN-TQLEQFLNEN----K
G4LUZ0_SCHMA      IFSAIPG---FRESVCKFIVQIISQTYQRISKPLLMSFLDMSEN--DLKQFIKQL----E
F4NRP5_BATDJ      FTGDYSL---FDDNIREFIAQTLSITYQTISIESLEKMLDLSDE--DLADWVKMRE---S
E3L1E7_PUCGT      VVGSIGQ---FADLVRRSIGRSVASCFRSIDRTRLAAYLNLTDP-ALLQKWIETQ----A
Q5CU68_CRYPI      KVEKIQG---FYDSIRDIIIYSVNCSHSCISTAVLSELLDFPKDSTELKNIIEKN----K
S7UXN8_TOXGG      DVVSTPG---LVDSIRRFVCDVVSLTYSALSLADLCAFLNVVPGTSEAERLLKNLGWTVE
B8BVJ5_THAPS      LLSNAVNGSSASNQIRINMIQMLARTYRSAPLSSVLGALDLKDV-ESLKGFSSKVMLVAG
                                                                              

Q4UE04_THEAN      PSYKREDE--------------DSGLCYSTSREDSSKVHKSNANQNPLEKYLKSDPMKYY
Q4N5I7_THEPA      SSYNREDE--------------NSGLCYSTSREDSSKVHKSNATQNPLEKYLKSDPMKYY
A7ANU7_BABBO      GGYNRDDP--------------NSGTCVPPTRDEVIKQHMAQDKEPGVEKYFKLDTMRTY
EIF3K_BOVIN       WSA-DESG------------------QIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
G1PFG2_MYOLU      WSA-DESG------------------QIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
G1LUE5_AILME      WNA-DESG------------------QIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
EIF3K_HUMAN       WSA-DESG------------------QIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
H0Y1U1_OTOGA      WSA-DESG------------------QIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
EIF3K_MOUSE       WSA-DESG------------------QVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ-
EIF3K_XENTR       WME-SENG------------------KIFVCNQEENIKPKNIVEKIDFDSVSGIMASSQ-
H3BH15_LATCH      WTE-AEPG------------------KIFICSQEENIKPKNIVEKIDFDSVSSIMATSQ-
EIF3K_DANRE       WTE-NEDG------------------QIFIHNQEESVKPKNIVEKIDFESVSSIMATSQ-
C3YGW5_BRAFL      WRD-DSEG------------------FVFLANQEENVKTKNIVEKIDFESVAGIMAAAIQ
EIF3K_AEDAE       WKE-DGQ-------------------YITVAVQEGNIKTKHITEKIDFENLAPLMANCL-
EIF3K_ANOGA       WKE-EGG-------------------LVTIATQEDNIKTKHITEKIEFDNLAPLMANCL-
EIF3K_DROME       WKN-QGQG------------------LVIVAMQDDKIKTKNITEKIEFDNVGALMAQCL-
EIF3K_DROPS       WKH-QGQD------------------LIVVAMQDDKIKTKNITEKIEFENVGALMAQCL-
EIF3K_BOMMO       WRD-DGS-------------------LIFIANQDENIKTKNITEKIEFDHLAPLMALL--
E0VVK8_PEDHC      WKD-QGS-------------------SVFIANQDENIKTKNITEKIDFESVAGIMATCK-
E9H0D0_DAPPU      WKD-LGNG------------------RVFITSQEDLVKTKNITEKIEFENVAGIMSHCI-
EIF3K_NEMVE       WMS-SDDG------------------TIYVTNQEAHIKSKNIAEKIDFASVANIIAAAR-
B3SCB7_TRIAD      WQR-VDNN------------------KIFLSNQELNSNSKNMSFKFEIDIINQLLSRSRF
EIF3K_CAEBR       WETKENGE------------------VFFVANHEGTIKTRNIDEKIQFSHVADLLTSNVP
EIF3K_CAEEL       WEAKENGD------------------VFFVANHEGTIKTRNIDEKIQFPHVADLLTSIQP
A9UW43_MONBE      WTK--EGD------------------NYMVSRKDDVVVSKTVVEKIEFGGELLLPIILSF
EIF3K_DICDI       WKISDST------------------VSLQSD-----NSKQKKADTFTFDQLSRILPTFIK
F0ZSE2_DICPU      WKINDST------------------VSLQSD-----TSKQKKADTFTFDRK---------
D3B6R0_POLPP      WKSNGTT------------------VSLQSD-----SVKQKKSDIFTFDRMYILSFKSHT
C5WVR8_SORBI      WVIEKG--------------GQSQVIVLPRNEFNHPELKKNTADIVPFEHVTRIFPVLS-
D7TC95_VITVI      WVLEKSQ-------------GKGQLIVLPPNEFNHPELKKNAADSIPLEHITRIFPILG-
EIF3K_ARATH       WIVEKE----------------GGSIVLPQNEFNHPELKKNTGENVPLEHIARIFPILG-
A9RDQ6_PHYPA      WALEKGG----------------KVVVLPLNEDNQPVLRRNTADSIPLEHVAKILPVLV-
A9T5D2_PHYPA      WALEKGGKVIYSC-------FCLQVVVLPLNEDNQPVLRRNTADSIPLEHVARILPVLV-
A8JHW7_CHLRE      WSIVNTP--------------AGEVVGLPKNDDNQ-SVVKRTQELIRFDQVAPMLKAVTV
D0MYZ2_PHYIT      WTVADNL-------------------IQINPNEDNQMQAKKVQENIEFEDVLKVIHTLSR
H3GXI5_PHYRM      WTVADNL-------------------VQISPNEDNQMQAKKVQENIEFEDVLKVIHTLSR
EIF3K_EMENI       WEVDKSG---------------SATVVKVPTNKENEARSEVKSERVGVDMFGRVIRRGFE
EIF3K_ASPFU       WEVDKTGP--------------NGTVVKVPTNKENEARSEVKSERVGVEMFGRVIRRGFE
C0NGT3_AJECG      WEVDKSAGSDL-----------TSAVIRVPKNKENEARGEIKGEKVGIEMFGRVLRRGLE
EIF3K_PHANO       WTIEGAK-------------------IKVPMNKDNEAKGTVVRENVKFDQFARVIKRAYE
EIF3K_SCLS1       WTIENGS-------------------VIVPLNKENEAKGTVVRENVKMEQFSRVIRRAYE
D5GGJ4_TUBMM      WAIEGDV-------------------VKIPLNKENEAKTTVTRENVKFDQFQRVIKRAYE
C7YPB6_NECH7      WSVEDDD------------------TVKVPSNPDNEAKKAEIREDVSVEQFSRVLRRSWE
EIF3K_NEUCR       WKVEGD-------------------VVQIPKNADNEARKAEIREDVNVDMFARVIKRSWE
EIF3K_YARLI       WKVEGET-------------------VVVPPNKENEAKPATTTESIKIEQISRLLKRTNE
A8PZL8_MALGO      EGWSL-----------------ANGTVAVPPNPDNEVKSTVVREEVSLERCRRRI-----
EIF3K_USTMA       DGWKL-----------------ADGTVSVPANPDNEIKATVIREEISLDQMHKFLAQAQS
A8N1Y1_COPC7      -GWSIDA---------------STGNVAVPPNPDNQIEATVVQEQIKLPQLTKVISHAIK
EIF3K_CRYNJ       -EWTVE-----------------GQDAVIPNNGQNDVKAGVVKENVQLGQLTKLVAAAGY
Q4XW53_PLACH      WIVKKIKNKDG----------EEQTICINENIENIQ-NRKNINTYFNDDNITSYINKLNS
Q7RFX1_PLAYO      WTVKKIKNKDG----------EEQTICINENIENIQ-NRKNISTYFNDDNVTSYINKLNS
B3L493_PLAKH      WTVKNAVHKD-----------EEMKICSNGNIETMQQSKKTINTYFNEDNISSYISKLNN
A5KBB9_PLAVS      WTVKKATHKE-----------EEVQVCSNGNIETMQQSKKSINAYFNEDNISSYINKLNN
Q9NFE6_PLAF7      WTIKMINHKG-----------KDEQICYNGNIETVQ-NKKNINTYFTEDNIGSYITKLNH
G4LUZ0_SCHMA      WSETTDDA-------------DHDQQLILVNNHEENIKSVQIRERVNFDSITSMSDAFRP
F4NRP5_BATDJ      WSVNADDD----------------SLIDLPITSWNQAKEIVMQEDVKFEQLGKILNRSRL
E3L1E7_PUCGT      WSLDADK-------------------VIIPNNSDNCPVTLVIRENTTIDDLQQFITKSVV
Q5CU68_CRYPI      WILDSACE----------------IIRIPLPENPIENVDSNANKNKSLGCNEVIFKNYLN
S7UXN8_TOXGG      EVFVPAKEAARSRETVKVVRVVGSASLAAAALKEGEERNRNRDGKPGAAGQALAVRKTVE
B8BVJ5_THAPS      GGEG----------------------EVTGTENEIPIVEKIEGDLLLLPRRLRIARGLGQ
                                                                              

Q4UE04_THEAN      YNTLHN----------------
Q4N5I7_THEPA      YTTLHN----------------
A7ANU7_BABBO      YSTLKGASG-------------
EIF3K_BOVIN       ----------------------
G1PFG2_MYOLU      ----------------------
G1LUE5_AILME      ----------------------
EIF3K_HUMAN       ----------------------
H0Y1U1_OTOGA      ----------------------
EIF3K_MOUSE       ----------------------
EIF3K_XENTR       ----------------------
H3BH15_LATCH      ----------------------
EIF3K_DANRE       ----------------------
C3YGW5_BRAFL      R---------------------
EIF3K_AEDAE       ----------------------
EIF3K_ANOGA       ----------------------
EIF3K_DROME       ----------------------
EIF3K_DROPS       ----------------------
EIF3K_BOMMO       ----------------------
E0VVK8_PEDHC      ----------------------
E9H0D0_DAPPU      ----------------------
EIF3K_NEMVE       ----------------------
B3SCB7_TRIAD      PSMF------------------
EIF3K_CAEBR       PLAF------------------
EIF3K_CAEEL       PLTL------------------
A9UW43_MONBE      CVT-------------------
EIF3K_DICDI       ----------------------
F0ZSE2_DICPU      ----------------------
D3B6R0_POLPP      VYSYINTITYHYCYSF------
C5WVR8_SORBI      ----------------------
D7TC95_VITVI      ----------------------
EIF3K_ARATH       ----------------------
A9RDQ6_PHYPA      ----------------------
A9T5D2_PHYPA      ----------------------
A8JHW7_CHLRE      GF--------------------
D0MYZ2_PHYIT      ----------------------
H3GXI5_PHYRM      ----------------------
EIF3K_EMENI       QAA-------------------
EIF3K_ASPFU       QAA-------------------
C0NGT3_AJECG      QPA-------------------
EIF3K_PHANO       QPA-------------------
EIF3K_SCLS1       QPA-------------------
D5GGJ4_TUBMM      QPA-------------------
C7YPB6_NECH7      DTV-------------------
EIF3K_NEUCR       ESA-------------------
EIF3K_YARLI       ----------------------
A8PZL8_MALGO      ----------------------
EIF3K_USTMA       PLLRA-----------------
A8N1Y1_COPC7      A---------------------
EIF3K_CRYNJ       ----------------------
Q4XW53_PLACH      ----------------------
Q7RFX1_PLAYO      ----------------------
B3L493_PLAKH      ----------------------
A5KBB9_PLAVS      ----------------------
Q9NFE6_PLAF7      ----------------------
G4LUZ0_SCHMA      SKSDFFIKTTYNNHNNNHIHTK
F4NRP5_BATDJ      VV--------------------
E3L1E7_PUCGT      C---------------------
Q5CU68_CRYPI      LLSNN-----------------
S7UXN8_TOXGG      KYMMPENLKVCMATLLK-----
B8BVJ5_THAPS      LSRRG-----------------