CLUSTAL format seed alignment for MF_03011

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EIF3L_HUMAN       ---------------------------------------MSYPADDYESEAAYDPYAY--
EIF3L_PANTR       ---------------------------------------MSYPADDYESEAAYDPYAY--
EIF3L_BOVIN       ---------------------------------------MSYPADDYESEAAYDPYAY--
EIF3L_MOUSE       ---------------------------------------MSYPADDYESEAAYDPYAY--
EIF3L_CHICK       ---------------------------------------MAYPGEDYDNDAAYDPYAY--
EIF3L_XENTR       ---------------------------------------MSYANE--EFEGSYDPYNY--
EIF3L_DANRE       ---------------------------------------MSYPAE--EEDVNYDPYSY--
H2ZZ48_LATCH      ---------------------------------------MSYNDD---YDGDCDSSEY--
C3ZJN8_BRAFL      ----------------------------------------MYGGEDYQEYDQYGQHPYGP
E9GER2_DAPPU      -----------------------------------------------MYAEEFEDYEY--
EIF3L_NEMVE       ---------------------------------------------MYTQADEYDGGDAGY
EIF3L_AEDAE       ---------------------------------------------MYSNENYAEEG----
EIF3L_ANOGA       ---------------------------------------------MYSNEEPWEGG----
EIF3L_DROME       ---------------------------------------------MYGGDEYATNSDY--
EIF3L_DROPS       -------------------------------------------MSKYSGEEFSNNGDF--
EIF3L_CAEBR       ----------------------------------------------MSRRVEFDMSHE--
EIF3L_CAEEL       ----------------------------------------------MSRRVEFDLSTE--
EIF3L_EMENI       ------------------------------------------------------------
EIF3L_ASPFU       ------------------------------------------------------------
C0NVD9_AJECG      ------------------------------------------------------------
EIF3L_NEUCR       ------------------------------------------------------------
C7Z9P8_NECH7      ------------------------------------------------------------
EIF3L_SCLS1       ------------------------------------------------------------
EIF3L_PHANO       ------------------------------------------------------------
D5G6D3_TUBMM      ------------------------------------------------------------
EIF3L_YARLI       ---------------------------------------------MDSDEEFIDNSLAVG
EIF3L_CRYNJ       -----------------------MADPSAFYEPEED-----ELLSQLAIPVQNYQPLSEG
A8NN22_COPC7      ----------------------MSQQRMALWAAEADI----DEDVDLSLAIGNYGQ----
EIF3L_USTMA       MVADASQQGQSNGAAFNQQQQYQQQQQRQLFGGEEEFGDEEELGDDVDLVVGDYSAAFAG
F4NY56_BATDJ      ---------------------------MDTYD-EGD-----VPAEGIELPTVFATA----
F4JY76_ARATH      ---------------------------------------------------------MAS
F6H2Y0_VITVI      ---------------------------------------------------------MAS
C5XJP4_SORBI      --------------------------------------------------------MAAA
A9TY01_PHYPA      ---------------------------------------------MAYDGNRDFGGGYDD
A9TEY6_PHYPA      ---------------------------------------------MAYDGNRDFGGGYDD
A8IQV5_CHLRE      ------------------------------------------------------------
H3GMF5_PHYRM      ------------------------------------------------------------
D0NVK9_PHYIT      ------------------------------------------------------------
EIF3L_DICDI       -----MSQTNNAGTTNTNTNQNNNRKGGNNKNYQNRNNNNQQQQGGQQQQQQQ------H
F0ZBR7_DICPU      -----MSQ--------------NNRKGGNKNFQKNNQNNNNNQQGGQQQQQQ--------
D3BGB9_POLPP      -----MESSS---APVAEQQQQQQQQQGGRPQHQRKNNNNQQRQGGQQRNNQQGGNNNRQ
Q4N5P3_THEPA      ------------------------------------------------------------
Q4UDV1_THEAN      ------------------------------------------------------------
A7AN02_BABBO      ------------------------------------------------------------
B3L7T1_PLAKH      ------------------------------------------------------------
A5K1W2_PLAVS      ------------------------------------------------------------
Q7RAI1_PLAYO      ------------------------------------------------------------
A4HNN3_LEIBR      ------------------------------------------------------------
A4ICW2_LEIIN      ------------------------------------------------------------
Q38BD7_TRYB2      ------------------------------------------------------------
EIF3L_MONBE       ------------------------------------------------------------
B8C720_THAPS      ------------------------------------------------------------
Q5CTX7_CRYPI      ------------------------MSFQIVPDQLEEVEEDVNTAIAVAVSTSRNALLEIG
Q23T76_TETTS      ----------------------------------------MSTSKYQSILESNELPVNLD
A0C6C9_PARTE      -------------------------------------MNNIYIQQIIINYNQFLMYEQEL
                                                                              

EIF3L_HUMAN       PSDYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_PANTR       PSDYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_BOVIN       PGDYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_MOUSE       PGDYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_CHICK       SNDYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_XENTR       QADYDMHTG-DPKQDLAYERQYE------------------------QQTYQVIPEVIKN
EIF3L_DANRE       PNDYDYHTG-DPKADLAYERQYEH-----------------------QQTYHVIPEVIKN
H2ZZ48_LATCH      QSDYDLHTGRDPKQDLAYERQYE------------------------QQTYHVIPEVIKN
C3ZJN8_BRAFL      PESYELHTG-DPRADLEYERQFQQ-----------------------APPAYIVPDVIKR
E9GER2_DAPPU      EADAYEPTG-DPRLDAENERYTSYGS-------------------APQYAQYSMPDVIKK
EIF3L_NEMVE       EDDYSGYQG-----DGDD-----------------------------SVGSYNVPEEIKR
EIF3L_AEDAE       -YEDYGYDA-GMIDDG-YDRSYYP-----------------------------MHEDVKK
EIF3L_ANOGA       -YDEYGYEM-GMPEDGMYDRGYFP-----------------------------MHEDVKK
EIF3L_DROME       -YDDYAHTG-DPQLDMEYERNYYAA---------------------------RMPDNVKY
EIF3L_DROPS       -YDDFAHTG-DPALDMEYERNYYAS---------------------------RMPENVKY
EIF3L_CAEBR       --DHTDRRRTNTFSS--EEDG--------------------------------VPNEVAD
EIF3L_CAEEL       --DHSDRRRTNTFSSSADEDG--------------------------------VPNEVAD
EIF3L_EMENI       ------MSYDER---ANAHPNLND---------------------------ESDVEEEAL
EIF3L_ASPFU       ------MSYEER---VNAHPNLGD---------------------------ESDVEEEAL
C0NVD9_AJECG      ------MAFDSNR-TSGRHANLHD---------------------------ESDVEEEAL
EIF3L_NEUCR       ------MSAFQQ--AQAPARAIDP---------------------------DSDVEEEAL
C7Z9P8_NECH7      ------MATYQN--GVAPARAIDD---------------------------DSDVEEEAL
EIF3L_SCLS1       ------MSAFQN--GGIASRALDD---------------------------DSDIEEEAL
EIF3L_PHANO       ------MSLPQHQNRDAARRAPDD---------------------------DDDAEEETM
D5G6D3_TUBMM      ------MLAGQNF--NGTNRHLRE---------------------------DSDTDDEVL
EIF3L_YARLI       DIVYDEAQIAQQQQEYAAQLKLAS---------------------------TAIPTVVKD
EIF3L_CRYNJ       DEYRRLQQLEQHAYAQQTAMAQEQEM-------------------EQLAVLELIPEDVKR
A8NN22_COPC7      NDHYEDAPIPQPQIDESTLLAMQQHM-------------------AQQAAFAQIPDVVKG
EIF3L_USTMA       EAGAEVDEAQAAALAAAHAQAQQQ---------------------AQAAALAAVPDQIRK
F4NY56_BATDJ      -----QFTAALEGFDTVTALSSQD-----------------------AQQQVKIPSPVAQ
F4JY76_ARATH      SNEYEE--GPGER-----ESGYD---------------------------PNMVPDSVKS
F6H2Y0_VITVI      SYDHED--VQSQSQVD--PLGYD---------------------------PNYVPDSVRT
C5XJP4_SORBI      PYDREDGLPPSVPPHA--ADAYD---------------------------PNYVPDSVKT
A9TY01_PHYPA      SYDDRPEFRDGFRDLQPPEPGFDT--------------------------ANYVPDVVRT
A9TEY6_PHYPA      SYDDRPEFRDGFRDLQPLEPGFDT--------------------------TNYVPDVVRT
A8IQV5_CHLRE      ------------------MGGLQE--------------------------FYTVPDIVKQ
H3GMF5_PHYRM      ---------------MTDRRDEKP-------------------------ADFLLPETVKS
D0NVK9_PHYIT      ---------------MADRRDEKP-------------------------ADFLLPETVKS
EIF3L_DICDI       RNKHQNQQGNQNQQGNQQGGGNQQQNKQGGHRGG------KTPSNVESFPINLSQQQVQQ
F0ZBR7_DICPU      -GGHQKHHNKHNQQNNQQQGGQQQ-----GKGRG------KAPTNVESFPINLTPQQIQQ
D3BGB9_POLPP      AGGGKNRNQNNHQQGGQQQDGQQQQQQQGGQGQQQGGKHRKPPANVESFPISLNPQQLQQ
Q4N5P3_THEPA      --MDNNDSFRQTLATDGPQRTVTQ--------------------------LLPIEPEVVD
Q4UDV1_THEAN      --MDNNDSFRQTPISDGPQRTFTQ--------------------------LLPIEQEVVD
A7AN02_BABBO      --MSSEEFTRQINGSDSPQRGFGG--------------------------LIPRETEVVD
B3L7T1_PLAKH      ---------MAEYGDGENAAGSHM--------------------------LVSFEEEVET
A5K1W2_PLAVS      ---------MAEYLEGEGGAGAEK--------------------------PVSFEEEVET
Q7RAI1_PLAYO      ----------MNPVQAENNAVEER--------------------------IVSFEEEVET
A4HNN3_LEIBR      ---------------MATNPDI----------------------------ETDIPRDVYQ
A4ICW2_LEIIN      ---------------MATNPDI----------------------------ETDIPRDVYQ
Q38BD7_TRYB2      ---------------MASNPDS----------------------------KLHIPDEMFN
EIF3L_MONBE       ---MEQETFEEQEITVADINA-------------------------------NVPQEVQN
B8C720_THAPS      -----------------------------------------------MASDDLFPDSVKD
Q5CTX7_CRYPI      INEEEEETPMSQNANIESQLQTQQSY----------------------NSETSFPDEVQS
Q23T76_TETTS      ELPNFKIKVPSQDIFASYYSASSD--------------------------SEVQMQVAVL
A0C6C9_PARTE      PSNLDDFPNYNLKQSTESEKVVVD--------------------------DDQKKKAAYQ
                                                                              

EIF3L_HUMAN       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_PANTR       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_BOVIN       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_MOUSE       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_CHICK       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_XENTR       FIQYFHKTVSDLI-------------DQKVYELQASRVSSDVIDQKVYEIQDIYENSWTK
EIF3L_DANRE       FLQYFHKTISDLI-------------DQKVYELQANRVSSESIEQKIYEIQDVYENSWNK
H2ZZ48_LATCH      FLQYFHKTVSDLI-------------DQKVYELQANRVSSELIEQKVYEIQDVYDNSWNK
C3ZJN8_BRAFL      FIEYFHKCVTD---------------------------------GNVFEIGNIYENSFNK
E9GER2_DAPPU      FIIYFREMVNS---------------------------------GKLYEIQNVYENTFPK
EIF3L_NEMVE       FIHFFHQHVLE---------------------------------QNLYEIQSIYENGFNK
EIF3L_AEDAE       FLVYFSSVIKN---------------------------------GVVYEIQNLYENTFPK
EIF3L_ANOGA       FLMYFCTVIKD---------------------------------GVVYEIQNLYENTFPK
EIF3L_DROME       FLINFCQAIKE---------------------------------GNLYDIQNMYENTFPQ
EIF3L_DROPS       FLMNFCQAVKE---------------------------------GNLYDIQNMYENTFPQ
EIF3L_CAEBR       YLVYFSRMIDE---------------------------------QNVPEILTLYDQAFPD
EIF3L_CAEEL       YLVYFSRMVDE---------------------------------QNVPEILTLYDQAFPD
EIF3L_EMENI       VNDYREQVNFDD---------------------------------GMSELDRTTSLGAAS
EIF3L_ASPFU       VNDYREQVNFDD---------------------------------GMSELDRTTSLGTGS
C0NVD9_AJECG      VNDYREQVHFDD---------------------------------GMSELDRTTSLGAGS
EIF3L_NEUCR       VNDYKEQVQYE----------------------------------EDD--AESTQMSLAA
C7Z9P8_NECH7      VAEYKEHVQYE----------------------------------DGDDLSRTTSLNLAQ
EIF3L_SCLS1       ANDYKEQVQYE----------------------------------GMEELEQVNSMSMAQ
EIF3L_PHANO       ANDYREQVQYD----------------------------------GMDDMDRMPSIS---
D5G6D3_TUBMM      ASTLVEEALRDD---------------------------------GDYDDLESAGGSLQI
EIF3L_YARLI       FIQYFHRCLSDN---------------------------------SVYELHGCYENSFGK
EIF3L_CRYNJ       FLVMFHQAILEN---------------------------------DLPTITSMYESGWNK
A8NN22_COPC7      FIVHFHQAVLDN---------------------------------NLAEITVAYESGWNK
EIF3L_USTMA       YVVLFNQAVQIN---------------------------------NVQDISNAYEGTWNR
F4NY56_BATDJ      FLTQFHAHLVER---------------------------------NTWELHAFYENSFNQ
F4JY76_ARATH      FVSHMYRHIRDK---------------------------------NVYEIHQMCETSFQS
F6H2Y0_VITVI      FVVHLYRHIREK---------------------------------NVYEIHQMYESSFQT
C5XJP4_SORBI      FVVHLYRHIRDK---------------------------------NVYEIHQMYEGGFQR
A9TY01_PHYPA      FVVYLYRHIREK---------------------------------NVYEIHQMYEGSFQK
A9TEY6_PHYPA      FVVYLYRHIREK---------------------------------NVYEIHQMYEGSFQK
A8IQV5_CHLRE      WAHYFYRHIRER---------------------------------NIPEIQSMYEISFLK
H3GMF5_PHYRM      WFSHLYTHLISG---------------------------------NVTEMARLYDREFHN
D0NVK9_PHYIT      WFSHMYTHLISG---------------------------------NVAEMARLYDREFHN
EIF3L_DICDI       LQAYQQQTQQNQS-AQFQSNFLPPATALYTPVINYFINLYNNFKSQSHQDILVSYDSFFK
F0ZBR7_DICPU      FQTYQQQIQSNPS-PQFQSNYLPPATALFTPVINYFINLYSNFKSQSHQDILVSYDSFFK
D3BGB9_POLPP      LHQYQQAQQAQQQGSNQFLNFLPPATVLYTPVVNYMITFLNNFRSQSHQDILLSYDNFFR
Q4N5P3_THEPA      FLVRLHDNLYRK---------------------------------NAEALKNLYEQELNV
Q4UDV1_THEAN      FLVRLHDNLYRK---------------------------------NAEALKNLYEQELNV
A7AN02_BABBO      FLLRFCDGLHHR---------------------------------NAEVVKALYEQELIT
B3L7T1_PLAKH      FLINLHDFVYHR---------------------------------NAEAIKKLFDTDFYA
A5K1W2_PLAVS      FLINLHDFVYHR---------------------------------NAEAIKKLFDTDFYA
Q7RAI1_PLAYO      FLINLHDFVYHR---------------------------------NAEAIKKLFDTDFYT
A4HNN3_LEIBR      FFRGLNRAVERR---------------------------------DAAAMHELYESQFDA
A4ICW2_LEIIN      FFRGLNRAVERR---------------------------------DAAAMHDLYESQFDA
Q38BD7_TRYB2      FFNSLNTAVDTG---------------------------------DISSFHNLYENIFPS
EIF3L_MONBE       YLRSFNKAIQEK---------------------------------SLKEIEEHYEYKWRR
B8C720_THAPS      FVFDLHDVSRRS--------------------------------FIPSEQHSLYVGSFRD
Q5CTX7_CRYPI      FLINLNDSISRR---------------------------------DVDRIRYFNENLHNN
Q23T76_TETTS      FINELDKLIKEK---------------------------------NTDGLLVLYDVQFNK
A0C6C9_PARTE      FMQSLEKNLRTKIS------------------------SPQQRVQTLAVSLELYDTIFNK
                                                                              

EIF3L_HUMAN       -LTERFFKNTPWPEAEAIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPS
EIF3L_PANTR       -LTERFFKNTPWPEAEAIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPS
EIF3L_BOVIN       -LTERFFKNTPWPEAETIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPS
EIF3L_MOUSE       -LTERFFKNTPWPEAEAIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPS
EIF3L_CHICK       -LTERFFKNTPWPEAEAIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPT
EIF3L_XENTR       -LTERFFKNSPWPEAEAIAPQVG--------NDAVFLILYKELYYRHIYAKV---SGGPT
EIF3L_DANRE       -LTDRFFKTSPWPEAEAIASLVG--------NDAVFLILYKELYYRHIYAKV---SGGPT
H2ZZ48_LATCH      -LTDRFFKSSPWPEAEAVAPVVG--------NGCVFFCNYLELLFKFLFQ------GGPT
C3ZJN8_BRAFL      -LTERFFKTSPWPEAEYIMPLVK--------NDTVFLILYKELYFRHIYAKV---QGGPN
E9GER2_DAPPU      -LTEEHFKSSPWPDADEVSPLVD--------DDQPFLILYKELYYRHIYARI---QGGPT
EIF3L_NEMVE       -LTDRYFNKTPWPEAEFIAPLVS--------GDQVFLILYKELYYRHIYNKL-----KPT
EIF3L_AEDAE       -LSEQHFEKKAWPSEEEVAHLVD--------NDSLFMILYKELYYRHLHARI---QKGPS
EIF3L_ANOGA       -LSEQHFEKKAWPSEEEVAHLVD--------NDNLFLILYKELYYRHLHARI---QGGPS
EIF3L_DROME       -ISDHHFDKTAWPEEQEVAAIVD--------NDKVFLILYKELYYRHIHARI---PGGPK
EIF3L_DROPS       -ISDHHFDKSSWPEETEVGALVE--------NDKVFMILYKELYYRHIHARI---PGGPK
EIF3L_CAEBR       -LTERFFRDRMWPDENVVERIIGP-------GNKLFIILYKELYYRQLYARN---ARGPL
EIF3L_CAEEL       -LTERFFRDRMWPDENVVERIIGP-------GNKLFIILYKELYYRQLYARN---TRGPL
EIF3L_EMENI       -QTQDLQ-----AQLAAAATPLE---------------------------------YQAT
EIF3L_ASPFU       -QTQDLQ-----AQLAAAATPLE---------------------------------YQAT
C0NVD9_AJECG      -QTQDIQ-----AQLVAAATPLE---------------------------------FQAT
EIF3L_NEUCR       -QTDDIQ-----SRLAAAAQPLD---------------------------------YSAG
C7Z9P8_NECH7      -QTDDIQ-----ARLVQAAQPLD---------------------------------FQAP
EIF3L_SCLS1       -QTDDIQ-----SRLAAAAQPLD---------------------------------FSAP
EIF3L_PHANO       -NNQDIH-----AQLQAAATPLE---------------------------------FQAT
D5G6D3_TUBMM      -SGENIQ-----QRLAAAATPLD---------------------------------FQAP
EIF3L_YARLI       -LTDKFYKNSHWPHPVAQVAPLVK-------NDPVFLYFYSELYYRHLYAK-----LTPT
EIF3L_CRYNJ       -LTQAHYLNNEWPEAELIAPLVG--------NDQVFLTLYRELYFRHVYAR-----LQPT
A8NN22_COPC7      -YTEKFYARTEWPEAEVIAPLVN--------DDPIFLILYRELYYRHVYSR-----LQPN
EIF3L_USTMA       -LTDKFYARSEWPEAETIAPLVN--------DDQKFLTLYRELWYRHVYSR-----LSPD
F4NY56_BATDJ      -LTEKFYAKASWPEADTISHLVN--------DDPTFLILYKELYYRHLYSK-----MQPT
F4JY76_ARATH      -ISERLFKDTPWPSVEAIAPYVD--------NDHVFCLLYREMWFRHLYAR----LSP-T
F6H2Y0_VITVI      -LSDRLFKETPWPSVDAVAHHVD--------NDHVFCLLYREMWYRHLYAR----LSP-T
C5XJP4_SORBI      -LSDRLFRDAPWPSAEAVAPYCD--------GDHVFLLLYRELWYRHAHAR----LSPLT
A9TY01_PHYPA      -LSDRLFKQSNWPIVDMIAPYVE--------NDHVFCLLYKEMWFRHVYAR----LQP-T
A9TEY6_PHYPA      -LSDRLFKQSKWPAVEMIAPYVE--------NDHVFCLLYKEMWFRHVYAR----LQP-T
A8IQV5_CHLRE      -LSDRYYKASPWPEVQHIAEVVD--------HDHVFCLLYKEMYFRHLYAR----CQP-T
H3GMF5_PHYRM      -LTNNYFKQASWPEPSAVQSLVD--------EDPTFLLLYKQIYFRHLFSR-----LQPG
D0NVK9_PHYIT      -LTNNYFKQASWPEPSAVESLVD--------EDPTFLLLYKQIYFRHLFSR-----LQPG
EIF3L_DICDI       -SCETYYPHCALPTIENLIPILGDKFEESSFTDRFFVLLYKEIYYRYYYAL----VFQPN
F0ZBR7_DICPU      -ACETYYPHCSLPTIENLLPVLGDKFEDS-FTDRFFVLLYKEIYYRYYYAL----VFQPN
D3BGB9_POLPP      -SCEIYYPNCALPTVEVFLALLGDRIDENNFTDKFFILLYKEIYYRYYYAR----VSQPN
Q4N5P3_THEPA      -ITDKYFKSSRWPSISDVAGFYSQSGR----FHNLIMALYAEIYYRHAFYL-----GEAS
Q4UDV1_THEAN      -ITDKYFKSSRWPSISDVAGFYSQSGR----FHNLIMALYAEIYYRHAFYL-----GEAS
A7AN02_BABBO      -ITENHFKTTRWPSIAAVAGFYSQSGR----LHSLIMALYSEIYYRHVFYL-----GDVT
B3L7T1_PLAKH      -ISEIYFKNIRWPSIKLVDIFYKQKNR----FHNLIHSLYEELYYRHVFII-----NDVT
A5K1W2_PLAVS      -ISEIYFKNIRWPSIKLVDVFYKQKNR----FHNLIHSLYEELYYRHVFII-----NDVT
Q7RAI1_PLAYO      -ISDLYFKNIRWPSIKLVDLFYKQKNR----YHNLIHSLYEELYYRHVFII-----NDVT
A4HNN3_LEIBR      -LTKNYYMAGHGQFRSWPALRLEQVSSCFR-GNRMAELVYSFLFYKHLFMDN----RSVR
A4ICW2_LEIIN      -LTKNYYMAGHGQFRSWPALRLEQVSSCFR-GNRMAELVYSFLFYKHLFMDN----RSVR
Q38BD7_TRYB2      -HLSKYYAAEQGEFRPLPVLQRMEVAECF--GNDTAGKLYSFLCFKHLFTD-----RDVT
EIF3L_MONBE       -TTDQYFKDSRWPEPVYIQAMFEQEGQ----EDSYFVSLYPELYYRDVYYRSSNTNIEIT
B8C720_THAPS      -VTAKYFPTSAWPTPAQISSECG--------GDPLFLSLYAELTLRHLQSVK-----RPN
Q5CTX7_CRYPI      -LTFKYYMKSRWPNPSVVENLIDSFNN----YSELTKLLYIEQYYRHIFAKF---PNHVK
Q23T76_TETTS      -ICSSVFKESAWPAPHEIELYQDKE------IDIDIAYLYSELCYRHALARL---QNSFD
A0C6C9_PARTE      IYCNTLYKDTLFPLAESLEEAFNDE------FDSITKLLFNESCYRHAFQSV---QQQFN
                                                                              

EIF3L_HUMAN       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_PANTR       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_BOVIN       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_MOUSE       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_CHICK       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_XENTR       LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
EIF3L_DANRE       LDQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
H2ZZ48_LATCH      LEQRFESYYNYCNLFNYILNA---------------------DGPAPLELPNQ-------
C3ZJN8_BRAFL      LEQRFESYYNYCNLFNYILNQ---------------------KSPAPLELPNQ-------
E9GER2_DAPPU      IEQRFESYYNYCQLFNHILSA---------------------KSPVVLELPHQ-------
EIF3L_NEMVE       VEQRFESYYNYCDLFNYILNT---------------------DEPVPLTLPNQ-------
EIF3L_AEDAE       LEQRLNSFYNYCNFFNHILPS---------------------KEPVQLELPDI-------
EIF3L_ANOGA       LEQRLNSFYNYCNFFNYILPS---------------------KEPVQLELPDI-------
EIF3L_DROME       LEQRINSFFNYCDFFNLIISA---------------------QNPVMLELPDI-------
EIF3L_DROPS       LDQRINSFFNYCDFFNLIISA---------------------PNPVMLELPDI-------
EIF3L_CAEBR       LVHRYESFMNYQELFSELLSS---------------------KDPIPLSLPNV-------
EIF3L_CAEEL       LVHRYESFMNYQELFSELLSS---------------------KDPIPLSLPNV-------
EIF3L_EMENI       LETKFASYDNYCSLFHYILNS---------------------DGPVELEVPSYY------
EIF3L_ASPFU       LETKFASYDNYCSLFHYILNS---------------------EGPVELEVPSYY------
C0NVD9_AJECG      LETKFASYDNYCSLFHYILNS---------------------DGPVDLDVPTYF------
EIF3L_NEUCR       LEVKFSSYDSYCSLFHFILNS---------------------EGPVDLEPPSYY------
C7Z9P8_NECH7      LETKFQSYDAYCSLFHYILNS---------------------DGPVDLEPPSYY------
EIF3L_SCLS1       LEVKFASYDNYCSLFHFILNS---------------------DGPVDLEPPSYY------
EIF3L_PHANO       LETKFASYDNYCNLFHYILNS---------------------EGPVDLEVPNYY------
D5G6D3_TUBMM      LQNRFDSYDNYCTLFHFILNS---------------------DGPVDLELPTYY------
EIF3L_YARLI       PLERFESYSNYCNLFNYILNS---------------------DGPVDLELPTS-------
EIF3L_CRYNJ       IDDRFQSYENICELFNYLLNS---------------------EGPVPLDLPIQ-------
A8NN22_COPC7      IDDRFHSYENSCELFNYLLNS---------------------DGPVQLELPEQ-------
EIF3L_USTMA       GEDRFHSYDNYCDFFNFVLNS---------------------DGPVQLELPAQ-------
F4NY56_BATDJ      LDDRVRSYTNYCDLFNFILNSS--------------------DEPCELDLPSQ-------
F4JY76_ARATH      LKQRIDSYDNYCSLFQVVLHG-----------------------VVNMQLPNQ-------
F6H2Y0_VITVI      AKQRIDSWDNYCSLFQVVLHG-----------------------VVNMQLPNQ-------
C5XJP4_SORBI      AAHRAESWTNYCDLFSVVLHG-----------------------VVNMQLPNQ-------
A9TY01_PHYPA      LEQRCDSWDNYCNLFQVILHG-----------------------NVNMQLPNQ-------
A9TEY6_PHYPA      LEQRCDSWDNYCNLFQVILHG-----------------------NVNMQLPNQ-------
A8IQV5_CHLRE      LRDRCESWDNYIDLFGLLLTS-----------------------NVNMQLPNI-------
H3GMF5_PHYRM      MDMKVASWETYCAIFDGVLDG-----------------------SLELEALPSQ------
D0NVK9_PHYIT      MDMKVASWETYVAIFDGVLDG-----------------------SLELEALPSQ------
EIF3L_DICDI       INTCVESWQNYYQIFHTLLSANS-------------------PNDVEIDLPNA-------
F0ZBR7_DICPU      ITTCVESWQNYYQIFHTLLSANS-------------------PNDVEIDLPNA-------
D3BGB9_POLPP      IHVCVESWQNYALIFNTLLDAQT-------------------PTEVEIDLPNA-------
Q4N5P3_THEPA      YEDRVDSWNKYVRLLTYFIEECNKPEGS--------------EGLSGLTIPSS-------
Q4UDV1_THEAN      YEDRVDSWNKYVRLLTYFIEECNKPEGS--------------EGLSGLTIPSS-------
A7AN02_BABBO      FEDRLDSWEKYSKLLAYFIDELEKGEGS--------------DTLNSLVIPAS-------
B3L7T1_PLAKH      LEDRKNSWDNYKCLLNFISTICSDPSGD--------------TNDNVLVMPNV-------
A5K1W2_PLAVS      LEDRKNSWDNYKCLLNFISSICSDPSGD--------------TNDNVLVMPNV-------
Q7RAI1_PLAYO      LEDRKNTWENYKCLLNFISSICTDNDG----------------NDNVLVMPNV-------
A4HNN3_LEIBR      APDAEGAWRTYSDLF-PLLKS--------------------------YELPNW-------
A4ICW2_LEIIN      APDAEGAWKTYSELL-PMLKS--------------------------YELPNW-------
Q38BD7_TRYB2      AEDAKVSWRTFCDLFVSLPGS--------------------------CDIPNW-------
EIF3L_MONBE       VEDRHASYDHYIELINMFVEP---------------------DAPLDLELPNK-------
B8C720_THAPS      VHNRIEGWHTYRQLFDLLLSEAPEE-----------------EGGADAEKKKKESLYLVP
Q5CTX7_CRYPI      WIDRVSSWKNYIALFNHLLFRGHSSTESQSSQIPNSLKEYFESNNLSTNFDREDEICLPP
Q23T76_TETTS      AELVCNSWENYNDIFDTVIHA-----------------------QTEFPLPVP-------
A0C6C9_PARTE      LQTSIESWQNYQLLFAALQQK----------------------QNIDLPLPPS-------
                         :     ::  .                                          

EIF3L_HUMAN       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIDFLRSN---PKIWNVHS
EIF3L_PANTR       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIDFLRSN---PKIWNVHS
EIF3L_BOVIN       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIDFLRSN---PKIWNVHS
EIF3L_MOUSE       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEGEMDFLRSN---PKVWNVHS
EIF3L_CHICK       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIDFLRSN---PKIWNVHS
EIF3L_XENTR       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIEFLRSN---PKIWNVHS
EIF3L_DANRE       -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIEFLRNN---PKIWNVHS
H2ZZ48_LATCH      -WLWDIIDEFIYQFQSFSQYRCKTAKK-----------SEEEIEFLRSN---PKIWNVHS
C3ZJN8_BRAFL      -WLWDIIDEFIYQFQSFTHYRSKLSKK-----------GDDEIMILRSN---PKIWNVHS
E9GER2_DAPPU      -WLWEIIDEFVYQFQSFALFRCSLHKK-----------SAEELEFIRIN---PTLWNIHS
EIF3L_NEMVE       -WLWDIIDEFIYQFQAFSQFRSKLQNK-----------PEDEIDVLRAN---SKIWNIHS
EIF3L_AEDAE       -WLWELIDEFVYQFQNFAQYRARLSDK-----------SEEEMDMLLNNN--SKVWNILC
EIF3L_ANOGA       -WLWELIDEFVYQFQNFAQYRARLTDK-----------TDEEMDMLLNNN--SKVWNILC
EIF3L_DROME       -WLWELVDEFVYQFQNFAQYRARLTEK-----------SQDEIQQLCVNH--SNEWSILC
EIF3L_DROPS       -WLWELVDEFVYQFQNFAQYRARLTDK-----------SQEEIQQLCVNH--SNVWSILC
EIF3L_CAEBR       -WLWDIIDEFVYQFQAFCLYKANPGKR-----------NADEVEDLINIEENQNAWNIYP
EIF3L_CAEEL       -WLWDIIDEFVYQFQAFCLYKANPGKR-----------NADEVEDLINIEENQNAWNIYP
EIF3L_EMENI       -WAWDVIDEFIYQFESFCRYRNRVARS---------GSNEEEAQLLRENPN---TWGCYS
EIF3L_ASPFU       -WAWDVIDEFIYQFESFCRYRNRVARS---------GSNEEEAQLLRENPN---TWGCYS
C0NVD9_AJECG      -WAWDVIDEFIYQFESFCRYRNRVART---------GSNEEEAQLLKENPN---TWGCYS
EIF3L_NEUCR       -WAWDVIDEFIYQFNSFSSYRARIARQ---------GNNEEEIAMLRENPN---TWGCYS
C7Z9P8_NECH7      -WAWDVIDEFIYQFNSFSSYRMRIARQ---------TSNEEERQALRENPN---TWGCYS
EIF3L_SCLS1       -WAWDVIDEFIYQFNSFCSYRNRVARQ---------GTNEEEIQILREAPN---TWGCYS
EIF3L_PHANO       -WAWDVIDEFIYQFNSFCSYRQKVALK---------NDNEEEITLLRENPN---TWGCYS
D5G6D3_TUBMM      -WAWDVIDEFIYQFNSFCSHRNAVARKEG-------GGSEEERRLLCDHPQ---TWGCYS
EIF3L_YARLI       -WAWGIVDEFIYQYNSYWMTKEAHNSD-------------------GVAPD---TWGTYS
EIF3L_CRYNJ       -WLWDMLDEFVYQFTSFSHWRSSPKAK-----------TEEELEMLAESPN---IWSSYS
A8NN22_COPC7      -WLWDIIDEFIYQYQVFCTWRSKPKSK-----------TDDELAMLAEAGP---VWSSYS
EIF3L_USTMA       -WLWDIIDEFIYQFQSFSQWRNKVSNK-----------SEDEIALLQDGG----VWSSYS
F4NY56_BATDJ      -WLWDIIDEFIYQFQSFSQYRNKPKHK-----------TDYEINLLKSRPD---VWNVHN
F4JY76_ARATH      -WLWDMVDEFVYQFQSFCQFRAKLKNKT-----------EEEIALLRQHDK---AWNVYG
F6H2Y0_VITVI      -WLWDMVDEFVYQFQSFCQYRAKMKNKT-----------EQEIALLRQYDQ---AWNVYG
C5XJP4_SORBI      -WLWDMVDEFVYQFQSFCQYRAKLKTKT-----------EDELSQLKQFEK---AWNVYG
A9TY01_PHYPA      -WLWDMIDEFIYQFQSFCQYRAKLKQKT-----------DQELAVLRQIDE---VWNVVG
A9TEY6_PHYPA      -WLWDMVDEFIYQFQSFCQYRAKLKQKT-----------DQELAVLREIDE---VWNVVG
A8IQV5_CHLRE      -WLWDMVDEFLYQFQSFCQYRGKVQSMS-----------PEEIENLKKCDK---VWNIVE
H3GMF5_PHYRM      -WVFDIVGEFVYQYQTYCQYRAKVATK-----------GDAEIASYQENLF---IWDSSK
D0NVK9_PHYIT      -WVFDIVGEFVYQYQSYCQFRAKVATK-----------GEQEIASYSENLF---IWDTSK
EIF3L_DICDI       -WLWDLVDEFVYQYHTFAKFKLK----------------KQDVDFLSENPE---IWDTTN
F0ZBR7_DICPU      -WLWDLVDEFVYQYHTFAKFKLK----------------KQDVDFLSENPE---IWDTTN
D3BGB9_POLPP      -WVWDIVDEFVYQYHTFAKAKLK----------------KSDVEFLSENPD---IWDTTS
Q4N5P3_THEPA      -WVWDMLDEFVYQLQESCHWKIRFCSSTEDQRNCGYLVCSSSSRALTRVGKQSNVQICLS
Q4UDV1_THEAN      -WVWDMLDEFVYQLQESCHWKVRFCSST---GSIGYDAAETKAEIEQRIQETMGIWCVPV
A7AN02_BABBO      -WVWDILDEFVYQLQECCRWRSRISRSD--------------SKALVSDAKIHSIWKVPT
B3L7T1_PLAKH      -WIHDFLSEYLYQYQSMCHYKLKLLKNP-----------EENKEGINFLIKHTDVFESSI
A5K1W2_PLAVS      -WIYDFLSEYIYQYQSMCHYKLKILKEP-----------EENKEGIDFLIKHSDVFESSI
Q7RAI1_PLAYO      -WIYDFLSEYIYQFQSMCHFKIELLNFP-----------EENTKGIEFVVNNPDVFESNI
A4HNN3_LEIBR      -MLWDIFDEFLYQMTVVYQKVFASEGT----------------------------WAVPE
A4ICW2_LEIIN      -MLWDIFDEFLYQMTVVYQKVFATEGI----------------------------WAVPE
Q38BD7_TRYB2      -FLWDIFDEFLFQMTVVYQKRFAEGAE----------------------------WSVTE
EIF3L_MONBE       -WLWDMIDEFLYQFQDFVIFRSRVDDAK----------TESDYQEIAERPN---AWNVTI
B8C720_THAPS      EWCFDILHEFLYQFQGFCQFRTTTYCA------------AAKFSSDNDGENKAIPSHVAD
Q5CTX7_CRYPI      EMIHGIIDEFLYQFQDTCRYRTRVAHVISMS--------EQGQNDGRAAKVDQDVWRCDI
Q23T76_TETTS      -WIWDIIDEYIYQFYFACRWRYTIKPED-----------QGLKEILAKDSRDLTFWNLEN
A0C6C9_PARTE      -WIWDILDEYVYQFYVSSRWRKLLKNDE-----------------ITQVKNIQDYWNLEE
                       .. *:::*                                               

EIF3L_HUMAN       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_PANTR       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_BOVIN       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_MOUSE       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_CHICK       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_XENTR       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
EIF3L_DANRE       VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
H2ZZ48_LATCH      VLNVLHSLVDKSNINRQLEVYTSG---GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSL
C3ZJN8_BRAFL      VLNVLHSLVDKSSINRQLEVFSSG---GDPDSVAGDFGRHSLYKMLGYFSLVGLLRLHSL
E9GER2_DAPPU      VLNVLYSLVDKSNINQQLEVYAKG---DDPDTVAGEFGRRPLYKMLGYFSLVGLLRLHSL
EIF3L_NEMVE       VLNVLYSLVEKSRINYQLEMYNTN---GNPDEVSGEFGIHPLYKMLGYFSLIGLLRLHSL
EIF3L_AEDAE       ILNVLHSLVSMSKIKDQLEAAAAG---RDPEEVAGEFGRHSFYKMLGYFSLVGLLRVHSL
EIF3L_ANOGA       ILNVLHSLVSMSKIKDQLEAAAAG---KDPEAVAGEFGRHSFYKMLGYFSLVGLLRVHSL
EIF3L_DROME       ILNVLHSLVDISNIKKQLEAISQG---VDPQTVAGDFGKLSFYKMLGYFSLVGLLRVHSL
EIF3L_DROPS       ILNVLHSLVDISNIKKQLEAISGG---IDPNTVSGDFGKLSFYKMLGYFSLVGLLRVHSL
EIF3L_CAEBR       VLNILYSLLSKSQIVEQLKALKEK---RNPDSVADEFGQSDLYFKLGYFALIGLLRTHVL
EIF3L_CAEEL       VLNILYSLLSKSQIVEQLKALKEK---RNPDSVADEFGQSDLYFKLGYFALIGLLRTHVL
EIF3L_EMENI       VLNVLYSLIQKSQINEQLAAMKRG---EDPAAFAGEYGSRPLYKMLGYFSIIGLLRVHCL
EIF3L_ASPFU       VLNVLYSLIQKSQINEQLAAIKRG---EDPLAFAGEYGSRPLYKMLGYFSIIGLLRVHCL
C0NVD9_AJECG      VLNVLYSLIQRSQINEQLAAIKRN---EDPAAVAGEYGNRPLYRMLGYFSIIGLLRVHCL
EIF3L_NEUCR       VLNVLYSLIQKSQITEQLAAMKRN---EDPAAVAGEYGSKNLYKMLGYFSIIGLLRVHTL
C7Z9P8_NECH7      VLNVLYSLIQRSQITDQLAAMKRN---EDPMAVAGDYGSKNLYRMLGYFSIIGLLRVHTL
EIF3L_SCLS1       VLNVLYSLIQRSQINEQLAAMRRN---EEPMAVAGDYGSKSLYRMLGYFSIIGLLRVHCL
EIF3L_PHANO       VLNVLYSLIQRSQISEQLAAMKRG---EDAALYAGEYGNRPLYKMLGYFSIIGLLRVHCL
D5G6D3_TUBMM      VLNVLYSLIQRSQMNEQLAAIKKG---QDPNEVAGEYGSRPLYRMLGYFSIIGLLRVHCL
EIF3L_YARLI       VLNVLYSLSEKTKIREQLRAIKAG---LDPMDVAGPYGSRPLYKMLGYFCVIGLLRVHTL
EIF3L_CRYNJ       VLNVLYSLVQKSQINEQLKAERAGKSVEEVTEVAGEYGSKPLYKNLGYFSLICLLHVHVL
A8NN22_COPC7      VLNVLYSLMQKSRINEYIVAQREGKSPEEIAEIVGEYGQRPLYRMLGYFSIIGLLRVHVL
EIF3L_USTMA       VLNVLYSLIQKSRITEQLVAASKGEDPD---EVAGEFGSKPLYRMLGYFSIIGLLRVHVL
F4NY56_BATDJ      VLNVLYSLIQKSQINEQLVAFRNG---EDLVAAAGELGSKPLYRMLGYFSLVGLLRVHCL
F4JY76_ARATH      VLNFLQALVEKSCIIQILEHDKDGLE-FTETDGYDFSGGSNVLKVLGYFSMVGLLRVHCL
F6H2Y0_VITVI      VLNFLQALVEKSMIIQILEQEKEGLEQFTATDGYDYNGGSNVLKVLGYFSMVGLLRVHCL
C5XJP4_SORBI      VLNYLKALVEKSMITQILEREKEGLEQFTATDGYDYEGGSNVLKVLGYYSMIGLLRIHCL
A9TY01_PHYPA      VLNYLQALIEKSMILQILEEENEGNVTFTATDGYDYHGGTNVLKVLGYFSIVGLLRVHCL
A9TEY6_PHYPA      VLNYLQALIEKSMILQILEEEKDGNVTFTATDGYDYHGGTNVLKVLGYFSIVGLLRVHCL
A8IQV5_CHLRE      VLNILQALVDKSGIVAELE----GDGGARQLEGYYPQS-SNVLRMLGYFALTGLMRVHCL
H3GMF5_PHYRM      VLGYLHALVRHSKIVEILK------------EEEGVKAPSAVVKELGYFSLITLARAHVL
D0NVK9_PHYIT      VLGYLHALVRHSKIVEILK------------EEEGVRVPSEVVKELGYFSLITLARAHVL
EIF3L_DICDI       VIRYLYYIIKKSQIFSANTNRFES--------SSEDFCSHPVYKMLGYYSVISLVRVQCL
F0ZBR7_DICPU      VIRYLYYIIKKSQIFSATTNRFEN--------SSEDFCSHPVYKMLGYYSVISLVRVQCL
D3BGB9_POLPP      VIQYLYFLIRKSQIFNSPASGTES--------SLDDFCSHPVYKMLGYYSIISLVRVQCL
Q4N5P3_THEPA      VFKGCAFGYNKSELPTRIFR------------INLLIETSCVTWRLLYFTDNGLKRGFIP
Q4UDV1_THEAN      ALELLHELANNPVFKSACQSS-----------KDLNLDTTSLNYQLGYFASICLLRLHVL
A7AN02_BABBO      ALEMLQRLANNTVFQNMSHPS-----------QRDGLEAAGLSFQLGYFASISLVRLHVL
B3L7T1_PLAKH      VFEVLHSLLLKGEFTNLSDEERSI---FVHNVFHVSNEELSSRYQFSYFACCILLKAYVL
A5K1W2_PLAVS      VLEVLHSLLLKAEFVTLSEEERAI---FVHNVFHVNNEDLTSRYQFAYFACCVLLKVYVL
Q7RAI1_PLAYO      VLEVLHSLLLKGEFTTLPEDEKIT---YVNNIFNINNEELTSKYQFSYFSCCILLNVYVL
A4HNN3_LEIBR      VSRLLNEVVDNSRLFELMKEPDFLD-------DIHRG--PNTGALSGFYAIVTNSKLNVL
A4ICW2_LEIIN      VSRLLNEVVDNSRLLELVKEPDFLD-------DIHRG--PNTGALSGFYAIVTKSKLNVL
Q38BD7_TRYB2      AVQMMEKVISESGIEEVME-SDKAD-------DITKSGENHVRWMSGFFGIITVAKINVL
EIF3L_MONBE       VLNALHSLILKSEINEQLEAYRSG---QNPTEMAGAFGKSSLYKMLGCFSLVGLVRLQCH
B8C720_THAPS      AIDALNSNRDAWAVETVLYYLHRL------VAVGSGSNASATYRYLAILSLVTISRLECL
Q5CTX7_CRYPI      IFQIFQSFVDLSEVRLLMSADSTASQ-QEHLQVLNSVESFPIRYQLGYFSILGLLRLHAL
Q23T76_TETTS      INENFTSVIQKSQIFEKGVLTLKE--------------ATSTSHYFGFFTLVGQLRLNVL
A0C6C9_PARTE      ILKTLEAFYSQR-----------------------NSAVQNTFQYLAYYSYLATAKLQVM
                                                                         .    

EIF3L_HUMAN       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLMMRRYQDAI
EIF3L_PANTR       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLTMRRYQDAI
EIF3L_BOVIN       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLMMRRYQDAI
EIF3L_MOUSE       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLMMRRYQDAI
EIF3L_CHICK       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLMMRRYQDAI
EIF3L_XENTR       LGDYYQAIKVLENIELNKKS----------MYSRVPECQVTTYYYVGFAYLMMRRYQDAI
EIF3L_DANRE       LGDYYQAIKVLENIELNKKS----------MYSRVPECQITTYYYVGFAYLMMRRYQDAI
H2ZZ48_LATCH      LGDYYQAIKVLENIELNKKS----------MYSRVPECQITTYYYVGFAYLMMRRYQDSI
C3ZJN8_BRAFL      LGDYYQAIRVLENIDLNKQG----------LYSRVPSCQISMYYYVGFAYMMMRRYQDAI
E9GER2_DAPPU      LGDFYQAVKVLENMELNKKT----------LYSRVPACQISTYYYVGFAYLMMRRYADAI
EIF3L_NEMVE       LGDYFQAIKVLSNVELTRNT----------MYSRIPACQITTYYYVGFAYLMMRRYQDAI
EIF3L_AEDAE       LGDYHQAIKVLEPIEIHKKS----------QYSHIPACQISTSYYVGFAYMMMRRYSDAI
EIF3L_ANOGA       LGDYHQAIKVLEPIEIHKKS----------QYSHIPSCQISTSYYVGFAYMMMRRYSDAI
EIF3L_DROME       LGDYYQAIKVLEPIEIHKKS----------AYSHIPACQISTSYYVGFAYMMMRRYADAI
EIF3L_DROPS       LGDYYQAIKVLEPIEIHKKS----------AYSHIPACQISTSYYVGFAYMMMRRYADAI
EIF3L_CAEBR       LGDYHQALKTVQYVDIDPKG----------IYNTVPTCLVTLHYFVGFSHLMMRNYGEAT
EIF3L_CAEEL       LGDYHQALKTVQYVDIDPKG----------IYNTVPTCLVTLHYFVGFSHLMMRNYGEAT
EIF3L_EMENI       LGDFTLALKTLDDIEMNKKA----------MFARVMAAHFTTYYYVGFSYMMTRRYGDAI
EIF3L_ASPFU       LGDFSLALKTLDDIEMNKKA----------MFARVMAAHFTTYYYVGFSYMMMRRYGDAI
C0NVD9_AJECG      LGDFSLALKTLDDIEMNKKA----------MFARVMAAHFTTYYYVGFSYMMMRRYADAI
EIF3L_NEUCR       LGDFSLALKTLDDIELNKKA----------MFARVMAAHFTTYYYVGFSYMMMRRYADAI
C7Z9P8_NECH7      LGDFSLALKTLDDIELNKKA----------MFARVMAAHFTTYYYVGFSYMMQHRYADAI
EIF3L_SCLS1       LGDFSLALKTLDDIELNKKA----------MFARVMAAHFTTYYYVGFSYMMMRRYADAI
EIF3L_PHANO       LGDFSLALKTLDDIELNKKA----------MFARVMAAHFTTYYYVGFSYMMMRRYADAI
D5G6D3_TUBMM      LGDFTLALKTLDDIELNKKA----------VFARVMAAHFTTYYYVGVSYMMMRRYADAI
EIF3L_YARLI       LGDFTLALKTMESIELTKKA----------LFARVAPAHFATYYYVGICYVMTRRYADAI
EIF3L_CRYNJ       LGDPTLALQTMENVDLGNAA----------FLTRITACHVTTYYHVGCAYMALGRWPDAI
A8NN22_COPC7      LGDFTLALKVMDNIELNQKS----------PFTRVTACHVTTYYYVGFCYIMLRRYPDAI
EIF3L_USTMA       LGDYTLALKMLDHIELNKKSG---------LINRVTACHVTAYYYVGFAYLMLRRYPDCI
F4NY56_BATDJ      LGDYMLALETMQNVDPGQRG----------LFSRITACHVTTYYYIGFAYLMMRRYTDAI
F4JY76_ARATH      LGDYHTALKWLQPIDITQPG----------VYTSVIGCHIATIYHYGFATLMLRRYVDAV
F6H2Y0_VITVI      LGDYHTGLKCLLPIDISQQG----------VYTSVIGSHITTIYHFGFANLMLRRYVEAI
C5XJP4_SORBI      LGDYHTGLKCLAPIDLNQQG----------VYTIVIGSHISTIYHYGFANLMMRRYVEAT
A9TY01_PHYPA      LGDYHTGLRALAPIDINQPG----------VFNTVIGCQITTIYYYGFANLMLRRYVDAI
A9TEY6_PHYPA      LGDYHSGLRALSPIDINQPG----------VFNTVIGCQITTIYYYGFANLMLRRYVDSI
A8IQV5_CHLRE      VGDYFTALKAIYPLNLHERTHL--------FTPRIPGAHITLFYYGGFSYLMQRRYLDAA
H3GMF5_PHYRM      FGDYYTSIKLLEPIDLFNKSSRGETKTTAQIHEKSPGCHVSVFYHMGFAQLMLEDFAAAI
D0NVK9_PHYIT      FGDYYTSLKLLEPIDLFNKSSRGEAKTTAQIHEKSPGCHVSVFYHMGFAQLMLEDFAAAI
EIF3L_DICDI       LGDYTLALKTLELIDMGKKA----------MYTYVTACHITLYYYLGFAYLMSRKYNEAT
F0ZBR7_DICPU      LGDYTLALKTLELIDMGKKA----------MYTYVTACHITLYYYLGFAYIMSRKYNEAT
D3BGB9_POLPP      LGDYTLALKTLELIDMGKRA----------MYTFVTACHITLYYYLAYAYLMSRRYNEAN
Q4N5P3_THEPA      QKFVLEDSSLQCHTHLLPG-------------VRVHDAKVLPI----IPIIMCRRYNDAI
Q4UDV1_THEAN      LGDYYTSLTMASNVDLSPRS----------LYWKIPACNVTLIYYLGFAFMMLRRYNDAI
A7AN02_BABBO      LGDYHTSVRTATSIEISSKF----------LYWKVPSYYVSLFYHLGFAYMMLRRYSDCI
B3L7T1_PLAKH      MGDYYTALKIISYIELSHKA----------LYWKVTLCHINIYYHVAFCYMMLRRYNDSI
A5K1W2_PLAVS      MGDYYTALKIISYIELSHKA----------LYWKVTLCHISVFYHIAFCYLMLRRYNDCI
Q7RAI1_PLAYO      LGDYYSALKIISNIQLNHKQ----------LYWKVILCHINIYYNIAFCYMMLKRYNDSI
A4HNN3_LEIBR      LGDYYSALTDLEPLDVYNKGRA--------VLSRVSPCAVSVFYHIGFSYLMIHRFEDAS
A4ICW2_LEIIN      LGDYYSALTDLEPLDVYNKGRA--------VLTRVSPCAVSVFYHIGFSYLMIHRFEDAS
Q38BD7_TRYB2      LGDYNSALSVLKPLDIYGRGKK--------ILAEVAPANVSLMYYVGFSYLMLRRYADAS
EIF3L_MONBE       LGDYRQALQIMKNVDLDRRF----------IFSLVPACNVSLHYHLGFCYLMLRRYQDAF
B8C720_THAPS      LGDYKAAISALDVSAEELVN-------------GVFPARLSLAYHAGVSYLMLRRYKDAV
Q5CTX7_CRYPI      LGSYYIAIEVSNGIDHQIFRP---------LLWKVQTAYVSYLYYLGFSYMMLQRYIDAI
Q23T76_TETTS      IGNYDAAIKSIENLDFDSLV----------IFSKAFPAYFNLFYYAGFAYLMTGRYKEAV
A0C6C9_PARTE      SGNFNAAYTMLSQIQHSELI----------IYSKSGGAYQSLFSYAGFCFLLNKEYKKAN
                                                                    :    :  . 

EIF3L_HUMAN       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHALLAIALTMYPMR-------
EIF3L_PANTR       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHALLAIALTMYPMR-------
EIF3L_BOVIN       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHALLAIALTMYPMR-------
EIF3L_MOUSE       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHALLAIALTMYPMR-------
EIF3L_CHICK       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHALLAIALTMYPMR-------
EIF3L_XENTR       RVFANILLYIQRTKSMFQ-----RTTYKYEMINKQNEQMHGLLAIALTMYPMR-------
EIF3L_DANRE       RVFANILLYIQRTRNMFQ-----RTTYKYEMINKQNEQMHGLLAIALTMYPMR-------
H2ZZ48_LATCH      RVFANILLYIQRTKTMFQ-----RTTYKYEMINKQNEQMYGLLALVLTMYPMR-------
C3ZJN8_BRAFL      RTFTSILLYIQRTKAMFQ-----RQSYTFDMIMKQNEQMFNLLALCLTLYPMR-------
E9GER2_DAPPU      RTFSHILLYVQRTKPLYQ-----AKTYQNDQINKQTEKMYVLLSVCLVLHPQR-------
EIF3L_NEMVE       RCFSSVLLYIQRTKNMLQ-----TKSYQYEEIMKKNDQMYNLLAIALTLCPQQ-------
EIF3L_AEDAE       RTFSSILLYIQRTKQLYS-----ARSYQNDQINKQTDQMYHLLAICLVLHPQC-------
EIF3L_ANOGA       RTFSSILLYIQRTKQLYS-----ARSYQNDQINKQTDQMYHLLAICLVLHPQC-------
EIF3L_DROME       RTFSDILLYIQRTKQLYS-----TRSYQNDQINKQAEQMYHLLAICLVLHPQC-------
EIF3L_DROPS       RTFSDILLYIQRTKQLYS-----TRSYQNDQINKQAEQMYHLLAICLVLHPQC-------
EIF3L_CAEBR       KMFVNCLLYIQRTKTVQSQQ-PSKKNFQYDVIGKTWDQLFYLLAICLAVQPQR-------
EIF3L_CAEEL       KMFVNCLLYIQRTKSVQNQQ-PSKKNFQYDVIGKTWDQLFHLLAICLAIQPQR-------
EIF3L_EMENI       RMFSHILVYVSRTKNFQK------GGNSYDAIAKKNDQMYALIAICVALHPTR-------
EIF3L_ASPFU       RMFSHILVYVSRTKNFQK------GGNSYDAIAKKNDQMYALIAICVALHPTR-------
C0NVD9_AJECG      RMFSHILVYVSRTKNFQK------GSNSYDAIAKKNDQMYALIAICVAFHPTR-------
EIF3L_NEUCR       RMFSHILVYVSRTKNFQK------NAQ-YDSITKKNDQMYALIAICVAFQPTR-------
C7Z9P8_NECH7      RMFSHILVYVSRTKNFQK------SAQ-YDSITKKNEQMYALIAICVAFQPTR-------
EIF3L_SCLS1       RMFSHILIYVSRTKNFQK------NAQ-YDSISKKNDQMYALIAICVAFHPTR-------
EIF3L_PHANO       RMFSHILVYVSRTKNFQK------NAQ-YDSITKKNDQMYALVAICVAFHPTR-------
D5G6D3_TUBMM      KAFSHILVYVSRTKNFQK------NAQ-FDSVTKKNDQMYALIAICVALCPTR-------
EIF3L_YARLI       RCFSHVLTYMARTKNVQ--------GPRYDAK--RSEQMYALLAICVVLSPAR-------
EIF3L_CRYNJ       KTFVSVLIFFIRMKQYHT------RSYQYGSIAKTCERMYALLAICTTLSPGP-------
A8NN22_COPC7      RTFVTILNFIMRMKQYHT------RSYQYDQISKTADRMYALFAICHALSPSR-------
EIF3L_USTMA       KSFTHILVFIMRLRQYHT------RSYQYDQINKTADRMYALLSMACALCPTR-------
F4NY56_BATDJ      KMFANILNFVSRTKHYHN------RSYQYEMILRKSDQMYALLSMSLVLSPQK-------
F4JY76_ARATH      REFNKILLYIFKTKQYHQ------KSPQYEQLLKKNEQMYALLALSLSLCPQT-------
F6H2Y0_VITVI      REFNKILLYIYKTKQFHQ------KSPQYEQILKKNEQMYALLAICLSLCPQE-------
C5XJP4_SORBI      REFNKILLYILKYKQYHQ------KSPQYDQILKKNEQMYALLAICLSLCPQN-------
A9TY01_PHYPA      RSFNQVLLYIFKTKQYHQ------RSSQYDQILKKNEQMYALLAICLSLCPHP-------
A9TEY6_PHYPA      KSFNQILLYIFKTKQYHQ------RSSQYDQILKKNEQMYALLAICLSLCPHP-------
A8IQV5_CHLRE      RCFNAVLLYIYRVKAAHR------NSPQYEQMLKKNEQMYSLLAVCLALCPAAA------
H3GMF5_PHYRM      RSFSTIILQVNRNRNYYS------RFADYEQLHKLTEKAMALLAIALFLCPGQ-------
D0NVK9_PHYIT      RSFSTIILQVNRNRNYYS------RFADYEQLHKLTEKAMALLAIALFLCPGQ-------
EIF3L_DICDI       KALNTILVSVASKSKSQN--------FQSDHNEKKTDKMYALLTICQALYPNK-------
F0ZBR7_DICPU      KALNTILVSVASKSKSSS--------FQSDHNEKKIDKMYALLTICQALYPNK-------
D3BGB9_POLPP      KALNTILISMASKSKAQN--------FQADHNEKKIDKMYALLAICQALYPSK-------
Q4N5P3_THEPA      RILSQLLIFLTKQRSYLV----SQS-YQQSAMSKQTEKMYLIIILCHVTTRIK-------
Q4UDV1_THEAN      RILSQLLIFLTKQRSYLV----SQS-YQQSAMSKQTEKMYLIIIICHVTTRIK-------
A7AN02_BABBO      KVLSQILIFLTKQRTYLA----SQS-YQQGSMAKLAEKMYLMLILCHTTTKIR-------
B3L7T1_PLAKH      KVLSQILIYLSKQKVHLS----NQQRYEQSQIHKLIDKMYFIVIICHTLSNTR-------
A5K1W2_PLAVS      KVLSQILIYLSKQKVHLS----NQQRYQQSQIHKLIDKMYFIVIICHSLSNTR-------
Q7RAI1_PLAYO      KILSQILIYLSKQKAHIS----NQQKYQQSLINKLIDKMYLIAIICHSLCNTR-------
A4HNN3_LEIBR      NAFRRCVTVKLNGRRFSE------------RVQQDAAYMYVCARVLGGMPISN-------
A4ICW2_LEIIN      NAFRRCVTVKLNGRRFSE------------RVQQDAAYMYVCARVLGGMPINN-------
Q38BD7_TRYB2      RVFRQSLSAKVSSRKFSE------------RVRLDCAFMHVVSCILCGTQPDN-------
EIF3L_MONBE       RLFESILIQMASHRGPGH-----------YDGGRKRDTIVCLLALAYSLLPQR-------
B8C720_THAPS      GVLGGICLFMQRGFKTGQ----LRKIPGSEQFNKLFDRMIALLAILTHICPTA-------
Q5CTX7_CRYPI      RIFQQSTVSFASNAMNSNNSSAHSSPYQHDAIGKFIDRMSWLMLFCQLLSYGNS------
Q23T76_TETTS      KVLESVCLMMNKYKAFLTK------SSQSENMMKQLEKAVCLFAISLVFYPNKASESTFW
A0C6C9_PARTE      LTLTLIVNYFNKYKQLYT------KSYQYDSLIKQHEKILALLAVTSIFYPEL-------
                    :                                         .               

EIF3L_HUMAN       ------IDESIHLQLREK-YGDKMLRMQKGD---PQVYEELFSYSCPKFLSPVVP-NYDN
EIF3L_PANTR       ------IDESIHLQLREK-YGDKMLRMQKGD---PQVYEELFSYSCPKFLSPVVP-NYDN
EIF3L_BOVIN       ------IDESIHLQLREK-YGDKMLRMQKGD---PQVYEELFSYSCPKFLSPVVP-NYDN
EIF3L_MOUSE       ------IDESIHLQLREK-YGDKMLRMQKGD---PQVYEELFSYACPKFLSPVVP-NYDN
EIF3L_CHICK       ------IDESIHLQLREK-YGDKMLRMQKGD---AQVYEELFSYACPKFLSPVVP-NYDN
EIF3L_XENTR       ------IDESIHTQLREK-YGDKMLRMQKGD---AQIYEELFNYACPKFLSPVVP-NYDN
EIF3L_DANRE       ------IDESIHTQLREK-YGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVP-NYEN
H2ZZ48_LATCH      ------IDESIHTQLREK-YGDKMLRMQKGD---LQVYEELFSFACPKFLSPVVP-NYDN
C3ZJN8_BRAFL      ------IDESVHSQLREK-CGEKMIRMQKGD---MQAFEDSFSFACPKFLSPVAP-NYEA
E9GER2_DAPPU      ------IDESLQAILREKPHAERIVRMQKGE---LQEFENAFAFASPKFLSPVPP-PVEA
EIF3L_NEMVE       ------LDENVHSQLREK-CTEKMQKLQKGD---LQMFEECFSYSCPKFVSPVPP-NFDA
EIF3L_AEDAE       ------IDESIQQVLREKNYHDNMYKMQCGD---LETFRNFFVFACPKFVSPVPP-PSDA
EIF3L_ANOGA       ------IDESIQQVLREKNYHDNMYKMQCGD---LDVFRNFFVFACPKFVSPVPP-PPDA
EIF3L_DROME       ------IDESIQQVLREKNYHDAMFKMQCGD---LEVFKSFFVFACPRFVSPCPP-AVDA
EIF3L_DROPS       ------IDESIQQVLREKNYHDAMFKMQCGD---LEVFKSFFVFACPRFVSPCPP-AADA
EIF3L_CAEBR       ------IDESIASQLAER-CGERMMHMANGN---VDEFRNAFSTGCPKFLSPTTV-VYEG
EIF3L_CAEEL       ------IDESIASQLSER-CGERMMHMANGN---IDEFRNAFATGCPKFLSPTTV-VYEG
EIF3L_EMENI       ------LDDTIHSALREK-YGEQLHRLQQGGPEALPLFEELFRSACPKFISPTPP-DFDN
EIF3L_ASPFU       ------LDDTIHSALREK-YGEQLLRLQHGGPDALPLFEELFRSACPKFISPTPP-DFDN
C0NVD9_AJECG      ------LDDTIHSALREK-YGEQFNRLQHGGPEALPLFEELFRSACPKFISPTPP-DFEN
EIF3L_NEUCR       ------LDDTIHTALREK-YGDQLLKLQRGGPEALPIYEELFRTACPKFISPVPP-NFDE
C7Z9P8_NECH7      ------LDDTIHSALREK-YGDQLLKLQRGGPESLPIFEELFRTACPKFISPVPP-DFEN
EIF3L_SCLS1       ------LDDTIHTALREK-YGDQLLKLQRGGPESLPIFEELFRSACPKFISPTPP-DFDN
EIF3L_PHANO       ------LDDTIHTALREK-YGEQFNRLQRGGPDALPLFEELFRTACPKFISPTPP-DFDN
D5G6D3_TUBMM      ------LDDTIHASLREK-YGEQFTKMQRGGPDALQIYEQLFMSACPKFISPIPP-DFDK
EIF3L_YARLI       ------LDDSIHVALRDR-YGDQMAAMQRGD---LKLFEELFTFAAPKFIQPGDV-HGG-
EIF3L_CRYNJ       ------SDENIMTIVKEH-YGDQLAILQRGGPEALEAFKDLYLQACPKYLNVNPP-PYED
A8NN22_COPC7      ------LDDNIANIAKER-FNEQYAKMSRGGQDALAAFEELFLYACPKFIAANSP-PYED
EIF3L_USTMA       ------LDENIQTQMRDK-YGDQFSKMTRPGAEGLAAFEELFIYACPKFITANSP-AYHD
F4NY56_BATDJ      ------IDENINNTLKEK-YGEQYQKMQK-GEDGLSTFEELFLYACPKFISPSAP-DLES
F4JY76_ARATH      ----KLVDESVNSQLRDK-YGEKMMRMLRSDDEAFGIYDELFSYACPKFITPSAPPTFEE
F6H2Y0_VITVI      ----QLVEETVQSQLKEK-YGEKMNRMQRYDDEAFALYDELFSYACPKFITPSAP-VYEE
C5XJP4_SORBI      ----KLIDENVSTQLKEK-YNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPP-VLDQ
A9TY01_PHYPA      ----KLVEENVNNQLREK-YAEKMLRMQRNDE---AMFDELFSYACPKFITPSPP-NYDE
A9TEY6_PHYPA      ----KLVEENVNNQLREK-YAEKMLRMQRSDE---AMFDELFSYACPKFITPSPP-NYDE
A8IQV5_CHLRE      ----KSLDENVLMQLRER-QSDNMAAMARGDI---DLYDSLFRDACPKFVTSTPP-AYDQ
H3GMF5_PHYRM      -----RVNDQIHTLIREK-YGDKQTKLQKGD---ISALSELFGFSCPKFILPVVAVEGEA
D0NVK9_PHYIT      -----RVNDQIHSLIREK-YGDKQSKLQKGD---ISALTELFGFSCPKFILPAVAVEGEG
EIF3L_DICDI       ------IDENVSNNLKEK-FGDKLLRLQKGD---LSVYEELYTFAAPRCIGPVPPYISGF
F0ZBR7_DICPU      ------IDENVNNNLKEK-FGDKLLRLQKGD---LSVYEELYTFAAPRCIGPVPPYISGY
D3BGB9_POLPP      ------IDENVNNLLKEK-FGEKLLRMQKGE---IAVYEELFTFASPRCVGPVSPYISGL
Q4N5P3_THEPA      ------LDETVIQTIKEQ-YSNKFYQL-QVDNE--DSFRDVFHKACPKFIDPAGPS--LK
Q4UDV1_THEAN      ------LDETVLQTIKEQ-YANKFYQL-QVDNE--DSFRDVFLKACPKFIDPAVPT--LK
A7AN02_BABBO      ------LDETILQTIKEQ-YANRFYQL-QGENE--EAFRDAFLKSCPKFIDAASGS--GS
B3L7T1_PLAKH      ------LDETVLQNIKEN-YSGKFYALLQTTNE--QAYADLFYKVAPKFIDPLSNISFQL
A5K1W2_PLAVS      ------LDETILQNIKEN-YSGKFYALLQTTNE--QAYADLFYKVAPKFIDPLSNISFQL
Q7RAI1_PLAYO      ------LDETILQNIKEN-YSSKFYSL-QSANE--QAYTDLFYRVAPKFIDPVSNISFQL
A4HNN3_LEIBR      -------LTSYLDSRKVAAFEDDRESLRTGDE---ERFRDVFDRCSPKFLTVPPSDGLPV
A4ICW2_LEIIN      -------LTSYLDSRKVAAFEDDRESLRTGDE---ERFRDVFDRCSPKFLTVPPSDGSPV
Q38BD7_TRYB2      -------LSWLMDSRKLQVLEDDKELLATGDE---ERFRDVFDRCSPKFLAVPPVPPTVC
EIF3L_MONBE       ------LERSVEHLMNEK-EGENIRKIQSGEG-ADEAINHLLLRGAPRFLCPFLADPQQP
B8C720_THAPS      -----ILDDSIASIVRDK-HANNLSKIESGE----EGYEDLFVFACPKFVNAAVPDYAQA
Q5CTX7_CRYPI      ----SNFNRMEESLSHQN--DRKSSPSFSPLGSDTSNWKEMLSKVSPRFISPSVPLITPR
Q23T76_TETTS      QFKDLGIKTSKQNSQNRNEKERIVDKFDKLQRYDIQTFNELFNYGCPKLIEPIQSLDSFK
A0C6C9_PARTE      -------EDNIITLLKES-RNKLFEKYEKILKYDQQLIGEVFLQSCPKIINTIKNIKEFQ
                                                               .*: :          

EIF3L_HUMAN       VHPNY-------------------HKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMP
EIF3L_PANTR       VHPNY-------------------HKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMP
EIF3L_BOVIN       VHPNY-------------------HKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMP
EIF3L_MOUSE       VHPNY-------------------HKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMP
EIF3L_CHICK       VHPNY-------------------HKEPFLQQLKVFADEVQQQAQLSTIRSFLKLYTTMP
EIF3L_XENTR       VHPNY-------------------HKEPYLQQLKVFLDEVQQQAQLSTIRSFLKLYTTMP
EIF3L_DANRE       VHPNY-------------------HKEPFQQQLKVFAEEVQQQAQLSTIRSFLKLYTTMP
H2ZZ48_LATCH      VHPNY-------------------HKEPFLQQLKVFMEEVQQQAQLSTIRSFLKLYTTMP
C3ZJN8_BRAFL      PPANY-------------------HKEAFMAQLKVFIDEVQQQIALPVVRSYLKLYTTMP
E9GER2_DAPPU      PPADH-------------------RREPFQQLAKVFMDEVQQQLTLPTIRSYLRLYTTMP
EIF3L_NEMVE       PPANY-------------------NREPFNLQLKVFMNEVAQQSMIPVIRSYLKLYTTMP
EIF3L_AEDAE       PIDDY-------------------VKEALEHQTNVFMDEVRQQQELPTIRSYLKLYTTLP
EIF3L_ANOGA       PIEDY-------------------VKDALEHQINVFMDEVKQQQELPTIRSYLKLYTTLP
EIF3L_DROME       PMDDY-------------------VKDPMEHQLQVFMDEVRQQKDLPTTRSYLKLYTTLP
EIF3L_DROPS       PMEDY-------------------VKDPMEHQLQVFMDEVRQQKDLPTTRSYLKLYTTLP
EIF3L_CAEBR       VNQS---------------------KEPLLRQTQSFLEGIESQMALPVLRGYLKLYTTLP
EIF3L_CAEEL       VNQS---------------------KEPLLRQTQSFLEGIESQMALPVLRGYLKLYTTLP
EIF3L_EMENI       PALN---------------------VDPVDHHTAIFMDEVKNTLYNPTIRSYLKLYTTMD
EIF3L_ASPFU       PALN---------------------IDPVDHHTAIFMDEVKNTLYNPTIRSYLKLYTTMD
C0NVD9_AJECG      PAMN---------------------VDPVDHQTAIFMDEVRNTLYNPTVKSYLKLYTTMD
EIF3L_NEUCR       PEAN---------------------IDPIEHHLSVFMDEVKTNMFNPTIKSYLRLYTTMD
C7Z9P8_NECH7      PEAN---------------------IDPVEHHLAVFMDEVKTNMWSPTIKSYLRLYTTMD
EIF3L_SCLS1       PELN---------------------VDPLEHHLSIFMDEVKTNMWSPTVKSYLRLYTTMD
EIF3L_PHANO       PEVN---------------------IDPVEHHLRIFMDEVKNNMMSPTVKSYLKLYTTMD
D5G6D3_TUBMM      PENN---------------------VDPSQHHLRVFMADVRNSMLAPTLKSYLKLYTTMD
EIF3L_YARLI       --------------------------DPLKHHLKIFMVDVTNTLSTANLKSYLNLYATMD
EIF3L_CRYNJ       ASALEAWL-------------ANPPADATQRHLELFLSDVQAVQGVNGMRNLLKLYTSID
A8NN22_COPC7      PAALQTLLSPSSPSDSTTDVSAAPQLDATHRHLSLFLADVAAQSPVPTLRSFLKLYTSLG
EIF3L_USTMA       EEALVEYKQ------------KAVFPDPTQHQLRVFLSDVKTQLSNANVRSFLRLYTTLG
F4NY56_BATDJ      EGSL--------------------IHDAVKHQARIFLSDIKTQILVPTLRSYLKLYNNLP
F4JY76_ARATH      PLVNY-------------------NQDAYRLQLKMFLYEVKQQQLLSGVRTFLKVYSSIS
F6H2Y0_VITVI      PLVNY-------------------NQEAYRLQLKLFLYEVKQQQLLSGVRTFLKVYSTIS
C5XJP4_SORBI      PLTNY-------------------NQDAYRLQLKLFLYEVKQQQLLSGIRSYLKLYSTIT
A9TY01_PHYPA      PLVNF-------------------NQDAYRLQLKLFLSEVRQQQLLSSIRSFLKLYTTIS
A9TEY6_PHYPA      PLINF-------------------NQDAYRLQLKLFLSEVRQQQLLSSIRSFLKLYTTIS
A8IQV5_CHLRE      ATTNT-------------------NQLAFRAQLNSFLLEVRSQQTLPQLKQYLLLYSSIA
H3GMF5_PHYRM      PVNRS--------------------AEASQRQQKAFNDMVARQQHIPAVRSYIKLYRSID
D0NVK9_PHYIT      PVNRS--------------------AEASQRQQKAFNDMVTRQQHIPAVRSYIKLYRSID
EIF3L_DICDI       NVTAL---------------------DPHRLQLSLFLEEVKQQSLLTTIRSYITLYSTIS
F0ZBR7_DICPU      NVTAL---------------------DSHRLQLSLFLEEVKQQSLLTTIRSYITLYSTIS
D3BGB9_POLPP      NQTVF---------------------DPPRLQLSLFIEEVKQQSLLTTIRSYITLYSSIS
Q4N5P3_THEPA      LTESPT------------------VNEPLQRQVQIFLEEINKQRKVNEIYSYAKLYHNIS
Q4UDV1_THEAN      LTEASS------------------VNEPLQRQVQIFLEEINKQRKVNEIYSYAKLYHNIS
A7AN02_BABBO      TTDEESDIT------------GGSLNEPVQRQLNLFLKEIGNQRRVDEIYSFAKLYHNIS
B3L7T1_PLAKH      LTNFENVQN------------QTYNSDPMTTQLNIFLKDVSYQKKAFHFMSYSKLYHNIQ
A5K1W2_PLAVS      LASFENVQN------------QTYNSDPMTTQLNIFLKDVSYQKKAFHFISYAKLYHNIQ
Q7RAI1_PLAYO      LTNFENTQN------------QPYNSNPTLRQLSIFLKNVTYQKKTYHLMSYVKLYHNIQ
A4HNN3_LEIBR      KG-----------------------SEGRELQARMFRRAVQQQQDIIKLRGYFKVYQNTK
A4ICW2_LEIIN      KG-----------------------SEGRELQARMFRRAVQQQQDIIKLRGYFKVYQNTK
Q38BD7_TRYB2      KG-----------------------MEGKELQARLFLRAVKQQQDTIKLRVYLGVYQTTT
EIF3L_MONBE       PEEDV-------------------LKAESERQLELFKQEAKQLILLGQIRSYLKLYTRMK
B8C720_THAPS      LKPGAEMMP--------------YGQDAYKLQVHHFMNEMTAHQTLRKMRSYMSLYTSIG
Q5CTX7_CRYPI      DHILKAD-----------------QNEPQQRQMQTFSPLMHLYELNSMIRSFTKLYNNLN
Q23T76_TETTS      DITNKN------------------TSDLIINAKEKLTKEFKVVQNLNNLATVMKLYSKIN
A0C6C9_PARTE      TEQELN------------------PNETIIEVKDKLLKEILEAKRINDVEQVLSLYNQIT
                                                     :                  :*    

EIF3L_HUMAN       VAKLAGFLD----LTEQE--------------------------------------FRIQ
EIF3L_PANTR       VAKLAGFLD----LTEQE--------------------------------------FRIQ
EIF3L_BOVIN       VAKLAGFLD----LTEQE--------------------------------------FRIQ
EIF3L_MOUSE       VAKLAGFLD----LTEQE--------------------------------------FRIQ
EIF3L_CHICK       VAKLAGFLD----LTEQE--------------------------------------FRIQ
EIF3L_XENTR       VAKLAGFLD----LPEQE--------------------------------------FRIQ
EIF3L_DANRE       VAKLAGFLD----MSEQE--------------------------------------FRIQ
H2ZZ48_LATCH      VAKLAGFLD----LTEQE--------------------------------------FRIQ
C3ZJN8_BRAFL      VSKLAGFLD----MTEEE--------------------------------------FRTH
E9GER2_DAPPU      VAKMAAFLE----MPDTD--------------------------------------FRTH
EIF3L_NEMVE       IAKLAAFLD----MDEAT--------------------------------------FRNQ
EIF3L_AEDAE       LLKLASFMD----HIPQDEIGEQKIE-----------------------------NLLTH
EIF3L_ANOGA       IMKLASFMD----RKPQDEVDEQKLE-----------------------------NLLTR
EIF3L_DROME       LTKLASFID----PNASE----DDVS-----------------------------KLLIR
EIF3L_DROPS       LAKLASFID----PNAND----DDVS-----------------------------KLLIR
EIF3L_CAEBR       TKKLASFMD----VDEEN------YD-----------------------------SFLGK
EIF3L_CAEEL       TKKLASFMD----VDDEH------YD-----------------------------SFIGK
EIF3L_EMENI       LQKLAGFLD----VEPEK--------------------------------------LRSW
EIF3L_ASPFU       LKKLAGFLE----VQPEV--------------------------------------LRSW
C0NVD9_AJECG      LQKLAGFLD----VEPQQ--------------------------------------LRSW
EIF3L_NEUCR       LKKLAGFLE----VKPEE--------------------------------------LRGW
C7Z9P8_NECH7      LNKLAGFLE----VKPEE--------------------------------------LRSW
EIF3L_SCLS1       LKKLAGFLE----VEPEK--------------------------------------LRGW
EIF3L_PHANO       LKKLAGFLE----VEPEK--------------------------------------LRCW
D5G6D3_TUBMM      LKKLAAFIE----VDPEV--------------------------------------LRTQ
EIF3L_YARLI       LGKLASFLD----TDAED--------------------------------------LRSQ
EIF3L_CRYNJ       AAKLAAFSVSGEEEGEEE--------------------------------------VLQQ
A8NN22_COPC7      AKKLANFLD----EDEEE--------------------------------------MVQE
EIF3L_USTMA       TDKLASFLE----IDEEE--------------------------------------LVEM
F4NY56_BATDJ      MEKLATFLE----TTPED--------------------------------------VRRQ
F4JY76_ARATH      LAKLANYME----VDEPT--------------------------------------LRTI
F6H2Y0_VITVI      LGKLATYME----VDDPT--------------------------------------LRTI
C5XJP4_SORBI      ISKLAQYME----MDEAT--------------------------------------LRSI
A9TY01_PHYPA      ISKLASFMD----VDEPT--------------------------------------LRVA
A9TEY6_PHYPA      IAKLASFMD----VDEPT--------------------------------------LRVA
A8IQV5_CHLRE      LGRLAALMD----VEEGA--------------------------------------LRQQ
H3GMF5_PHYRM      LEKLAAFRG----IDVEL--------------------------------------ARAE
D0NVK9_PHYIT      LEKLAAFRG----VDVEL--------------------------------------ARAE
EIF3L_DICDI       IQKLAGLLQ----IDPED--------------------------------------LRVK
F0ZBR7_DICPU      IQKLATLLQ----MDPED--------------------------------------LRVK
D3BGB9_POLPP      IQKLATLLQ----MDPED--------------------------------------LRVK
Q4N5P3_THEPA      LKKLGVLMNAGDDPE----------------------------------------VLRSQ
Q4UDV1_THEAN      LKKLGVLMNLGDDPE----------------------------------------LLRSQ
A7AN02_BABBO      LEKLAALMKLGEDRE----------------------------------------LVRSY
B3L7T1_PLAKH      LKKLSSLMNYGEQRRLATEQKEWQKSGLVK-------NPMGDAENGEIPPNEEQ--VCAD
A5K1W2_PLAVS      LRKLSSLMNYGQQRRPAEGDTASQE------------NHLGEVQKGEPSPDEALALVSAD
Q7RAI1_PLAYO      INKLGNLMNYQEE----------------------------DNDN-----------VYCD
A4HNN3_LEIBR      MNLLETLLE----VDDGY----------------------------------------AP
A4ICW2_LEIIN      MNLLETLLE----VDDGY----------------------------------------AP
Q38BD7_TRYB2      TELVKTVLD----VNDGL----------------------------------------VP
EIF3L_MONBE       LEKLAKFLE----LTVPQ--------------------------------------LRSM
B8C720_THAPS      VEKLASFND----MKVEE--------------------------------------FEPW
Q5CTX7_CRYPI      VDTLASLMHIAKKNGNLKSREVIKSRNSGSDSQANEISSTPSTTTDDFEVQEPSSIARSQ
Q23T76_TETTS      LQKAASIVN----VSKDE-----------------------------------------F
A0C6C9_PARTE      FEHFNKLLP-----------------------------------------------QKYV
                                                                              

EIF3L_HUMAN       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_PANTR       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_BOVIN       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_MOUSE       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_CHICK       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_XENTR       LLVFKHKMKNLVWT-----SGISALEGEFQSASEVDFYIDKD------MIHIADTKVARR
EIF3L_DANRE       LLVFKHKMKNLVWT-----SGISALDGEFQSASEVDFYIDKD------MIHIADTKVARR
H2ZZ48_LATCH      LLVFKHKMKNLVWI-----SGISALDGEFQSASEVDFFIDKD------MIHIADTKVARR
C3ZJN8_BRAFL      LLCFKHKMSNVTSS-----KGTGGLDGEFQSASEVDFFIDKD------MVHIADTKVARR
E9GER2_DAPPU      LLCFKHKMKNVVWT-----KGTSGLDGELQSGSEVDFYIDGG------MIHIADTKVARR
EIF3L_NEMVE       LLCYKHKQRNLVWT-----KGTDGLDGEQQSSSEVDFYIDRD------MIHIADTKVDRR
EIF3L_AEDAE       LLCFKHKMKNIVWT-----KGASGLEGKFQSGSELDFYIDKD------MIHIADTKVSHR
EIF3L_ANOGA       LLCFKHKMKNVVWT-----KGSSGLEGKFQSGSELDFYIDKD------MIHIADTKVSHR
EIF3L_DROME       LLCFKHKMRNLVWS-----KGPSGLEGTFKSGSELDFYIDDD------MIHIADTKVSHR
EIF3L_DROPS       LLCFKHKMRNLVWS-----KGPSGLEGTFKSGSELDFYIDDD------MIHIADTKVSHR
EIF3L_CAEBR       LLTYKMIVNELGKE-----AGPSTVDDD-EPQTDIDFYVDRD------MINIADTKVARH
EIF3L_CAEEL       LLTYKMIVNELGKE-----AGPSSADDD-EPQTDIDFYVDRD------MINIADTKVARH
EIF3L_EMENI       LLVNKQRSRQVRWV----EGGLLE--GETVSANDLDYALEKD------LIHVSETKAGRR
EIF3L_ASPFU       LLVNKQRSRQVRWV----EGGLLE--GEVVSANDLDYALEND------LIHVSETKAGRR
C0NVD9_AJECG      LLVNKQRSRQIRWS----DGGLLE--GEVANANDLDYAIEGD------LIHISEAKAGRR
EIF3L_NEUCR       LMVNKQRTKQLRWT----DGGLLE--GELVNVSDLDYALQGD------LIHISEAKVGRK
C7Z9P8_NECH7      LLVTKQRTKQLRWQ----DQGLLE--GELVNVSDLDYALQGD------LIHISEAKVGRK
EIF3L_SCLS1       LLVNKQRSRQIRWT----DNGLLD--GEVVNSNDLDYAMQGD------LIHISEAKVGRK
EIF3L_PHANO       LLVNKQRNRQTRWS----EGGLLERRGDPQQRSRLRHGKEIS------STCLRPRSAGDW
D5G6D3_TUBMM      LLVYKQRSRQTRWI----EGGLLE--GETINTSDLDFALQGD------LIHISEAKVGRR
EIF3L_YARLI       LVTLKMKNRQLRWT----EGELAD--GTYQHCSELDIALEND------LIHVAEAKGGRK
EIF3L_CRYNJ       LMVLKSASSTYGR--GQAETTLLD--GERKVTNNLDFTIDGT------MVHVEETTSHRR
A8NN22_COPC7      MMVVKQASRSLSRVPGTEGTGLLE--GQTITTSDLNFVIDEN------MVHIAESTVGRR
EIF3L_USTMA       MMVMKNSTRSLKW----SSGSLLH--GQVVNTSDLDFVIDTD------MVHIAESRVGRR
F4NY56_BATDJ      LLVFKHKSRQVVW----HHGPIST--GSLISTTDLQLYLKQD------TVYIAETKTGRR
F4JY76_ARATH      LLTYKHKTHSVDSDG------------RIISNADIDFFINND------MIYVVESKPAKR
F6H2Y0_VITVI      LMTYKHKTHAVDSDG------------KIGSNADVDFYIDDD------MIHVIESKPTKR
C5XJP4_SORBI      LMTYKHKMHAVDSDG------------KIVSSADFDFYIVED------VIHVVESKPTKR
A9TY01_PHYPA      LLTYKHKTHVINNDG------------SVLSNADVDFYIDDD------MVHIADTKVTKR
A9TEY6_PHYPA      LLTYKHKTHVINYDG------------TVLSNADVDFYVDDD------MIHIADTKVTKR
A8IQV5_CHLRE      LLCLKAKQRQLKWDGG-----KDMTAGTWTVASDLEFHIDVDAATGREMVLVSDSQTVAT
H3GMF5_PHYRM      LMSLKVSGS--------------------RLKSDVHFYLNNN------LVLIDEEASNQR
D0NVK9_PHYIT      LMALKVSGS--------------------RLKSDVHFFLNNN------LVLIDEETSNQR
EIF3L_DICDI       LTCYKHKLFNVLGKG----------ETKWNNQLDIDFYIDQD------MIHI-DNRLYAK
F0ZBR7_DICPU      LTCYKHKLFNVLGKG----------ENKWNNQLDIDFYIDQD------MIHI-DNRLYAK
D3BGB9_POLPP      LTCYKHKLINVLGKG----------DNKWNNQMDIDFTIDQD------MIHI-DNRFHAK
Q4N5P3_THEPA      ILCAKHHVRQFVSN----SFSLYHTNLLQTFGDRDDLYIDQN------VLHIKSKKNQKI
Q4UDV1_THEAN      ILCAKHHVRQFVSN----SFSLYHTNLLQTFGDRDDLYIDQN------VLHIKSKKNQKI
A7AN02_BABBO      VLSVKHQTRQFANS----SSG--GDVIPGTAEGDIDLYIDQN------ILYIKSKRSQKL
B3L7T1_PLAKH      IMCVKNSGRQLVWKE---GPLYKGEVVTSVFGSSFDFYIDMD------ILNIKTRAQQKI
A5K1W2_PLAVS      IMCVKNSGRQLVWKD---GPLYKGEVVTSVFGSAFDFYIDMD------ILNIKTRAQQKI
Q7RAI1_PLAYO      IMCVKNYNRQLIWKE---GPLYSGEITTSIFGNTFDFYIDID------ILNIKTRAQQKF
A4HNN3_LEIBR      LFALKMRSRQLVHDG----VTADLLQGVFTSSSEFDCIVQDD------NVEVVPSMTFGG
A4ICW2_LEIIN      LFALKMRSRQLVHDG----VTADLLQGVFTSSSEFDCIVQDD------NVEVVPSMTFGG
Q38BD7_TRYB2      LFAMKLTSRQLVHDG----VSADLHSGTYVVRAALDCTVEGD------NICVVQKSSYRT
EIF3L_MONBE       LHSFKHKMSQIVHTP-----GGEPLAGERQFTDSVDFYVDGD------EICIATMTVKKS
B8C720_THAPS      LTCFKHKVRQLERGE---------GGDKMGTAMDIHYYVGEN------LVHVDEAEKVRR
Q5CTX7_CRYPI      IIAIKSRSGRQKIWK----SGDLHSGELVQLNGDVDLLLDLDT-----IHIIEGKQVDKF
Q23T76_TETTS      LNLLKQYEKRETSDLLKTPFEQTVLSRFFLPTPILKFDINGD------NITINEVVPVKN
A0C6C9_PARTE      QLYIDRNSVALNENS----FESTILSKFWQKSKLLEIEIKNN------IIHVKEVQVNQR
                      .                                              :        

EIF3L_HUMAN       -YGDFFIRQIHKFEELNRTLKKMGQRP---------------------------------
EIF3L_PANTR       -YGDFFIRQIHKFEELNRTLKKMGQRP---------------------------------
EIF3L_BOVIN       -YGDFFIRQIHKFEELNRTLKKMGQRP---------------------------------
EIF3L_MOUSE       -YGDFFIRQIHKFEELNRTLKKMGQRP---------------------------------
EIF3L_CHICK       -YGDFFIRQIHKFEELNRTLKKMGQRP---------------------------------
EIF3L_XENTR       -YGDFFIRQIHKFEELNKTLKKMSQKP---------------------------------
EIF3L_DANRE       -YGDFFIRQIHKFEELNRTLKKMPLNTGASISSSSTSRAT--------------------
H2ZZ48_LATCH      -YGDFFIRQIHKFEELNKTLKKMNPRP---------------------------------
C3ZJN8_BRAFL      -YGDFFIRQIHKFEEMKRSFGELQTKS---------------------------------
E9GER2_DAPPU      -YGDYFIRQIHKFEEINRVLKTQKV-----------------------------------
EIF3L_NEMVE       -YGEFFMRQIYKFDEMARNLQAL-------------------------------------
EIF3L_AEDAE       -YGDFFIRKIMKFEDLNRRLHNLK------------------------------------
EIF3L_ANOGA       -YGDFFIRKVMKFEDLNRRLHAIKG-----------------------------------
EIF3L_DROME       -YGDFFVRKILKFNDLNRKLKNINI-----------------------------------
EIF3L_DROPS       -YGDFFVRKIMKFNDLNRKLKNINI-----------------------------------
EIF3L_CAEBR       -VGEHFLRHIQKLQEVQDVLKRLDSAGQKP------------------------------
EIF3L_CAEEL       -VGEHFIRHIQKLQEVQDVLKRLDI--QKP------------------------------
EIF3L_EMENI       -LVDWYLRNLARVY----------------------------------------------
EIF3L_ASPFU       -LVDWYLRNLARVY----------------------------------------------
C0NVD9_AJECG      -LVDWYLRNLARTY----------------------------------------------
EIF3L_NEUCR       -LVDWYLRNLSRTYA---------------------------------------------
C7Z9P8_NECH7      -LVDWYLRNLSRTYN---------------------------------------------
EIF3L_SCLS1       -LVDWYLRNLARTY----------------------------------------------
EIF3L_PHANO       -STGIFVIWPGHTKARRRASRGRPLF----------------------------------
D5G6D3_TUBMM      -LVDWYLRNLAKTY----------------------------------------------
EIF3L_YARLI       -FADWFIRNTVKNYSVQDYIVNGDKKDKEKKN----------------------------
EIF3L_CRYNJ       -YAGFFIRNAEHAQRALTSIKSAPLPV-RKPASSSAPAPATTAAPIS-KSGESAAPAPAE
A8NN22_COPC7      -YAGWFIKNTERTQKILDDLKHAPLPAPKRPSQQQPAAEAQQQKPAG-KTGQKVAWGGVK
EIF3L_USTMA       -YGDWFLRNGTRMHDVLNNIQAKPLPIVSKQVQDEAAAAAAEAKDAKDKKVKNAWAAGVK
F4NY56_BATDJ      -VADWFIRNMNKFEDIVDGMEKKSTAIAAHSN----------------------------
F4JY76_ARATH      -YGDFFLRQIAKLEGVINDMDRVKLE----------------------------------
F6H2Y0_VITVI      -YGDYFMRQVVKLEGLMNDMDRVKLD----------------------------------
C5XJP4_SORBI      -HGDYFLRQILKFEEMIGELEKVQLD----------------------------------
A9TY01_PHYPA      -FGDYFIRHIQKFDEIINELDRTQLE----------------------------------
A9TEY6_PHYPA      -FGDYFIRHIQKFDEIVNELDRTQLE----------------------------------
A8IQV5_CHLRE      -YAPLLAHHISRFEEIVRDLSLPPPVAAAAAAAPAAAAAPAAARA---------------
H3GMF5_PHYRM      -TGEFFINHIHRFARIVDECAVNQ------------------------------------
D0NVK9_PHYIT      -TGEFFINHIHKFARIVDECVVSQ------------------------------------
EIF3L_DICDI       -ETDSFINSILKFEGSLTPSYNWM------------------------------------
F0ZBR7_DICPU      -ETDSFINSILKFEGSLTPSYNWM------------------------------------
D3BGB9_POLPP      -ETDSFINSILKFEGSLKTIF---------------------------------------
Q4N5P3_THEPA      -YAEYFLQQINKCKQTLNNLQSKRDDQQNKKEKVNVVSQ---------------------
Q4UDV1_THEAN      -YAEYFLQQINKCKQTLNNLQSKKEDQQNRKEKVNVVSQ---------------------
A7AN02_BABBO      -FVDYFLQQINRCKYTFRNLQSKREEQVQGRKEAAIQES---------------------
B3L7T1_PLAKH      -FIDYFMHQINMCKNLSNNLQGTGAPHAYKAKYENFRRKNKGKGRPKV------------
A5K1W2_PLAVS      -FIDYFLHQINMCKNLSSNLQGTPAPHAYKPKYDNFRRKGKAKPRRSGEAATERWSCQAS
Q7RAI1_PLAYO      -FIDYFIHQIGMCKNLTNNLHGNNSGHLYKIKYDNYKRKNKGKNRNKHANHQIPVMQ---
A4HNN3_LEIBR      -IEQKLLNKIKNTQRG--------------------------------------------
A4ICW2_LEIIN      -IEQKLLNKIKNTQRDIEMAKRKFNQTRNRDEGGNKRRDQRDQKRRPNQQQLHGGVGNNA
Q38BD7_TRYB2      -IESKYFKRMTQRRPRHRHFDNPRQGRRPAPDAHNTN-----------------------
EIF3L_MONBE       -YGDDFLTASLKMVTSNR------------------------------------------
B8C720_THAPS      -FETFFMKQIANNDDILRQVERLRMDV---------------------------------
Q5CTX7_CRYPI      -FGDIFAKQILKARNLLRHIDSLTSKNLDSSSKKEKA-----------------------
Q23T76_TETTS      -YTEQYQKLNKKMTEIYSDVLSLL------------------------------------
A0C6C9_PARTE      DFINQLAQMNASLEKNIQELSKNL------------------------------------
                                                                              

EIF3L_HUMAN       ----------------------------------------
EIF3L_PANTR       ----------------------------------------
EIF3L_BOVIN       ----------------------------------------
EIF3L_MOUSE       ----------------------------------------
EIF3L_CHICK       ----------------------------------------
EIF3L_XENTR       ----------------------------------------
EIF3L_DANRE       ----------------------------------------
H2ZZ48_LATCH      ----------------------------------------
C3ZJN8_BRAFL      ----------------------------------------
E9GER2_DAPPU      ----------------------------------------
EIF3L_NEMVE       ----------------------------------------
EIF3L_AEDAE       ----------------------------------------
EIF3L_ANOGA       ----------------------------------------
EIF3L_DROME       ----------------------------------------
EIF3L_DROPS       ----------------------------------------
EIF3L_CAEBR       ----------------------------------------
EIF3L_CAEEL       ----------------------------------------
EIF3L_EMENI       ----------------------------------------
EIF3L_ASPFU       ----------------------------------------
C0NVD9_AJECG      ----------------------------------------
EIF3L_NEUCR       ----------------------------------------
C7Z9P8_NECH7      ----------------------------------------
EIF3L_SCLS1       ----------------------------------------
EIF3L_PHANO       ----------------------------------------
D5G6D3_TUBMM      ----------------------------------------
EIF3L_YARLI       ----------------------------------------
EIF3L_CRYNJ       APAAPEKK-----------------AGTWVPKSRQARIAA
A8NN22_COPC7      A---------------------------------------
EIF3L_USTMA       AGPPAFSQRSGGAGRSSVNKSAPAPAGAWGSSKPQPSVTA
F4NY56_BATDJ      ----------------------------------------
F4JY76_ARATH      ----------------------------------------
F6H2Y0_VITVI      ----------------------------------------
C5XJP4_SORBI      ----------------------------------------
A9TY01_PHYPA      ----------------------------------------
A9TEY6_PHYPA      ----------------------------------------
A8IQV5_CHLRE      ----------------------------------------
H3GMF5_PHYRM      ----------------------------------------
D0NVK9_PHYIT      ----------------------------------------
EIF3L_DICDI       ----------------------------------------
F0ZBR7_DICPU      ----------------------------------------
D3BGB9_POLPP      ----------------------------------------
Q4N5P3_THEPA      ----------------------------------------
Q4UDV1_THEAN      ----------------------------------------
A7AN02_BABBO      ----------------------------------------
B3L7T1_PLAKH      ----------------------------------------
A5K1W2_PLAVS      ----------------------------------------
Q7RAI1_PLAYO      ----------------------------------------
A4HNN3_LEIBR      ----------------------------------------
A4ICW2_LEIIN      GSANRNNNNANRYPRQKMAAQPMTSNLFNRNDN-------
Q38BD7_TRYB2      ----------------------------------------
EIF3L_MONBE       ----------------------------------------
B8C720_THAPS      ----------------------------------------
Q5CTX7_CRYPI      ----------------------------------------
Q23T76_TETTS      ----------------------------------------
A0C6C9_PARTE      ----------------------------------------