CLUSTAL format seed alignment for MF_03013

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G1LLQ3_AILME      ------------------------------------------------------------
G1PQX9_MYOLU      ------------------------------------------------------------
CLU_HUMAN         ------------------------------------------------------------
H0WHW6_OTOGA      ------------------------------------------------------------
CLU_MOUSE         ------------------------------------------------------------
CLU_XENTR         ------------------------------------------------------------
H3BFU0_LATCH      -------------------MVSKTDEAPALVLTENTKKEE---------DSNTESKESCG
CLU_DANRE         -------------------MVSKTDDIPASVPNCSPADFARDGETANSKGTTSKKEASCA
C3Z652_BRAFL      ------------------------------------------------------------
CLU_AEDAE         --------------MQFLSPQMEQKLHRATIHQITVSKTGDMPIRFRLRHLNYRNNKKQK
CLU_ANOGA         ------------------MAKNKKQNGKAKTPPVVAAAAGE-------QKETIGNGHAEQ
E9GHX8_DAPPU      ------------------MAVESKKNETSTEKNVNSEASKG---------EEFVKINGEG
E0VTU9_PEDHC      ----------------------------------------------------MKIIPNED
CLU_DROME         MALETEAKNSNATATGDATATATKASGKAKENNNTAGGKKNLNPNSNQQNSNQNLVNGNG
CLU_DROPS         MALEMDSKNSNSAVTGDAAAATTK-TNKAKENNNLAGSKK---------NQSQNLVNGNG
F6RE09_XENTR      ------------------------------------------------------------
CLU_CAEBR         ------------------------------------------------------MTSGSE
CLU_CAEEL         ------------------------------------------------------MTLGSE
CLU_BRUMA         -----MCVCACARVCVYVCTRHHPPLDVFPADDVITPPCSSWPLRGVMSRPACQCLRRCE
CLU_DICDI         MSETIDNPTVEEYNEKETVVSGEQVEQVEQVEQENEQVS-----------------QSFQ
D3B1P9_POLPP      MKSSMENKEQQQTSQDGYIIPGDTSIPLPDPAQEEQQQSPDQNEVRNIPLVSDAQHQDIN
CLU_ARATH         ---------MAGKSNKSKAKRAAQSTTTNSTTDVKSDAPAPPVAATVPATAPVTAAAAPV
D7T2X0_VITVI      ---------MAGKSNKGRNRRGSHSATNSSEPVGSSDS-----------------QMKDN
C5XZV7_SORBI      ---------MAGKSKGGKNKGKAQGAGQPTSAEPEVLA-------------------TDG
A9RLF4_PHYPA      ---------MAGKSTKGKSKGKGKSESSSADSSMASKEVQPLASATGLPELVLKKAPSVP
D0P366_PHYIT      ---------MGSSDTIEPMQQQE--EAVEVDESSFSVL-----------------VAPPA
H3GWU1_PHYRM      ---------MGSSDTVEQPAEQQPAELLALEEQTFSVL-----------------VAPPA
A0E685_PARTE      ------------------------------------------------------------
Q6BG47_PARTE      ------------------------------------------------------------
CLU_ASHGO         ------------------------------------------------------------
CLU_KLULA         ------------------------------------------------------------
CLU_YEAST         --------------------------------------------------------MSE-
CLU_VANPO         --------------------------------------------------------MSET
CLU_CANAL         ------------------------------------------------------MSS--E
CLU_LODEL         ------------------------------------------------------MSNG-D
CLU_DEBHA         ------------------------------------------------------MSSD--
CLU_PICST         ------------------------------------------------------MSGETP
CLU_PICGU         ------------------------------------------------------MTED--
CLU_EMENI         -----------------------------------------------MAQTNGEMEHSKE
CLU_ASPFU         MAIWSTRKVGLDNLRISQLLNFRGFDPSALVTKLTDPFSLQRLLTLNQSRSPPMVNRLKD
C0NW18_AJECG      -----------------------------------------------MEQPTKEKEPSKE
CLU_SCLS1         --------------------------------------------MAATNEVIPTSENPSD
CLU_PHANO         -------------------------------------------MAASSNDASKSAMANSN
C7YZ61_NECH7      ----------------------------------------------MASDPTPPAPAHVD
CLU_NEUCR         --------------------------------------------MADASQATTPAAEGNP
D5G8Q8_TUBMM      ----------------------------------------------MANISEKIRTGDEA
CLU_SCHPO         --------------------------------------------MSTIDLPTSSLPGSSG
CLU_MALGO         ------------------------------------------------------------
CLU_USTMA         ----------------------------------------------------MDPVTQAP
CLU_YARLI         --------------------------------------------MTSEQEEVSILTLQVT
CLU_CRYNJ         -----------------------------------------------MSESAKAAAQNGQ
E3K6B8_PUCGT      -------------------------------------MAADPTPEVTELPANQEKNEEEA
                                                                              

G1LLQ3_AILME      -------MLLNGDCPESLKKEERAPELPRENGLDEA--------EPGEET----------
G1PQX9_MYOLU      -------MLLNGDCPESLKKEEGPTEPPQENGLDEA--------EPGEET----------
CLU_HUMAN         -------MLLNGDCPESLKKEAAAAEPPRENGLDEA--------GPGDET----------
H0WHW6_OTOGA      -------MLLNGDCPESLKKEERVAEPPRENGLDEA--------EPGDET----------
CLU_MOUSE         -------MLLNGDCSENLKKEEGTSEPPRENGLDEG--------EPGDET----------
CLU_XENTR         ------MTLMNGDGAHEHQAEAEPKQ----NGHEMG--------DQTEEG----------
H3BFU0_LATCH      CDHSSGMALVNGDGAHDHL-EAESKQ----NEREGG--------EQGTDG----------
CLU_DANRE         CGHGVETAVMNGDAGHDQAEEADSKQ----DGSGDA--------DQAEDA----------
C3Z652_BRAFL      ------------------MAVEEARK-----GSSEG--------ERVEK-----------
CLU_AEDAE         NGKDKETTPPPTTTGAKEPLVNGHSAAVNGMNGHTS-------EGEQQKDKTAAEDKK--
CLU_ANOGA         NGLNGHASSEESDPAAAGPNESADDKSAGVAGGGET-------EQQQQQQ----------
E9GHX8_DAPPU      KGVEISKQHKEDQNAGKKGSSINGEKDLNLNTESTE-------EKDDEKK----------
E0VTU9_PEDHC      RFNEIPDNRDEVIEKG----------EVEATKEKEK-------NDDKEKK----------
CLU_DROME         TAADGPAAKKKGKKNRNKSPTEPTTEAVLSNGHAEKPTVVDAVEDNADTNANVEKPQE--
CLU_DROPS         TAADGPATKKKGKKNRNKSPPVSTDEAALSNGHVEEKKPEGDGDADADANANVVAVKDEK
F6RE09_XENTR      ------------------------------------------------------------
CLU_CAEBR         LKAEVDAPVVN------GKDELVHEEDNNDSGHSSI--------NTPDASE---------
CLU_CAEEL         TKTDVEVPIIN------GKHEIPQEE--NDSGHSSI--------NTPDSSEP--------
CLU_BRUMA         VMGEVNGPVCSPEIVLASAGKTLSENGQENSPHNSD--------SGHETSSPDSPLTPIE
CLU_DICDI         ISIKTPAEIGTINIQVQPTDTLIDIQSFLYETSETC--------LYSSFEFR--------
D3B1P9_POLPP      ISLKTPVELGTIKLTISDTDSIGDIHKFLQETTETC--------LLTSYHLE--------
CLU_ARATH         ATAAA-PVTAPDNGTLTAVDSAVPEANEVAPTIPKA--------DESESQVE--------
D7T2X0_VITVI      VTASG-SNQAEANGVMATAES----------NSTNS--------EVKESETA--------
C5XZV7_SORBI      AEVVN-PENGEVHETPATEDGVA--------DVEKR--------DGDAPEAV--------
A9RLF4_PHYPA      ASIKQLPAEAPKQDVAEALAESSGVETSAAASEKTE--------RSDESVEA--------
D0P366_PHYIT      GKTGQPLRLESVSPSDTVLALRQLIGEFPALACYTC--------YHLEAKRL--------
H3GWU1_PHYRM      AKSGQCVRLESVGASDTVVSLRQLIAEFPALACYTS--------YHLEAKSS--------
A0E685_PARTE      ------------------------------------------------------------
Q6BG47_PARTE      ------------------------------------------------------------
CLU_ASHGO         ---MSKELDTVEVSIRVPFG-----------KSKR-------------------------
CLU_KLULA         ---MSADNIEVIVKGTPSYT-----------KSKNS------------------------
CLU_YEAST         -KKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSS------------------------
CLU_VANPO         GKNSTAELSAVKVTVKLPESIVHHRSHQKKQQSHNV------------------------
CLU_CANAL         EKIEETQQQQQESVPVKELLLKVQLPSFFNVGDDYL------------------------
CLU_LODEL         VVVDADQQQAQAVVAPQQLELQIKLPSFIDQKGD-L------------------------
CLU_DEBHA         ----EASSEALAQEDIKQITLRIKLPACIS-NEEDL------------------------
CLU_PICST         VKPVEVDNDVEALESAKELSLKIDLPACLN-AGDSL------------------------
CLU_PICGU         ----NAEGQETALSSQNLVSVEITLPKDVSGASKPL------------------------
CLU_EMENI         SPEQ----------ITNGNNQEVVQ--EDDGAGGLF------------------------
CLU_ASPFU         SRKRRAAVVCRIRDTRDGWFSSLSS--LTSSVIGLF------------------------
C0NW18_AJECG      VAEK---------NGDEQTPNGHHV--DGEHDGGLF------------------------
CLU_SCLS1         VSGSSQKLATEETALANGVDHEEED--SGEAGGEVF------------------------
CLU_PHANO         VTTEVAQTPSKEQDVNGEVEATEEDGANGQLPDNIF------------------------
C7YZ61_NECH7      ASEEPEN-------TMAAEAPDVDAGAEALL-----------------------------
CLU_NEUCR         VPEVPETQTPPADVNGTTEQEQTEEGAEQALEDQPF------------------------
D5G8Q8_TUBMM      LDANTSKVTSQPTTERNEREEIFQDGAGAPQLHDLF------------------------
CLU_SCHPO         --------------------DPSGTEMSHSDVDVSV------------------------
CLU_MALGO         ----MAEPE-SEPNATFELELFLPGRPLLPKDVKSL------------------------
CLU_USTMA         APEGVDAPEIDESLQPFEINLYLPKRPLIPSAAASAN-----------------------
CLU_YARLI         FPDPELPPLSLTVSPEESVQEIRNYIRDAFVQERCIT-----------------------
CLU_CRYNJ         AEEQQLQQQLDEQQQLEEQQQLPPVTIRIPSPTCSRTVP---------------------
E3K6B8_PUCGT      KQSQNDTTPADPEPAGFQLSIFIPRPNFCSEVNLTPS-----------------------
                                                                              

G1LLQ3_AILME      --------------------------TGQEVIVIQDTG------------------FSVK
G1PQX9_MYOLU      --------------------------TGQEVIVIQDTG------------------FSVK
CLU_HUMAN         --------------------------TGQEVIVIQDTG------------------FSVK
H0WHW6_OTOGA      --------------------------TGQEVIVIQDTG------------------FSVK
CLU_MOUSE         --------------------------TGQEVIVIQDTG------------------FSVK
CLU_XENTR         --------------------------NEQEVIVIQDTG------------------FTVK
H3BFU0_LATCH      --------------------------NEQEVIVIQDTG------------------FTVK
CLU_DANRE         --------------------------NEQEVIVIQDTG------------------FTVK
C3Z652_BRAFL      --------------------------DDQEVIVIQDMG------------------FNIK
CLU_AEDAE         ------------------------KPDSDVMEIIQDTG------------------FTVQ
CLU_ANOGA         --------------------------EDDVMRLMQETG------------------FTVQ
E9GHX8_DAPPU      --------------------------EDQDVVFVQDVG------------------FTIK
E0VTU9_PEDHC      --------------------------DDQEVLFIQDLA------------------FTVK
CLU_DROME         ----------------GGAPDAEADGDDIDLDALQDIG------------------ITVN
CLU_DROPS         AEGG------------DGADAAELDTEDIDLDALHDAG------------------IHVN
F6RE09_XENTR      -------------------------------------M------------------FDVK
CLU_CAEBR         ---------------------------DKQTDKLV----------------------KVT
CLU_CAEEL         ---------------------------DKQVDKFV----------------------KIT
CLU_BRUMA         EGAVSPGDDSFFVVWIKFMVLPRKLCINKDVEKLFSAAEKTGNDGEVLCPSDECDTFRIR
CLU_DICDI         --------------------------LYG--KQIPEYS--------------ELSSIEGL
D3B1P9_POLPP      --------------------------VEGIPKKLNEFA--------------DVKFYSEI
CLU_ARATH         --------------------------NNDAQPKQG-----------------ELRLYPVS
D7T2X0_VITVI      --------------------------NTKDGSKQG-----------------EINLYPVS
C5XZV7_SORBI      --------------------------QPARKPAEG-----------------ELHLYPVP
A9RLF4_PHYPA      --------------------------EKKEKAESGETP--------------ELLLYPII
D0P366_PHYIT      --------------------------TDDTWEPLNDFV--------------ELSEYENV
H3GWU1_PHYRM      --------------------------ADGSWQPLNDFV--------------ELGEYESV
A0E685_PARTE      --------------------------MKQTKEES------------------------VK
Q6BG47_PARTE      --------------------------MKQTKEES------------------------VK
CLU_ASHGO         ------------------------------------------------------------
CLU_KLULA         -------------------------------------------------------D----
CLU_YEAST         -------------------------------------------------------K-NND
CLU_VANPO         -------------------------------------------------------KETNE
CLU_CANAL         -------------------------------------------------------TIPSS
CLU_LODEL         -------------------------------------------------------KIPSH
CLU_DEBHA         -------------------------------------------------------EVPSL
CLU_PICST         -------------------------------------------------------SIPSN
CLU_PICGU         -------------------------------------------------------TVKMA
CLU_EMENI         -------------------------------------------------------QISVK
CLU_ASPFU         -------------------------------------------------------QISVK
C0NW18_AJECG      -------------------------------------------------------QISVK
CLU_SCLS1         -------------------------------------------------------QLTVV
CLU_PHANO         -------------------------------------------------------QIKIK
C7YZ61_NECH7      -------------------------------------------------------TLTII
CLU_NEUCR         -------------------------------------------------------VVTIV
D5G8Q8_TUBMM      -------------------------------------------------------QLTVK
CLU_SCHPO         -------------------------------------------------------DIDVI
CLU_MALGO         ------------------------------------------------------------
CLU_USTMA         ------------------------------------------------------------
CLU_YARLI         -------------------------------------------------------SFTLN
CLU_CRYNJ         ---------------------------------------------------------KPK
E3K6B8_PUCGT      ------------------------------------------------------QPNADP
                                                                              

G1LLQ3_AILME      ILAPGIEPFSLQVSPQEMVQEIHQVLMDREDTCHRTCFSLH-------------------
G1PQX9_MYOLU      ILAPGIEPFSLQVSPQEMVQEIHQVLMDREDTCHRTCFSLH-------------------
CLU_HUMAN         ILAPGIEPFSLQVSPQEMVQEIHQVLMDREDTCHRTCFSLH-------------------
H0WHW6_OTOGA      IVAPGIEPFSLQVSPQEMVQEIHQVLMDREDTCHRTCFSLH-------------------
CLU_MOUSE         ILAPGIEPFSLQVSPQEMVQEIHQVLMDREDTCHRTCFSLH-------------------
CLU_XENTR         VQVPGVETFSIQVSPQEMVQEIHQVLMDREDTCHRTCFSLQ-------------------
H3BFU0_LATCH      IHAPGIEPFDLQVSPQEMVQEIHQVLMDREDTCHRTCFSLQ-------------------
CLU_DANRE         IQAPGTEPFDLQVSPQEMVQEIHQVLMDREDTCHRTCFSLQ-------------------
C3Z652_BRAFL      VVAPGIEPFELQVSSQEMVQEIHQVLMDREDTCHRTCFSLQ-------------------
CLU_AEDAE         ILSPGVEPLSIQVSSMELVQEIHQLLMDREDTCHRTCFSLQ-------------------
CLU_ANOGA         VLSPGVEPLSIQVSSMELVQEIHQLLMDREDTCHRTCFSLQ-------------------
E9GHX8_DAPPU      ITAPGVEPFDIQVSSMEMVQEIHQLLMDREDTCHRTCFSLQ-------------------
E0VTU9_PEDHC      ISSPGADSFDLQVSSMELVQEIHQLLMDREDTCHRTCFSLQ-------------------
CLU_DROME         ISSPGADLLCVQLSSMELVQEIHQLLMDREETCHRTCFSLQ-------------------
CLU_DROPS         ISCPGSELLTVQLSSMELVQEIHQLLMDREESCHRTCFSLQ-------------------
F6RE09_XENTR      IQLPSGELVDIQVSSKELVQEIIQVLMEHEDSCHRTCFSLQ-------------------
CLU_CAEBR         IQPSCGEAFDLHLSDNELVQELYQTLLDREATCHRTCFSLY-------------------
CLU_CAEEL         IQPSCGDAFELHLSDNELVQELYQTLLDREATCHRTCFSLY-------------------
CLU_BRUMA         IIAPGAEPFDLQVNSNEMVQELHQVLLEREATCHRTCFSLQ-------------------
CLU_DICDI         VEGATLEMVPVDYNERSAKLHVKRLRDIMNTGLTEFANMNN-------------------
D3B1P9_POLPP      TSGATLVMKKAPYNERSANLHVNRLKSIISSGEWETHPTN--------------------
CLU_ARATH         VKTQSGGKMELQLNPGDSVMDIRQFLLDAPETCYFTCYELL-------------------
D7T2X0_VITVI      VKTQGGEKLELQLNPGDSVMDVRQFLLDAPETCFFTCYDLL-------------------
C5XZV7_SORBI      VRTQSGEKLELQLSPGDSVIDVKQFLLDAPETCFYTCYDLI-------------------
A9RLF4_PHYPA      VKGPSGEKLELQVNPGDSVMDLRQFLLDAPETCFYTCYDLI-------------------
D0P366_PHYIT      TDGVTLRMMLDKYDARKARAQVRRFRDVLSNPPIPQAAVEL-------------------
H3GWU1_PHYRM      ADGVTLRMALDKFDARKVRGHVRRFRDVLNNPPIPQAATEP-------------------
A0E685_PARTE      LYLDFYDKYTWPLEIAETLLEVRQYLTESTILSLFQNFYFS-------------------
Q6BG47_PARTE      LYLDFYDKYTWPLEIAETLLEVRQYLTESTILSLFQNFYFS-------------------
CLU_ASHGO         LSTTASR-RARVQSIMYFLAFNAASKYYTNYELLHN--GVE-------------------
CLU_KLULA         IKYQLGK-ESNVSHLRTFLSFEESTKFYTSYDLIEN--SRV-------------------
CLU_YEAST         ISFEIGK-ESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQ-------------------
CLU_VANPO         LSFQFPR-ETRVQTILDVLSYAQATKYLTNFKLKTV--HQI-------------------
CLU_CANAL         YEENIAD-LKQALNIIVLCRNLTNYSILIKGIDIIENFGEL-------------------
CLU_LODEL         YEETITD-LKLTLTVIPKTRSLTNYLILIQGEHDVEQFGEI-------------------
CLU_DEBHA         LSETLAD-IRETLNLSAATQNLTNFNVFYQDINLSENFDDL-------------------
CLU_PICST         YDETIND-LKQALSLLPLSRSLTNYTIYINGTNVSDSVDDL-------------------
CLU_PICGU         ESDTISD-LTSTLGLLSSMRDLTNYYVFYRNTNISETFDEL-------------------
CLU_EMENI         LPHEPYK-IQVMVSSQEQVQDVRQSIVELPGTFQYTCFHLE-------------------
CLU_ASPFU         LPHEPYK-IQVMVSSQEQVQDVRQSIVELPSTFQYTCFHLE-------------------
C0NW18_AJECG      LPHEPYN-IQVTVSSQEQVQDVRQSIVELPGTFQYTSFHLE-------------------
CLU_SCLS1         LPREPHK-IPIIVSSQEAIHDVRQSIIELPGTFQYSCFHLE-------------------
CLU_PHANO         LPHEPFE-IPMTISTAEQVQDLRQSIIEMPNTFQYSCFHLE-------------------
C7YZ61_NECH7      LPDAKASKMQIMVSSQEQVHEVRQSIIDLPSAFQYTCFHLE-------------------
CLU_NEUCR         LPNTTET-LDIPVSPMEQIHEIRQSIIEHPIAIEFSCFHLE-------------------
D5G8Q8_TUBMM      LPHHPNS-MQIMVSTSEQVQDIRQSIIELPDTFQYTCFHLE-------------------
CLU_SCHPO         FPDHTQT-LSFSLLLSNTIHDVRQVILELMLAPPHTCFHLE-------------------
CLU_MALGO         GLPETPPSLKVAVTQHETLNDLRITLNDSPEGYWLGAFRFRRPDS---------------
CLU_USTMA         GLPETPSPLKVAVTPQETLNDLRVTITDSPEGYWLGAFCFRKPLASPNSTAK--------
CLU_YARLI         LNGQPIDGFESLAEIEGLESGATIELTNAPYNEHEARLHVI-------------------
CLU_CRYNJ         DSTEPLDRITLYPQPQETIQDIKLLINDWVGAYWLGPYSLQLPFVKGEDGRGKIYSKKKD
E3K6B8_PUCGT      EPESEYIELILPAHGPETIRELQQSVIESAEGWWLGSIGLASVELDPNGKPD--------
                                                                              

G1LLQ3_AILME      ----LDGNMLDHFSELRSVEGLQEGSV--------LRVVEEPYTVREARIHVRHVRDLLK
G1PQX9_MYOLU      ----LDGNMLDHFSELRSVEGLQEGSV--------LRVVEEPYTVREARIHVRHVRDLLK
CLU_HUMAN         ----LDGNVLDHFSELRSVEGLQEGSV--------LRVVEEPYTVREARIHVRHVRDLLK
H0WHW6_OTOGA      ----LDGNMLDHFSELRSVEGLQEGSV--------LRVVEEPYTVREARIHVRHVRDLLK
CLU_MOUSE         ----LDGNMLDHFSELRSVEGLQEGSV--------LRVVEEPYTVREARIHVRHVRDLLK
CLU_XENTR         ----LDGNVLDNFAELKTIEGFQEGSV--------LKVVEEPYTVREARIHVRHIRDLLK
H3BFU0_LATCH      ----LDGNVLDNFAELKTIEGLQEGSI--------LKVVEEPYTVREARIHVRHIRDLLK
CLU_DANRE         ----LDGNVLDNFAELKSIEGLQEGSL--------LKVVEEPYTVREARIHVRHIRDLLK
C3Z652_BRAFL      ----FEGNVLDNFAELKNIEGLQEGSV--------LKVVEEPYTVREARIHMRHVRDLLK
CLU_AEDAE         ----LDGVTLDNFAELKNIEGLKEGSI--------IKVVEEPYTMREARIHVRHVRDLLK
CLU_ANOGA         ----LDGRTLDNFAELKNIDGLQEGSV--------IRVVEEPYTMREARIHVRHVRDLLK
E9GHX8_DAPPU      ----LNATTLDNFAELKSIEGLKEGSI--------IKVVEEPYTMREARIHLRHVRDLLK
E0VTU9_PEDHC      ----LDGNTLDNFAELKSVEGLREGSV--------IKVVEEPYTIREARIHVRHVRDLLK
CLU_DROME         ----LDNVTLDNFAELKSINNLEQGST--------IKVVEEPYTMREARIHVRHVRDLLK
CLU_DROPS         ----LDNVTLDNFAELKTIEQLESGST--------IKVVEEPYTMREARIHVRHVRDLLK
F6RE09_XENTR      ----FEGNVLDNFSELKSVEGLKEGSV--------LKVVEEPYTIREARIHIRHFRDLLK
CLU_CAEBR         ----LNGTAVDNYSEVRSVPGFIDGCT--------LNVVDEPYTVRDARLHLRQVRELLR
CLU_CAEEL         ----LNGTAVDNYSEVRAIPGFVDGCT--------LNVVDEPYTIRDARLHLRQVRELLK
CLU_BRUMA         ----LNGVSLDHFTELKNISGLTDGSV--------LRVVEQPYTTREARIHVRHIRDLIR
CLU_DICDI         ----PSLFTSFSFPEKSNILTEEQQLE--------EQKQKFEQQQQQQQQTEDKEEKETI
D3B1P9_POLPP      ----PSLFSLYSF-------TDENPIE--------DQQQ---QQQIENNNNNNNSNNKLN
CLU_ARATH         ----LRNKDGETHHLEDYNEISEVADI--------TIGG-CSLEMVAALYDDRSIRAHVH
D7T2X0_VITVI      ----LHTKDGSVHHLEDYNEISEVADI--------TTGD-CSLEMVAALYDDRSIRAHVN
C5XZV7_SORBI      ----LHTEDGSAHQLEDYNEISEIADI--------TSGG-CSLEMVAAIYDERSIRSHLR
A9RLF4_PHYPA      ----LNVADGARYHLAEYLEIGEVADI--------SSGG-CSLEMVNALYDDRMVRSHVR
D0P366_PHYIT      ----ETQPET-ADKVEEPADSKEIDEQ--------KLKE-ISEQQLKRLREIHHKLEGIE
H3GWU1_PHYRM      ----EAQPEG-VADTS----NEEPDDK--------ALKE-MSEKQLKRLREIHHKLEGVE
A0E685_PARTE      ----HKGQRINEYSEFSIPDGGKLQVL--------LDEFNERTARFHLRRVQEIIANLSH
Q6BG47_PARTE      ----HKGQRINEYSEFSIPDGGKLQVL--------LDEFNERTARFHLRRVQEIIANLSH
CLU_ASHGO         ----VDEQQLISELAGNEQT-------------VHLQLRLKPYNTGEVIRHFVTFREYIG
CLU_KLULA         ----VDDEDVLGDLAGNGSS-------------LTFQFKPKAYNLVTAVQHIVGLRETLG
CLU_YEAST         ----LSDEMSIKEIVG-EKS------------ELKLQLILKPYSAREALKHVITVRDFIG
CLU_VANPO         ----LNPEQSINEIINDEKSN-----------HLNLSIELCPYNTREIVRHVLTLRDFIG
CLU_CANAL         ----ITFEQIISHFELDKQEEQEEQGQEREISELKIVIKEKSYNLASIYEQISRFREVIG
CLU_LODEL         ----VTFGQIIEELALGEPE------------CLQIQIREKPYNLAAVYEQIIRLREIVG
CLU_DEBHA         ----VPLNDILTELGVGEID------------SLNLVLKEKPYNLAAIYDHLNKFREVIG
CLU_PICST         ----TTFSQLFELFQWDSVD------------LLKVTIKERAYTLAAVYEQISRFREIIG
CLU_PICGU         ----CPISEVISALRVESQP------------NVKLELRHKPYTLAAVYEHLNKFREVIG
CLU_EMENI         ----FNGKRINDFVELSEVPGLQADSE--------IVLVEDPYTEKDARMHVVRLRELLG
CLU_ASPFU         ----FNGKRINDFVELSEVEGLKADSE--------IVLVEDPYTEKEARMHVVRFRDLVG
C0NW18_AJECG      ----HNGTRINDYIELSEVKDIQSNSE--------VVLVEDPYTEKEARMHVIRIRELIG
CLU_SCLS1         ----HKGERINDFVQISEVPGLTADSE--------IHLVEDPYTEKEARIHIVRVRELIG
CLU_PHANO         ----HKGQRINDFVDLSEVPELGPDSV--------LEVKEDPYNEKEARLHVIRVRELIG
C7YZ61_NECH7      ----FNGEKINDFIPLAEIPDLGATPE--------FHLVQDPYTEKEARIHLVRIRELIG
CLU_NEUCR         ----FNGKKINDFIQVSDVEGLEHGAQ--------LHLVEDPYTEKEARIHLIRIRELIG
D5G8Q8_TUBMM      ----HNGTRISDFVELSDVPGITPDSE--------LILVEDPYTEKDARLHLLRVRELIG
CLU_SCHPO         ----YKREKLHSFLEIGQIPHLKLSKTR----KIVLEVVLDPYTERESKYHIYTLLEFLS
CLU_MALGO         --HTRKGELVNEWEELQEVFRHDAPHDR------ILQVSHEPYNETEVRLHIQRLRDLLS
CLU_USTMA         GGKVQLGERVPEWTELREIFEGVDKDKR------ELHVTHVPFNEADARAHVQRLRDLLS
CLU_YARLI         -----RVRELAGFSNNSHAAVGQDAGMTAFNRTEGIDKTPKDYMQEVVETKAQKEAKAKL
CLU_CRYNJ         FSEVRAGEKLNEWLEVQDAFEHLQEGEE-----RVLEAVREPYGELSARQSIIRLLELIA
E3K6B8_PUCGT      PQQLSVRTVYGEFAELSSAFQSDKFKDP--DAKRALLAINIDYTEYSARLHVIRLRDVLY
                                                                              

G1LLQ3_AILME      ------------SLDPSDAFNGVDCNSLSFLSVFTDGDLG--------------------
G1PQX9_MYOLU      ------------SLDPSDAFNGVDCNSLSFLSVFTDRDSE--------------------
CLU_HUMAN         ------------SLDPSDAFNGVDCNSLSFLSVFTDGDLG--------------------
H0WHW6_OTOGA      ------------SLDPSDAFNGVDCNSLSFLSVFTDGDLG--------------------
CLU_MOUSE         ------------SLDPSDAFNGVDCNSLSFLSVFTDGDLG--------------------
CLU_XENTR         ------------SLDPSDAFNGVDCNSLSFLSVFTDGDLG--------------------
H3BFU0_LATCH      ------------SLDPSDAYNGVDCNSLSFLSIFTDGDLG--------------------
CLU_DANRE         ------------SLDPSDAYNGVDCNSLSFLSVFSEGDLG--------------------
C3Z652_BRAFL      ------------SLDPADAYNGMDCSSLSFLNVITEGDI---------------------
CLU_AEDAE         ------------SMDPADAYNGVDCSSLTFLHTITQGDIL--------------------
CLU_ANOGA         ------------SLDPADAYNGVDCSSLTFLHTITMGDIM--------------------
E9GHX8_DAPPU      ------------SLDPSDAYNGLDCSSLSFLNVVTQGDIL--------------------
E0VTU9_PEDHC      ------------SIDPADAYNGVDCCSLAFLNVVTQGDIL--------------------
CLU_DROME         ------------NLDPADAYNGIDCTSLTYLNTITQGDLL--------------------
CLU_DROPS         ------------NLDPADAYNGIECTSLTYLNTITQGDLL--------------------
F6RE09_XENTR      ------------SLDLTDAYNGVDCSSLSFLNIISEGDIGDSLCHESNG-----------
CLU_CAEBR         F-----------GLVQDQHEPPCGNEAQSYLASIDLNPSE--------------------
CLU_CAEEL         F-----------GLTEDQHEPPCTNDAQSYLTTINLQPEE--------------------
CLU_BRUMA         ------------SLDMSDAVNGTDGASMSYLASMTLGDRK--------------------
CLU_DICDI         A-----------TEQQQNKKNKHHNKKGNKKNNGDESLNN--------------------
D3B1P9_POLPP      V-----------QNKSKSKKSKSTSKKSSKKD----------------------------
CLU_ARATH         R-----------ARDLLSLSTLHSSLSTTLALQYDAALNK--------------------
D7T2X0_VITVI      R-----------ARELLSLSSLHASLSTSLALQHETSQTT--------------------
C5XZV7_SORBI      R-----------VRELLSLSSLHVSLSTSLALQHESAQGK--------------------
A9RLF4_PHYPA      R-----------TRDLISTSSIHSSLSTALAMEYEAKQAG--------------------
D0P366_PHYIT      I-----------PVKPELSEFYSFPGATTAVKEESEQTDT--------------------
H3GWU1_PHYRM      V-----------PVKPELAEFYAFP---TPVAQEDAEPTP--------------------
A0E685_PARTE      Y-----------QYLCKGKNQNEDSLSLKEIGDLQLNDIL--------------------
Q6BG47_PARTE      Y-----------QYLCKGKISNEDSLSLKEIGDLQLNDIL--------------------
CLU_ASHGO         F-----------VGDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQKEEF---
CLU_KLULA         F-----------SSELEDGISEFAISSGSQFQDMSLEPNSEKSNGSETT-----------
CLU_YEAST         F-----------AQETSDGLSEFAISTGSSFSSLPLGPIKERSKQEEKDEKSDPEEK---
CLU_VANPO         F-----------ALETEDGISEFSISTGSKFSNIPFMDVKEKQEEIEEIPRDDNKNLP--
CLU_CANAL         L-----------HYIDRLSNDIGSCGGVSKFNGIQLDDIKPK-EAKKEESTEKEQQ----
CLU_LODEL         L-----------HYVDKVSQELGSCGGVTRFNSIKLDPVTARGEAEKSDTNEEEQEQGKG
CLU_DEBHA         L-----------HFLDKYSSEVGVLSGVSKFGDIDLQDVKETEPETQDDKDKETDETKST
CLU_PICST         L-----------HYVDRMAEDLGVASGVSRLNELTLNAVKERE--NQEEKDRNEKSEKDE
CLU_PICGU         L-----------HFIDRRAFELGELSGVGKFDQLQLSQVPDQK-----------------
CLU_EMENI         A-----------AG-DRVDTINGVNAGLSLHDSIAAEAGSEKSE----------------
CLU_ASPFU         A-----------AG-DRSDNLHGLNAGLSLHDAVTAEAATDDV-----------------
C0NW18_AJECG      A-----------AG-DRVDNLHGICAGLSLHDSVAAGEQLTDTKEGE-------------
CLU_SCLS1         A-----------AG-DRTDTLNGIISGVSLLDSVTSAESTQNGT----------------
CLU_PHANO         A-----------AG-DRTDALHGIMAGLSLHDTVGLDQSGKPKE----------------
C7YZ61_NECH7      A-----------AG-DRSDTTQGLLPGLSLFETVASEAQGSAEEES--------------
CLU_NEUCR         A-----------SG-DRTDTVHGVLAGVSVHDDIVVENPDAPEAE---------------
D5G8Q8_TUBMM      A-----------AG-PRIDLVNGISAGLCLFDGIGVENRDDSKKP---------------
CLU_SCHPO         R-----------KL-PSSSTSPGIRAGFCIFPSLNIPSGENLQIKSS-------------
CLU_MALGO         G-----------TQSDPASVSVDAGATVHDAIVHANEWAHDAHMPAP-------------
CLU_USTMA         G-----------GAADPSAIGVDAALSVQDAVRNPQEWQQDAARQNANGRAV--------
CLU_YARLI         K-----------AEQKKAKAAAKAEALAKNEEVSEDEESEPE------------------
CLU_CRYNJ         P-----------SGTTANTTSNPLGLQAGSTIFEQVRDGLVSANAETTYEEVEVSLPSGR
E3K6B8_PUCGT      SQAPGLLVGNPTPFPPYDPSQIGISGAVSLFPFVRGDQGTTGADSPACEQNLTDQPGTGP
                                                                              

G1LLQ3_AILME      ----------------------DSGKRKK-GLEMDPIDCTPPEYILPGSRERPLCPLQPQ
G1PQX9_MYOLU      ----------------------DSGKRKK-GLEMDPIDCTPPEYILPGSRERPLCPLQPQ
CLU_HUMAN         ----------------------DSGKRKK-GLEMDPIDCTPPEYILPGSRERPLCPLQPQ
H0WHW6_OTOGA      ----------------------DSGKRKK-VLEMDPIDCTPPEYILPGSRERPLCPLQPQ
CLU_MOUSE         ----------------------DSGKRKK-GLEMDPIDCTPPEYILPGSRERPLCPLQPQ
CLU_XENTR         ----------------------DSGKKKKKGNELEQIDCTPPEYILPGSKERPLSPLQPQ
H3BFU0_LATCH      ----------------------DSGVRKKKGIELEQIDCTPPEHILPGSKERPLVPLQPQ
CLU_DANRE         ----------------------DTGKRKKKGSELEQIDCTPPEHILPGSKERPLVPLQPQ
C3Z652_BRAFL      ----------------------DMKKRKR--NDSDSVDCTPPDYVMPGAKDRPILPLQPM
CLU_AEDAE         ----------------------EKKKGRS-----ESVDCTPPEHIMPGAKDRPLLPLQPG
CLU_ANOGA         ----------------------EKKKTRQ-----ESVDCTPPDFIMPGARERPLLPLQPG
E9GHX8_DAPPU      ----------------------EKKKSRP-----ESVDCTPSDSIIPGSTERPLVPLQPQ
E0VTU9_PEDHC      ----------------------EKKKTKP-----DSVDCTPPEYIMPGSKERPLIPLQPQ
CLU_DROME         ----------------------DKKRTRP-----DSVDCTPPEYVTPGVSDPPILPLHPN
CLU_DROPS         ----------------------DKKKTRP-----DSVDCTPPDYVTPGVFEPPLLPLHPN
F6RE09_XENTR      ----------------------KKKKRSPADQGLEAIDCSPPEYILPGSTERPLQPLQPI
CLU_CAEBR         -----------------------KKESKQ-------SDILPPDYVLPGCKERSLAHLVVP
CLU_CAEEL         -----------------------KKEPKP-------SDILPPDHALPGCKERSLAHLLVP
CLU_BRUMA         -----------------------KNADKT-------LECSPPDYVLPGYKERPLIPLLPV
CLU_DICDI         --------------------------ENNEEKLTPQQKERKQKMTEIKGIDKPMLSSYYP
D3B1P9_POLPP      ----------------------------------LELAERKKEVVQVDATQKALLSNYYP
CLU_ARATH         --------------------------VQNPGDKPKSDVPELEC-LGFMEDVPGSLKKLIN
D7T2X0_VITVI      --------------------------ASSSGDPVKTEVPELDG-LGFMDNVAGSLSNLLS
C5XZV7_SORBI      --------------------------SAGS---EKSPIQELDG-LNFMEDSAGALTNLLA
A9RLF4_PHYPA      --------------------------RNLKTEPVKMELAELEGGLGFMEDSCGQLNLLIS
D0P366_PHYIT      --------------------------PAKIKKGKKGKKNQHKQ--KQQQQNETNQKEQEQ
H3GWU1_PHYRM      --------------------------AKDQKKAKKGKKNQLKQ--KQNEANQHKEPEQKQ
A0E685_PARTE      -------------------------------------------------QPAIKPTLLLN
Q6BG47_PARTE      -------------------------------------------------QPAIKPTLLLN
CLU_ASHGO         --------------------------QVSDAEKAVFTKELDSILELRP---SAQDV--LK
CLU_KLULA         ---------------------------ISDQEKVKFLQTCNELLESTN---TDFNIASLK
CLU_YEAST         ---------------------KNTFKDVTDEEKLKFNEMVHEVFSSFK---NSSINKLLT
CLU_VANPO         ---------------------KKNVLKVSQEEKDNFSKEVHSILDSFKYS-NSNLKSAYS
CLU_CANAL         ------------EKE---------ELSISKEEVSKISDFAKQFISDSFDGNDFTKLTKFD
CLU_LODEL         KVGKP------NEKESGETKETDSQPELSREELLQLSDLVKE-IEESPESINFTQATKFD
CLU_DEBHA         KEDSN------QTEEKKS------EIVFTAEEKQQIGKITDELISGNTPSLVEFG--TFD
CLU_PICST         KDE--------KSEETEE------SFVLNEEDIKSLKISAEDLSSTIDIDLAATAA-SFN
CLU_PICGU         -------------EDEKE------KVDLGEDDKASISSICDRILDETKLDLSEYG--KFY
CLU_EMENI         -----------------------------------KEHSLAKYDIPGSSSLKTILPR-SE
CLU_ASPFU         -----------------------------------KEHSLSKYDIAASPSLETILPR-AE
C0NW18_AJECG      -------------------------------RGVVRDHALVDYDMTAPPVLQTILPR-AQ
CLU_SCLS1         --------------------------------STAPSHPMVGFDFQASGTLSTLLPK-AQ
CLU_PHANO         --------------------------------DGPEQSPLADYDFKSSGAIKNLLPP-PQ
C7YZ61_NECH7      ----------------------------------TEELPIKDYDFQAVPSLTSLVPQ-PT
CLU_NEUCR         ---------------------------------------IKEYDFQAPADLAILLPK-ET
D5G8Q8_TUBMM      --------------------------------ITEEPQPMAGFDFNAPASLDQFLPKFPV
CLU_SCHPO         -------------------------------SSLEEINKIPENIVTQSLSYTNLLKKFET
CLU_MALGO         ---------------------------------------PKPSWRGWPQDGTAQLLPALA
CLU_USTMA         ----------------------TKKGVNDAAEASSELPLPLVDWAGWPSVTSIDLIPQVA
CLU_YARLI         --------------------------DDTPMKQSTQVLEENSPMHGFKLEESKSLQELFP
CLU_CRYNJ         KGK-------------------GGKKELVKVKRSVSGDKAHAFADWKGWAPASFGSLAVS
E3K6B8_PUCGT      SKNKKKKKSSQPTSSIVNMPQAAPEPAAQESAIESLGNYRFNSSNPFGVFSSLMGEQSEP
                                                                              

G1LLQ3_AILME      NRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDR-QVSITASTRGFYLNQST
G1PQX9_MYOLU      NRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDR-QVSITASTRGFYLNQST
CLU_HUMAN         NRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDR-QVSITASTRGFYLNQST
H0WHW6_OTOGA      NRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDR-QVSITASTRGFYLNQST
CLU_MOUSE         NRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDR-QVSITASTRGFYLNQST
CLU_XENTR         NKDWKPLQCLKVFTMSGWNPPPGNRKMHGDLMYLYVITMEDR-HVSITASTRGFYLNQST
H3BFU0_LATCH      NKDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLYVVTMEDR-HVSITASTRGFYLNQST
CLU_DANRE         NKDWKPMQCLKVLTMSSWNPPPGNRKMHGDLMYLYIVTVEDR-HVSITASTRGFYLNQST
C3Z652_BRAFL      SKDFKSPQCLKVLTASGWNPPPGNRKMHGDLMYLSVVTAEDK-HFHLTASTRGFFVNQST
CLU_AEDAE         VGKKG-PQPLKVLTTSAWNPPPGPRKLHGDLMYLYVVTMEDK-RFHISACPRGFFINQSS
CLU_ANOGA         TGKKGTPQPLKVLTTSAWNPPPGPRKLHGDLMYLYVVTMEDK-RLHISACSRGFYVNQST
E9GHX8_DAPPU      SKEQKGPNCIKVITTSGWNPPPGYRKLHGDLIYLYAVTLEEK-RLHITACTRGFYINQST
E0VTU9_PEDHC      AKEQKALQCIKILTTSGWNPPPGYRKMHGDLMYLYAITLEDK-HFHITACTKGFFLNMST
CLU_DROME         VKNAKGPQALKVLTTSAWNPPPGPRKLHGDLMYLYVVTMEDK-RFHISACSKGFFINQST
CLU_DROPS         FKNAKGPQALKVLTTSAWNPPPGPRKLHGDLMYLYVITMEEK-RYHISACSRGFFINQST
F6RE09_XENTR      SGDNKPLQCLKSMIMSGWNPPPGNRKMHGDLMYLNVITMEDH-HINITASNRGFYINQST
CLU_CAEBR         Q--QKELIAVKDIAFSPFNPPPGPRKLRGDVLYIDVTTVENR-VYHLTCCTRGFYVNNSQ
CLU_CAEEL         Q--PKELIALKDIAFSPYNPPPGPRKLRGDVLYIDITTVENR-IYHVTCCTRGFYVNNSQ
CLU_BRUMA         M--KEPVLALKSLAISPFNPPPGHRKLKGDVLYLTFDTREGR-RYHITCCTKGFYVNATT
CLU_DICDI         ESPIAPVQCVKSMIYSGWSPVPGYRKLFGDLFYLDITLLE-GTTICVTASTQGFFINQSS
D3B1P9_POLPP      TNFNKPIVVLRRIDRSGWAPVPGYRALLGDLFYMEVELVDIRETLFITANVIGFFINQST
CLU_ARATH         S-TSEEIRSVENIVFSSFNPPPSHRRLVGDLIYLDVVTLEGN-KYCITGTTKTFYVNSSS
D7T2X0_VITVI      S-HSKEIKCVESIVFSSFNPPPSNRRLVGDLIYLDVVTLEGN-KFCITGTTKVFYVNSST
C5XZV7_SORBI      S-APTEIKCVESIVFSSFNPPPSYRRLHGDLIYIDVATLEGN-KYCITGSSKSFYVNSSN
A9RLF4_PHYPA      LPDPQENPCVQTIAFSSFNPVPGYRRLLGDLIYLDVVTAEGK-SYCITAHTRGFYVNSSK
D0P366_PHYIT      QPIAKLPACVQSIVFSGYNPPPGPRKLAGDLLYLEVVAAGDNSRYHITSHVNGFFVNRST
H3GWU1_PHYRM      Q-DAKLPTCVKSIVFSGYNPPPGPRKLAGDLLYLEVVVAGDNTRYHITAHVNGFFVNRST
A0E685_PARTE      DDNKAIKQNVQQLGLSSFNPPPLSRKLKGDLFYIVLKTIESV-ELIITASNLGFYVNSSQ
Q6BG47_PARTE      DDNKAIKQNVQQLGLSSFNPPPLSRKLKGDLFYIVLKTIESV-ELIITASNLGFYVNSSQ
CLU_ASHGO         GGSALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGE-TLHITATVSGFYVNKSS
CLU_KLULA         TGNLLVTPVLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENE-TFHITTSISGFYVNKSS
CLU_YEAST         SESNIITPCVRSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGE-SFYITAIPSGFYVNKSN
CLU_VANPO         TISNIVTPCLNSLNLSAFNPVPAFFKTKGHILYLHIVTLEGE-SFHVTAVPSGFYINKSS
CLU_CANAL         DINGKVKIPIKSLTISQWSPVPPFQQAKGDLLYLSLQTLEHE-TFNITCHFSGFFVNKSS
CLU_LODEL         NINGKVKIPLKSFAVSQWSPVPSFQKTKGDLLYLTVQTLENE-TFHITSHFTGFFVNKCS
CLU_DEBHA         NISGSIKTPIKSLTVSQWSPVPSFQKLKGDLLYITLQTLENE-TLNITCHLSGFFVNKSS
CLU_PICST         NIHTKIKLPIKSLTISQWSPVPAFQKNKGDLLYLTLQTLENE-TFNITCHFSGFFVNRSS
CLU_PICGU         DIYSDLQVPIKSLTISQWSPVSPKEAVRGDLLYLTLQTLEND-TYHITCHLSGFFVNSCS
CLU_EMENI         APAPK---TVKSISLSPWNPPPHHLRQKGHLLYLQVTTNEGE-QFQITSHVSGFFVNKCS
CLU_ASPFU         APLPK---TVKSISLSAWNPPPYHLRQKGHLLYLQVTTNEGE-QFQITSHVSGFYVNKCS
C0NW18_AJECG      PSLPK---TVKAISLSPWNPPPYHLRQRGHLLYLQVTTNEGE-QHQITSHVSGFFVNKSS
CLU_SCLS1         EPGPK---TIKSISVSPWNPPPYHLRQKGHLLYLQVTTNEGE-QFQITSHVSGFYVNKSS
CLU_PHANO         EPAPK---CIKSIALSAWNPPPYHLRTKGHLLYLVAMTNENE-QHHITSHVTGFYVNKSS
C7YZ61_NECH7      EPAPK---TVKQIALSSWNPPPPHLRQRGHLLYLVVTTTEGE-QYQITSHVSGFFVNKSS
CLU_NEUCR         GPAPK---SIKSISLSPWNPPPAYWRQKGHLLYLVIQTNEGE-QHHVTAHVGGFFVNRCS
D5G8Q8_TUBMM      HPAPK---CVKSIALSPWNPPPHHLRQRGHLIYIQVTTLEGE-QFHITSHVSGFYVNRSS
CLU_SCHPO         SPNPSNNGCFRSLALSGWNPVPAEFVIQGHLLYLTVLTIEGK-TYNITSHVSGFYVNNCT
CLU_MALGO         RYPRVLPKCVRGMALSAWNPPPKSWALRGHLLYLSIDTLEGD-VLHITASVNGFFLNASS
CLU_USTMA         RRPRQLPVCVRQLSLASWNPPPQHCKLNGHLLYLQVGTLEGE-VIFVTASTHGFYVNRSS
CLU_YARLI         DRQNLPAPALLSLHLSHWNPPTQAQQLNGELLYLQCATLEGE-SYQIVAHTNGFYVANST
CLU_CRYNJ         SDPVEVAPSLKSIQISHFNPPPPHLRQKGHELYLQVSLLEGE-VVTLICSTRGWYVSKSN
E3K6B8_PUCGT      REPNLSARYLKSFALSTWNSPPHHYRLRGHYLYLAITTFENV-SYEITCHTKGFYVNKST
                           .  :  : : . .      *. :*:            :      :::    

G1LLQ3_AILME      AYHFNPKPASP------------------------------RFLSHSLVELLNQISPTFK
G1PQX9_MYOLU      AYHFNPKPASP------------------------------RFLSHSLVELLNQISPTFK
CLU_HUMAN         AYHFNPKPASP------------------------------RFLSHSLVELLNQISPTFK
H0WHW6_OTOGA      AYHFNPKPASP------------------------------RFLSHSLVELLNQISPTFK
CLU_MOUSE         AYHFNPKPASP------------------------------RFLSHSLVELLNQISPTFK
CLU_XENTR         AYNFNPKPANP------------------------------SFLSHSLVELLNQVSPTFK
H3BFU0_LATCH      TYSFNPKPANP------------------------------SFLSHSLAELLNQISPTFK
CLU_DANRE         TYNFSPKPANP------------------------------SFLSHSLVELLSQISAAFK
C3Z652_BRAFL      QETFNPKPASP------------------------------KCSAHSLIELLNQISPIFK
CLU_AEDAE         DDVFDPRPDNP------------------------------SYLCHSLIDLLSQISPTFR
CLU_ANOGA         DDAFNPQPANP------------------------------SYLSHSLIDLLSQISATFR
E9GHX8_DAPPU      DEEFNPKPANP------------------------------NHLSHSLIELLSQVSPSFK
E0VTU9_PEDHC      EEEFNPKPYNP------------------------------SHLSHSLIELLTHISPGFK
CLU_DROME         DDTFNPKPDNP------------------------------SHLSHSLIDLLSHISPSFR
CLU_DROPS         DDTFNPKPDNP------------------------------SYLSHSLIDLLSHISPSFR
F6RE09_XENTR      AELFNPKPATP------------------------------SHLSHSLVELLNQVSPAFK
CLU_CAEBR         EQKFDPTISNAN-----------------------------KTIYQSVIELLQNVSPGFK
CLU_CAEEL         DGRFDPTVSNSN-----------------------------KTVYQSVIELLQNVSPGFK
CLU_BRUMA         EAGFRPTPSPSH-----------------------------RTVHHSLLDLLSSISISFK
CLU_DICDI         NATFNPSVSPK------------------------------ATINHSLHQLLTQVSRLFR
D3B1P9_POLPP      INTFNPAVSSKY-----------------------------GATHHNLYELLSQYSPIFA
CLU_ARATH         GNILDPRPSKS------------------------------GFEAATLIGLLQKLSSKFK
D7T2X0_VITVI      GNTLDPRLSKS------------------------------TFEATTLIGLLQKISSKFK
C5XZV7_SORBI      GSIFDSRPTKQ------------------------------ALEASTLVGLLQKISAKFK
A9RLF4_PHYPA      GNILNPEKAAS------------------------------AFESTTLVGLLRQLSKKFV
D0P366_PHYIT      ATKFDPRPHKTV-----------------------------PAHSHLLVDVLSNVSPKFK
H3GWU1_PHYRM      ATKFDPRPHKTA-----------------------------AAHAHLLVDVLSSVSPKFR
A0E685_PARTE      GRTFESTQKSD--------------------------------CYYNLIDLIVDHSPSFK
Q6BG47_PARTE      GRTFESTQKSD--------------------------------CYYNLIDLIVDHSPSFK
CLU_ASHGO         AIKFDPTLKT------------------------------DAAVCLTLYELLTKHSKKFA
CLU_KLULA         SVKFDPSPKD------------------------------EFEPKFNLIDLLTQVSKKFH
CLU_YEAST         STKFDPSPKENTDENAH-----------------------SSLIYYSLFDLIASRSKKFI
CLU_VANPO         SNKFDPSMKDVEGITQQ-----------------------DS-IKYNLYDLIALHSKKFH
CLU_CANAL         TINFNPTIKINE---KG-----------------------KFNKSYLLYDLVCQLSPLFS
CLU_LODEL         ATTFNPALKTNE---KG-----------------------RYHKHYLLYELLAQLSPSFT
CLU_DEBHA         TINFNPAIKMNE---NG-----------------------KVHKDYLLINLVDSLSPSFS
CLU_PICST         TVNFNPEVKVNE---KG-----------------------QVSKNYLLVNLVDSLSPSFS
CLU_PICGU         TVNFNPARKPS------------------------------HEPKFLFFDLVSSLSPAFA
CLU_EMENI         NSRFDPFPKTI-----P-----------------------KKGSAHSLLNLISQLSPSFD
CLU_ASPFU         NHKFDPLPRTT-----P-----------------------KKVSAHSLLTLISKLSPSFN
C0NW18_AJECG      NAKFDPFPRPA-----P-----------------------KNYSAHSLLTLISMLSPSFD
CLU_SCLS1         TGKFDPSPKSA-----P-----------------------KAHSAHSLLALLGDLSPSFE
CLU_PHANO         NASFDPAPRQG-----P-----------------------KALHAHSLLTLLEKLSPSFE
C7YZ61_NECH7      NAKFDPYPRPA-----P-----------------------KGQSAHSLLSLIDLISPSFT
CLU_NEUCR         NAKFDPLPKPA-----P-----------------------KDCASHSLFTLLKKLSPSFE
D5G8Q8_TUBMM      SNKFDPAPKLA-----P-----------------------KDFSAHSLIALLGLISPSFN
CLU_SCHPO         STKFDPSP--------C-----------------------DDLQSHSLVLLLEQLSPLFK
CLU_MALGO         SQKFQPQPHPS-----------------------------KALHSSSLFDLLCAASPLFL
CLU_USTMA         GARFDPSPRPDG----------------------------QDFASCSLFDLLCGFSPLFL
CLU_YARLI         LGSFDPSPKPLMVKTKAKKQNGGKKGGKKTETEISYVPITTENMHHSLYDLLVSLSDKFA
CLU_CRYNJ         VNNFDPSPRPS-------------------------ADGSIPAPTHSLIDLLHSISPLFS
E3K6B8_PUCGT      KTQFDPSPSSDSSP--------------------------DSVYFHTLTQLICTLSPAFV
                     : .                                         .  ::   *  * 

G1LLQ3_AILME      KNFAVLQKK-----RVQRHPFERIATPFQVYSWTAPQAEH--------AMDCVRAEDAYT
G1PQX9_MYOLU      KNFAVLQKK-----RVQRHPFERIATPFQVYSWTAPQAEH--------AMDCVRAEDAYT
CLU_HUMAN         KNFAVLQKK-----RVQRHPFERIATPFQVYSWTAPQAEH--------AMDCVRAEDAYT
H0WHW6_OTOGA      KNFAVLQKK-----RVQRHPFERIATPFQVYSWTAPQAEH--------AMDCVRAEDAYT
CLU_MOUSE         KNFAVLQKK-----RVQRHPFERIATPFQVYSWTAPQAEH--------AMDCVRAEDAYT
CLU_XENTR         KNFAALQKK-----RVQRHPFERIATPFQLYSWTAPQVEH--------AMDCVRAEDAYT
H3BFU0_LATCH      KNFAALQKK-----RVQRHPFERIATPFQLYSWIAPQTDH--------AMDCVRAEDAYT
CLU_DANRE         KNFTTLQKK-----RVQRHPFERIATPFQVYSWTAPQIDH--------AMDCVRAEDAYT
C3Z652_BRAFL      RNFATLQKR-----RVNRHPFERIATPFQVYSWTAPQMDH--------TIDSVRAEDAYT
CLU_AEDAE         RCFAQMQKK-----RTQRHPFERVATPYQVYTWSAPALEH--------TIDAIRAEDTFS
CLU_ANOGA         RCFAQMQKK-----RTQRHPFERVATPYQVYTWTAPALEH--------TIDAIRAEDTFS
E9GHX8_DAPPU      RNFTLLQRK-----RTQRHPFERVATPYQVYSWIAPMADH--------PIDAIRAEDAFS
E0VTU9_PEDHC      RNFATLQKK-----KTARHPYERVTTPYQVYSWTAPQMEH--------TVDAIRAEDTFS
CLU_DROME         RAFQTIQKR-----RTMRHAFERVATPYQVYQWAAPILEH--------TVDAIRAEDAFS
CLU_DROPS         RAFQAIQKR-----RTLRHAFERVATPYQVYQWAAPNLEH--------TVDAIRAEDAFS
F6RE09_XENTR      KNFFALQKRS---NRIHRHPLERIATPYQVYSWVAPSTSH--------IIDCVRAEDAYN
CLU_CAEBR         KVYPQILKR-----RVEKSLVERLPTSYPVSTWVASPLKPD-----NYSSDSLRAIELIE
CLU_CAEEL         KVYPQILKR-----RQEKTLVERLPTSYPVSSWVGNPLKTD-----GYMSDSLRAIELTE
CLU_BRUMA         RAMALILKR-----RSEKHIFERLPTPYQVNSWIAPVFEQ--------IEDGIRAEDCTQ
CLU_DICDI         RGLNQILTNI---GR--NHPFDMLPGVLPVHNWVA-----------SSKTNRYDINKGTD
D3B1P9_POLPP      RGLKSLLKRI---SR--RNSYEMIPNSIPVNTWTLK----------QNRSFHYNIAAASE
CLU_ARATH         KAFREVMEKK---AS--AHPFENVQSLLPPHSWLR---------TYPVPDHKRDAARAEE
D7T2X0_VITVI      KAFREILERK---AS--AHPFENVQSLLPPSSWLG---------LYPVPDHIRDAARAEE
C5XZV7_SORBI      KGFREVLDRR---AS--AHPFENVQSLLPVTSWLG---------AYPVPAHRRDAARAED
A9RLF4_PHYPA      AGFAAILDKK---SS--GHPFENVPVLLPPNAWLG---------PHPIPPHKRDIARAED
D0P366_PHYIT      ESYGALLAKA---ASLAKEGPSSIEWMVAAGSSLGGKLPWNTPVAAAMEEHSYDLNRAED
H3GWU1_PHYRM      ESYAALLAKA---ASLAKEGPSSIEWMVAAGSSLGGKLPWNTPAATATEEHTYDLNRAED
A0E685_PARTE      KELINAIPE--------QQEPALPATIKYNHKWLSVQ-----------EVPLTLDHQRSE
Q6BG47_PARTE      KELINAIPE--------QQQPALPATIKYNHKWLSVP-----------EVPLTLDHQRSE
CLU_ASHGO         SHLSQLEAAL---KAHESVNYVKPISVFLHKTWFPSSLP----------SNS-IDFTEYQ
CLU_KLULA         QHVTSLRNKL---SSTDSAQYVKPASCFLSKPWLVSQLP----------SNN-GDFMRTQ
CLU_YEAST         SHVQAFEKKL---SALDSTSYVRPSNTFLHKPWFVSSLP----------PNN-PDYLRLQ
CLU_VANPO         SHVEALEKKL---AAYQSIEYVKPLTTFLHKPWLVSSLP----------ANN-ADYSRMQ
CLU_CANAL         KTIAENEINLSD-STKYPETYLLPGNSFPAYPWLVNEKD----------LQNVPDLSRSQ
CLU_LODEL         KTIEDNEVKLSE-STEHPETYLLPNNSFLAFPWVVNASD----------LKNIPDSSRSQ
CLU_DEBHA         KTIQENELVLSR-SSKHPESFLIPSNSLMSSPWIVNPSK----------FANQPDASRSQ
CLU_PICST         KVLEENELSLST-SSEHPETYLLPNNSFLATPWYIDTVH----------AKNYPDVSRSQ
CLU_PICGU         KTIARNEEILAN-SSRYAESYLIPSHTSGSYPWLVDTSA----------ISRKPDQSRPQ
CLU_EMENI         AAFKELQESN---NQKDLLTTFPFQNSIPSSPWLVAPPASN-------S-----------
CLU_ASPFU         SAFEALQESN---NKKDLLTTFPFQNAIPNSPWLVTPPSSN-------PNSHQADITRSQ
C0NW18_AJECG      ASFKALQESN---NKKDLLTTFPFQNSIPKNPWLVPPTSSA-------VTAHQSDITRSQ
CLU_SCLS1         DSFKRLQEYN---NTKEPLATFQITNATPSNPWIVPSASAP-------LVAHQADITRTQ
CLU_PHANO         ASFQQLLEHN---AKKELLTIFQLSNAIPANPWLVPPPTSS-------LTTHQPDLARTQ
C7YZ61_NECH7      NAFTQLQEYN---NQRDPLATFQITNAIPAAPWVVPSPSSS-------LCTHLPDPTRSQ
CLU_NEUCR         ESFKKFQEFS---SQKDPLATFQVGNTIPSAPWLVPSINSS-------LIAHEADNTRSQ
D5G8Q8_TUBMM      KEFHALQEWN---AKKEALVTFAPTNAIPAAPWLVPGPDTK-------YYNHQSDVARPQ
CLU_SCHPO         ERLHLSLNDY---KSGDAIAQASITGTLPQAPWITFP------------VPHRADLSRTQ
CLU_MALGO         QNFALLFNDPV--STRDYFSALPVMNSLPAAPWLAREPKHE---------SDPMRTQTAF
CLU_USTMA         SSFSKLFNDPL--SSRDYFSAVPVTNALPAFPWLARNHTHH---------ADALRSQAAF
CLU_YARLI         KKIASNYAEL---NAAGMLSVVPPTNCFLANPWLTKPAGFR-----------RPDMARNQ
CLU_CRYNJ         ERVSRLPPISLDGALADPISTVAIPQATPAYPFLTSPPKP-------AISPEILRTQLAF
E3K6B8_PUCGT      KQVTQTWNRALNPAFPDFFTSISITNCLPAFPWLVNPEKP---------SPDAIRSQLAY
                                                                              

G1LLQ3_AILME      S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
G1PQX9_MYOLU      S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
CLU_HUMAN         S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
H0WHW6_OTOGA      S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
CLU_MOUSE         S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
CLU_XENTR         S-RLGYEEHIPGQTRDWNEELQTTRELTRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
H3BFU0_LATCH      S-RLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMA-
CLU_DANRE         S-RLGYEEHIPGQTRDWNEELQTTRELSRKNLPERLLRERAIFKVHSDFAAAATRGAMA-
C3Z652_BRAFL      S-RLGYEEHIPGQTRDWNEELQTTRELSRKNLPERLLRERAIFKVHSDFVAAATRGAMA-
CLU_AEDAE         S-KLGYEEHIPGQTRDWNEELQTTRELPRETLPERLLRERAIFKVHSDFVTAATRGAMA-
CLU_ANOGA         S-KLGYEEHIPGQTRDWNEELQTTRELPRATLPERLLRERAIFKVHSDFVTAATRGAMA-
E9GHX8_DAPPU      S-KLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFVAAAARGAQA-
E0VTU9_PEDHC      S-KLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFVAAATRGAMA-
CLU_DROME         S-KLGYEEHIPGQTRDWNEELQTTRELPRKTLPERLLRERAIFKVHGDFVTAATRGAMA-
CLU_DROPS         S-KLGYEEHIPGQTRDWNEELQTTRELPRKTLPERLLRERAIFKVHGDFVTAATRGAMA-
F6RE09_XENTR      S-RLGYEEHIPGQTRDWNEELQTTRELPQALPTDQQLRQRATFKINSDFVGASTRGAMA-
CLU_CAEBR         PFRVGFEDHMPGLLRDWNEELQTTFEMPRKSLAERAVRDRSYYKIHADYVNAAAKGVQS-
CLU_CAEEL         PFRVGFEDHMPGLLRDWNEELQTTFEMTRKSISERVIRDRSYYKIHADYVNAAARGVQS-
CLU_BRUMA         PHKIGLEDHIPGQIRDWNEELQTTHELPRETLGERLIRERAIFKIHSDFVSAAIKVNVSM
CLU_DICDI         TFVSVQDVELRGNPRDWNEEIQAPKELPKSTVQERIIRDRAISKVNSEFVECAIRGAQV-
D3B1P9_POLPP      SNIDVHDPEMRGQPRDWNEEFQALRELPRGSISERILRDRAFYRVNSDFVESAIRGAKL-
CLU_ARATH         ALTISYGSELIGMQRDWNEELQSCREFPHTSPQERILRDRALYKVSSDFVDAALNGAIG-
D7T2X0_VITVI      ALTLSYGSELIGMQRDWNEELQSCREFPHTSPQERILRDRALYKVTSDFVDAAISGAIG-
C5XZV7_SORBI      SVVLSYGTELIGMQRDWNEELQSCREFPHGNPQERILRGRALYKVTCDFVDAAVKGAVG-
A9RLF4_PHYPA      ALMVPYGTEVVGMQRDWNEELQSCREFSRDNLQDRIMRDRALYKVNCDFVEAATKGAKA-
D0P366_PHYIT      ELCTTYGMDERGVLRDWNEEYQCCRELPKDTLKAEIVRARVMYKIVAEFVEAATKGAVA-
H3GWU1_PHYRM      ELCASFGMDERGVLRDWNEEYQCCRELSTDSLKDEIVRARVMYKIVTEFVEAATQGSVA-
A0E685_PARTE      SWALDLHGFDVSSLRDWNEELQVFRSLPKMDLIQKLNRDKALSKVYGDFVEAAVRGACA-
Q6BG47_PARTE      SWALDLHGFDVSSLRDWNEELQVFRSLPKIDLIQKLNRDKALSKVYGDFVEAAVRGACA-
CLU_ASHGO         LEALNFQTE-----RNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKGSME-
CLU_KLULA         LEHFNNDDE-----RNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAMA-
CLU_YEAST         TAALDTTPE-----RNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMS-
CLU_VANPO         LDSSQYESE-----RNFNDEFQAIRELPTPTVQESIQSERLLSRISHEFTTAAVKGAMS-
CLU_CANAL         LSSLINGVDGADYIKDWNNDIQSIKELPTTTVQERIIREKLIQKSLFEFNKTATETAIN-
CLU_LODEL         LMLISNGVDGSEIIKEWNNDIQAMKELPSTNFQERLMRDKLIQKTLFDFSKTATETAIN-
CLU_DEBHA         LPLISNGVDGSGFVKEWNEDFQAIRELPNSTINERILREKLLMKSLHEFNKVATETAMN-
CLU_PICST         LPLILNGVDGSDYVKDWNEDFQSVRELPNTNIQERILREKLIQKALFDFTKTATDTSVN-
CLU_PICGU         LSILNNGVDGSDNVKDWNEDFQAIRELPSGTVNERILRERLAIKLVSEFTKQATETAVN-
CLU_EMENI         --------------------LQTTKELPRETVQDRVFRERLTSKLFADYNEAAARGAVL-
CLU_ASPFU         ESYLVSGVDNAETLRDWNEEFQTTRELPRETVQDRVFRERLTSKLFADYNEAAARGAVL-
C0NW18_AJECG      ENCLIFGVDNSETLRDWNEEFQSTRELPRETVQDKVFRERLTSKLFADYNDAAARGAVL-
CLU_SCLS1         ENYLIAGIENSETLRDWNEEFQSTRELPKETVQDRVFRERLTSKLFADYNDAAARGAIL-
CLU_PHANO         ESYLISGVENTDTLRDWNEEFQSTREMPKEAVHDRVFRERLTSKLFADYNDAATRGAML-
C7YZ61_NECH7      ETYLLAGVENTDTLRDWNEEFQSAKELPRETVQDRVFRERLISKLFADYNDAATRGAVM-
CLU_NEUCR         ETYLLGGAENVDSLRDWNEEFQSAKELPKETIQDRVFRERLLAKLFADYTDAAARGAVL-
D5G8Q8_TUBMM      ETYLIAGTENVDSLRDFNEEFQSTRELPRETVQERVFRERLLSKLFADYTDAAVRGVVL-
CLU_SCHPO         KSELFPYIENQGNLRDWNEEIQSTREMDHEDVQDRVLRERLTVKTLQDFTDMAVEGAID-
CLU_MALGO         LLTGAMSADTLDGSRDWNEELQSSRELPRSSLAERLMRDRVLNRLYAEFTLAAARVVPR-
CLU_USTMA         LLTGATSADALEGTRDWNDELQSARELPRTTLSERLMRDRVLNRIYSEFTQAAARAIPK-
CLU_YARLI         ELLSLKNLEGQDDTREWSEDLQSLKELPRETINDRVVRERHLNKTYFDFTEAAVAGAVQ-
CLU_CRYNJ         LHTGAYGPDLVDAARDWNEEIQGIRELPRGTMQERVFREKMLQKVWAEFDQAAARAVQA-
E3K6B8_PUCGT      LITGSTTAETLPPARDWADEFAQARELPRKSLAERILRERIWSRLQSDFSMAATRGVIS-
                                           .             :       ::   :       

G1LLQ3_AILME      -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
G1PQX9_MYOLU      -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
CLU_HUMAN         -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
H0WHW6_OTOGA      -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
CLU_MOUSE         -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
CLU_XENTR         -VIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVR-------------------------
H3BFU0_LATCH      -VIDGNVMAINPGEETKMQMFIWNNIFFSLGFDVR-------------------------
CLU_DANRE         -VIDGNVMAINPGEETRMQMFIWNNIFFSLGFDVR-------------------------
C3Z652_BRAFL      -VIDGNVMAINPGEEAKMQMFIWNNIFFSLGFDVK-------------------------
CLU_AEDAE         -VIDGNVMAINPGEDAKMQMFIWNNIFFSLGFDVR-------------------------
CLU_ANOGA         -VIDGNVMPINPGEDAKTQMFIWNNIFFSLGFDVR-------------------------
E9GHX8_DAPPU      -VIDGNVMAINPGEESRMQMFIWNNIFFSLGFDVR-------------------------
E0VTU9_PEDHC      -VIDGNVMAINPGEEAKMQMFIWNNIFFSLGFDVR-------------------------
CLU_DROME         -VIDGNVLAINPGEDTKMQMFIWNNIFFSMGFDVR-------------------------
CLU_DROPS         -VIDGNVLAINPGEDSKMQMFIWNNIFFSLGFDVR-------------------------
F6RE09_XENTR      -VIDGNVMAINPSEETKMQMFIWNNIFFSFGFDVR-------------------------
CLU_CAEBR         -ILDGNILAINPGEDKKTHMYIWNNIFFSLGFDVR-------------------------
CLU_CAEEL         -ILDGNILAINPGEDKKTHMYIWNNIFFSLGFDVR-------------------------
CLU_BRUMA         AVVDGNVVAINPADEPRTHMYIWNNIFFSLGFDVK-------------------------
CLU_DICDI         -IVDKAILPINPAENQRSHMFLYNNIFFSYALDTR-------------------------
D3B1P9_POLPP      -VVSKTIPPINPLEPEKAHMFVYHNIFLSFTLDTR-------------------------
CLU_ARATH         -VISRCIPPINPTDPECLHMYVHNNIFFSFAVDADIEQLSKKRPSNQMTEKVS-------
D7T2X0_VITVI      -VISRCIPPINPTDPECFHMYVHNNIFFSFAVDADLDQLSKKRASDPISKVESRNLSHNS
C5XZV7_SORBI      -VINRCIPPINPTDPECFHMYVHNNIFFSFAVDSDYEHISKDHKPDCQNGSSR-------
A9RLF4_PHYPA      -VINRCIPPINPTDPDRFHMYVHNNIFFSFAVDGDFTLMQQVRDQNSQTGESS-----TE
D0P366_PHYIT      -IVEGNIPPINPMDDKSAHVYVFNNIFFSVSIDGK-------------------------
H3GWU1_PHYRM      -IVEGHIPPINPMDDKSAHVYVFNNIFFSMSIDGN-------------------------
A0E685_PARTE      -VVDKIIQPLNPMDIECQQVYVYNQIFFSFAMETP-------------------------
Q6BG47_PARTE      -VVDKIIQPLNPMDVECQQVYVYNQIFFSFAMETP-------------------------
CLU_ASHGO         -IFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLD-------------------------
CLU_KLULA         -IFNNELTPIDPGTTGENAVYFHKSLIFSFVADVS-------------------------
CLU_YEAST         -IFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVS-------------------------
CLU_VANPO         -IFYGEMLPLNPES--DDQIFLRDNIFYSYVMDAN-------------------------
CLU_CANAL         -IIKGNIPPLNPDESSDKFIYLRNGIFYSSGTSTV-------------------------
CLU_LODEL         -IIKGNIAPMNPGEEPDKLIYLKNGVFYSAGTSTV-------------------------
CLU_DEBHA         -VIKGNLTPLNPNEPKDYHIYLRNGIFYSLGVNAT-------------------------
CLU_PICST         -IIKGNLTPMNPNEEEGKHIYLKNGIFYASDATSV-------------------------
CLU_PICGU         -IIKGNLTPMNPNESVEQHIYMRNGIFYSSGVNAT-------------------------
CLU_EMENI         -VARGEVAPLNPTEAQDAQIFVYNNIFYSFGADGV-------------------------
CLU_ASPFU         -VARGEVAPLNPTEERDAQIFVYNNIFYSFGADGV-------------------------
C0NW18_AJECG      -VAKGEIAPLNPTEGKDAQIFVYNNIFFSFGADGV-------------------------
CLU_SCLS1         -VARGEIAPLNPTEGKDAQIFVYNNVFFSFGADGV-------------------------
CLU_PHANO         -VARGEIAPLNPTEAKDAQIFVYNNIFYSFGADGV-------------------------
C7YZ61_NECH7      -VARGEIAPLNPTECKDAQIFVYNNIFFSFGADGV-------------------------
CLU_NEUCR         -VARGEVAPLNPTEDKDAQIFVYNNIFFSFGADGV-------------------------
D5G8Q8_TUBMM      -IAKGEVAPLNPTEGRDAQIYVYNNIFFSYGADGV-------------------------
CLU_SCHPO         -MVNGNIPSLNPLEPTASQMFVHNNIFFSYGRDSV-------------------------
CLU_MALGO         -VAAGEVAPMNPADAPAAHMYLYNNLFVTRGTDSV-------------------------
CLU_USTMA         -VAAGEVQAMNPMDKRDAQMFIVNNLFISKGADGV-------------------------
CLU_YARLI         -VVHGEIQPINPSEPEASHIFLHKGIFYSVGADGS-------------------------
CLU_CRYNJ         -VSKGDIPPINPAEDPKAHMYLQSNIFITQGDSDAL------------------------
E3K6B8_PUCGT      -CSRGEVPALNPQEPESAWTYVLNNILFSRAEDPI-------------------------
                        . .::*        :.   :: :                               

G1LLQ3_AILME      ----------------------------------------DHYKDFGGDVAAYVAPTN-D
G1PQX9_MYOLU      ----------------------------------------DHYKDFGGDVAAYVAPAN-D
CLU_HUMAN         ----------------------------------------DHYKDFGGDVAAYVAPTN-D
H0WHW6_OTOGA      ----------------------------------------DHYKDFGGDVAAYVAPTN-D
CLU_MOUSE         ----------------------------------------DHYKDFGGDVAAYVAPTN-D
CLU_XENTR         ----------------------------------------DHYKDFGGDSAAYVSPTN-D
H3BFU0_LATCH      ----------------------------------------DHYKEFGGDNAAYVAPTN-D
CLU_DANRE         ----------------------------------------DHYRELGGDSAAHAAPTN-D
C3Z652_BRAFL      ----------------------------------------DHYKEYGGDYAAYIAPCN-D
CLU_AEDAE         ----------------------------------------DHYKELGGDAAAFVAPRN-D
CLU_ANOGA         ----------------------------------------DHYKELGGDAAAFVAPRN-D
E9GHX8_DAPPU      ----------------------------------------DHYKELGGDAAAYVAPKN-D
E0VTU9_PEDHC      ----------------------------------------DHYKELGGDAAAFVAPKN-D
CLU_DROME         ----------------------------------------DHYKELGGDAAAFVAPRY-D
CLU_DROPS         ----------------------------------------DHYKELGGDYAAYVAPRY-D
F6RE09_XENTR      ----------------------------------------DHYKDLGGDHAAHIAANH-D
CLU_CAEBR         ----------------------------------------DHYKELGGDAAAFAATST-D
CLU_CAEEL         ----------------------------------------DHYKELGGDAAAFAATST-D
CLU_BRUMA         ----------------------------------------DHYKDLGGDAAAHAATSN-D
CLU_DICDI         ----------------------------------------DSFTDCGGDDAARTSANN-D
D3B1P9_POLPP      ----------------------------------------DYYVNCGGDAGARVAANN-D
CLU_ARATH         ----SSEKVSCTEGTCDNE----------------EHNNCNEAPLVENEQATYASANN-D
D7T2X0_VITVI      SEKASNDLLHGTSGTSNGENCDGSMKLELNGVQELAPDVSSETQSIDSEQATYASANN-D
C5XZV7_SORBI      STKVSSPDVITKPDTNHTESA------------EVADSKSEEAQLADSEQATYASANN-D
A9RLF4_PHYPA      ESTISNGDAKSDNAESNESDA------------SLSLDANSGSAVVESEQATYASANN-D
D0P366_PHYIT      ----------------------------------------STKDAAGGEENAYSAANR-D
H3GWU1_PHYRM      ----------------------------------------STKDAAGGEENAYSAANR-D
A0E685_PARTE      ---------------------------------------EDFRQESGPDATPTVSTTNCD
Q6BG47_PARTE      ---------------------------------------EDFRQESGPDATPTVSTTNCD
CLU_ASHGO         ----------------------------------------GHYQDKGGDAAAHAASNQ-D
CLU_KLULA         ----------------------------------------GTYSSIGGNEAAYAVANQ-D
CLU_YEAST         ----------------------------------------GNYEGKGGDEAAIAASNQ-D
CLU_VANPO         ----------------------------------------GSYDGKGGNDAAFAASNQ-D
CLU_CANAL         ----------------------------------------NGFENTGGEEASRYVASK-D
CLU_LODEL         ----------------------------------------DVFDKTGGEEASRYVSSK-D
CLU_DEBHA         ----------------------------------------GAFDCTGGNEAARYTSSK-D
CLU_PICST         ----------------------------------------EVFEATGAEEAARYVASK-D
CLU_PICGU         ----------------------------------------GAFDETGGNEAARYAAAK-D
CLU_EMENI         ----------------------------------------GTFASEGGDEAARVAVGK-D
CLU_ASPFU         ----------------------------------------GTFVSEGGDEAARVAVGK-D
C0NW18_AJECG      ----------------------------------------GTFASEGGDEAARVAVGK-D
CLU_SCLS1         ----------------------------------------GTFASEGGDEAARAAVGK-D
CLU_PHANO         ----------------------------------------GTFGTEGGDEAARVAVGK-D
C7YZ61_NECH7      ----------------------------------------GTFTSEGGDEAARVATGK-D
CLU_NEUCR         ----------------------------------------GTFTSEGGDEAARVATGK-D
D5G8Q8_TUBMM      ----------------------------------------GTFSSEGGDEAARVATGK-D
CLU_SCHPO         ----------------------------------------GIFSTKGGDSAAYSAVGK-D
CLU_MALGO         ----------------------------------------DMYRFLGGDAAAHVAVGK-D
CLU_USTMA         ----------------------------------------DLYPHMGGDEAAHVAVGK-D
CLU_YARLI         ----------------------------------------GTYAEIGGDEAARVASAK-D
CLU_CRYNJ         ----------------------------------------DTYAHLGGDAAMRISHGK-D
E3K6B8_PUCGT      ----------------------------------------GAYEHLGGTAAARAIASK-D
                                                                             *

G1LLQ3_AILME      LNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQE---------------
G1PQX9_MYOLU      LNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQE---------------
CLU_HUMAN         LNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQE---------------
H0WHW6_OTOGA      LNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQE---------------
CLU_MOUSE         LNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQE---------------
CLU_XENTR         LNGVRAYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQE---------------
H3BFU0_LATCH      LNGVRAYNVVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQD---------------
CLU_DANRE         LNGVRAYSAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQE---------------
C3Z652_BRAFL      LKGVRAYNGVDIEGLYTLGTVVIDYRGYRVTAQSIIPGILEREQE---------------
CLU_AEDAE         LHGVRVYSAVDVEGLYTLGTVVIDYRGYRVTAQSIIPGILEREQE---------------
CLU_ANOGA         LHGVRVYSAVDVEGLYTLGTVVIDYRGYRVTAQSIIPGILEREQD---------------
E9GHX8_DAPPU      LQGVKVYNTVDQEGLYTLGTVVIDYRGYRVTAQSIIPGILEREQE---------------
E0VTU9_PEDHC      LQGVRVYSVVDLPGLYTLGTVVIDYRGYRVTAQSIIPGILEREQE---------------
CLU_DROME         LHGVRVYNAVDIEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQE---------------
CLU_DROPS         LHGVRVYNAVDVEGLYTLGTVVIDYRGYRVTAQSIIPGILEREQE---------------
F6RE09_XENTR      LKGVQAYSDLDIEELYVLGTVVLDYRGYRVTAQSIIPGILDRKED---------------
CLU_CAEBR         LQGVRAFATLEDPKLNTLGMAIFDYRGYRVTAQSIIPGILEREQE---------------
CLU_CAEEL         LQGVRAFATLDDPKLNTLGMAIFDYRGYRVTAQSIIPGILEREQE---------------
CLU_BRUMA         LQGVRAYAQLDNPKLFTLGMVIVDYKGFRVTAQSIIPGILEREQE---------------
CLU_DICDI         LKGIRLYNLADIDGLYTLGTAIVDYKGQRIIAQSLIPGILTTEKT---------------
D3B1P9_POLPP      LKGVKLFNLIDIDGISTICTAIIDYRGHRILAQSLVPGILSNERT---------------
CLU_ARATH         LKGTKLYQEADVPGLYNLAMAIIDYRGHRVVAQSVLPGILQGDKS---------------
D7T2X0_VITVI      LKGTKAYQEADVPGLYNLAMAIIDYRGHRVVAQSVLPGILQGDKS---------------
C5XZV7_SORBI      LKGTKAYQEADVSGLYNLAMAIIDYRGHRVVAQSIIPGILQGDKS---------------
A9RLF4_PHYPA      LKGTKAYNNADVSGLYTLAMAIIDYRGHRVVAQSIIPGILQGDKT---------------
D0P366_PHYIT      LQGVKAFNDADVRDLHTLATTVVDYLGVRVIAQSLIPGILMGDAA---------------
H3GWU1_PHYRM      LQGVKAFNEADVRGLHTLATTVVDYLGVRVIAQSIIPGILMGDAA---------------
A0E685_PARTE      FRNLQILHKLDIPGLSVLNTCLVDYKGRRVIAQSIIPGILNSDHS---------------
Q6BG47_PARTE      FRNLQILHKLDIPGLSVLNTCLVDYKGRRVIAQSIIPGILNSDHS---------------
CLU_ASHGO         LHIIKTLLQSNMRSVRHLLTAVVEFGGVRILAQSPVPGILDTAGMKFIKNEK--------
CLU_KLULA         LQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEE--------
CLU_YEAST         LKTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANT-------
CLU_VANPO         LKTIQILKNLKMKDVYYLLTTIIDFGGKRILAQTPVPGLLSNMGADVITDADS-------
CLU_CANAL         LTGIKLINRHDIRGISSLVTCIVDYMGKRVVCQAPVPGILDTPVITSPTTDAEGKNE---
CLU_LODEL         LAAIKIVNRHELKGISTLVTCIVDYMGKRIVCQAPVPGILDAAPPSEEEDDAGAEQEK--
CLU_DEBHA         LAAIKLLNRIDAKGIYNLVTCIVDYMGQRVICQAPVPGILDSSHE---------------
CLU_PICST         LAGVKVLNKADVPGVNNLVTCIVDYLGKRIVCQAPVPGIFNAAAE---------------
CLU_PICGU         LAGVKLLNRIDAKGIYHLATCVVDYMGRRIVCQAPVPGILNDPIV---------------
CLU_EMENI         VLGIKAVNQLDINGLFTPGTIVVDYMGKRIVGQSIVPGIFKQREP---------------
CLU_ASPFU         VLGIKAVNQLDINGLFTPGTVVVDYLGKRIVGQSIVPGIFKQREP---------------
C0NW18_AJECG      VVGAKAVNQLDIPGLFTPGTVVVDYLGKRLVGQSIVPGIFKQREP---------------
CLU_SCLS1         VMGVRMVNQLDIDGLFTPGTVVVDYLGKRIVGQSIVPGIFKQRDP---------------
CLU_PHANO         VIGVRAVNNLDIPNLFTSGTVVVDFLGKRIVGQSIVPGIFKQRDP---------------
C7YZ61_NECH7      VAGVKLVNQLDIEGLFTPATVVVDYVGKRIVGQSIVPGIFKQREP---------------
CLU_NEUCR         VLGVKLVNQLDIDGLYTPGTVVIDYLGKRIVGQSIVPGIFKQPEA---------------
D5G8Q8_TUBMM      VMGVKYVNGLDIPGLSTPGTVVVDYLGRRLVAQSIVPGIFRPREE---------------
CLU_SCHPO         ILAIRLLNQFDLSNPSLLGTCVVDYAGHRVVAQTIVPGIFKQLEN---------------
CLU_MALGO         LQGVRRLGNLDIEGLSLLGTVVIDWLGERWVVQTVLPGLFRQ------------------
CLU_USTMA         VQGVKTLNSLDVGGLCLLGTIVVDWKGERWVAQSVVPGLFRRRDDADELPEADGETTELA
CLU_YARLI         LQAVQQLVQFDFPEIASLCTTVVDYQGKRIVCQSPVPGIFRQPEN---------------
CLU_CRYNJ         AAGVKLLNKIDADGLYLLGHTIVDWQGRRWICQSILPGIFSNRRAVEEEKAQAETEAEAE
E3K6B8_PUCGT      LHSIKYLNQLDVPGIYTMGSAVVDYHGKRWIAQGMIPGIFRPPDLEAEKAQQDLAAQQSQ
                      .                :.:: * *   *  :**::                    

G1LLQ3_AILME      ------------------------------------------QSVIYGSID---------
G1PQX9_MYOLU      ------------------------------------------QSVIYGSID---------
CLU_HUMAN         ------------------------------------------QSVIYGSID---------
H0WHW6_OTOGA      ------------------------------------------QSVIYGSID---------
CLU_MOUSE         ------------------------------------------QSVIYGSID---------
CLU_XENTR         ------------------------------------------QSVIYGSID---------
H3BFU0_LATCH      ------------------------------------------QSVIYGSID---------
CLU_DANRE         ------------------------------------------QSVIYGSID---------
C3Z652_BRAFL      ------------------------------------------QSVVYGSID---------
CLU_AEDAE         ------------------------------------------QSVVYGSID---------
CLU_ANOGA         ------------------------------------------QSVVYGSID---------
E9GHX8_DAPPU      ------------------------------------------QSVVYGSID---------
E0VTU9_PEDHC      ------------------------------------------QSVVYGSVD---------
CLU_DROME         ------------------------------------------QSVVYGSID---------
CLU_DROPS         ------------------------------------------QSVVYGSID---------
F6RE09_XENTR      ------------------------------------------QSVVYGSID---------
CLU_CAEBR         ------------------------------------------QSVVYGSID---------
CLU_CAEEL         ------------------------------------------QSVVYGSID---------
CLU_BRUMA         ------------------------------------------QSVIYGSVD---------
CLU_DICDI         ------------------------------------------SKIYYGSMDTPTNEEEEQ
D3B1P9_POLPP      ------------------------------------------SDVKYGSMD---------
CLU_ARATH         ------------------------------------------DALLYGSVD---------
D7T2X0_VITVI      ------------------------------------------DSLLYGSVD---------
C5XZV7_SORBI      ------------------------------------------DSLLYGSVD---------
A9RLF4_PHYPA      ------------------------------------------ESLLYGSVD---------
D0P366_PHYIT      ------------------------------------------SKLVYGSVD---------
H3GWU1_PHYRM      ------------------------------------------SKLVYGSVD---------
A0E685_PARTE      ------------------------------------------NCTQYGSID---------
Q6BG47_PARTE      ------------------------------------------NCTQYGSID---------
CLU_ASHGO         -------------------------------GEEEAIQAKNDITVCYGFDE---------
CLU_KLULA         -------------------------------DKEVAEPMETLISVNYGYDD---------
CLU_YEAST         -------------------------------GEEVTEDFVNDINVKYGLDE---------
CLU_VANPO         -------------------------------GEQMIVDKKSEVSVVYGLDE---------
CLU_CANAL         ---------------------------------AEEPESEPVEKVVYGLSS---------
CLU_LODEL         ---------------------------KEEGKAEEDEEEEIMEKVLYGLSS---------
CLU_DEBHA         ----------------------------------DENEEEPTDKVCYGLST---------
CLU_PICST         ----------------------------------GEEE-----KVVYGLST---------
CLU_PICGU         ----------------------------------ESDE-APADKVCYGLST---------
CLU_EMENI         ----------------------------------------GEHQIDYGGVE---------
CLU_ASPFU         ----------------------------------------GEHQIDYGGVE---------
C0NW18_AJECG      ----------------------------------------GEHQIDYGGVE---------
CLU_SCLS1         ----------------------------------------GENQIDYGAVD---------
CLU_PHANO         ----------------------------------------GEHQIDYGAVE---------
C7YZ61_NECH7      ----------------------------------------GENQIDYGAVD---------
CLU_NEUCR         ----------------------------------------GENQIHYGAVD---------
D5G8Q8_TUBMM      ----------------------------------------GQSQIDYGGVE---------
CLU_SCHPO         ----------------------------------------GSSHLIYGKVE---------
CLU_MALGO         ---------------------------VAADAAASQSDGSTASHVAYGGVE---------
CLU_USTMA         EAAPEKKSP------------------EAKLAQSNKADLNDDTQVVYGGVE---------
CLU_YARLI         ----------------------------------------APPQVKYGSVE---------
CLU_CRYNJ         TADAVEGEQKKED----------WVDVEKPTEKSGSETESDNPMMIYGLDSE--------
E3K6B8_PUCGT      INGHSTPDDKDEGDWEKVNRSLPVTPQLGTVAVPEEVSPPTTYDILYGSADIEK------
                                                                **            

G1LLQ3_AILME      ------------FGKTVMSHPRYLELLER-TSRPLKILRHRVLN----------------
G1PQX9_MYOLU      ------------FGKTVVSHPRYLELLER-TSRPLKILRHRVLN----------------
CLU_HUMAN         ------------FGKTVVSHPRYLELLER-TSRPLKILRHQVLN----------------
H0WHW6_OTOGA      ------------FGKTVVSHPRYLELLER-TSRPLKILRHRVLN----------------
CLU_MOUSE         ------------FGKTVVSHPRYLELLER-TSRPLKILRHRVLN----------------
CLU_XENTR         ------------FGKTVVSHPKYLELLEK-TSRPLKIQKHTVLN----------------
H3BFU0_LATCH      ------------FGKTVVSHPKYLELLER-TSRPLKIQKHKVLN----------------
CLU_DANRE         ------------FGKTVVSHPKYLELLEK-TSRPLKVQRHAVLN----------------
C3Z652_BRAFL      ------------FGKSVVTNDKYLELLEK-TSKPLKILPHKVIN----------------
CLU_AEDAE         ------------FGKTVLSHEKYLELLNN-AGKHLKILPHSVLN----------------
CLU_ANOGA         ------------FGKTVLSHPKYLELLNA-AGKHLKILPHSVYN----------------
E9GHX8_DAPPU      ------------FGKTVVTHPKYLELLGK-AGQQLKVFQHSVLN----------------
E0VTU9_PEDHC      ------------FGKTVISHPKYVELLSK-AGQQLKILPHKVLN----------------
CLU_DROME         ------------FGKTVLSHPKYLELLRQ-AGKHLKILPHVVLN----------------
CLU_DROPS         ------------FGKTVLSHPKYLELLRQ-AGKHLKILPHSVYN----------------
F6RE09_XENTR      ------------FGKTVSSSVKYLTLLQK-SCKPLKIMRHTVLN----------------
CLU_CAEBR         ------------FGKTVVSDEKYHALLED-AAQQLKMLPHNVIS----------------
CLU_CAEEL         ------------FGKTVVSDEKYHELLED-AAHKLKMLPHTVIS----------------
CLU_BRUMA         ------------FGKTVVSSEEYHDLLSK-PAEQLKILPHEVHS----------------
CLU_DICDI         QQKEENEENKNNNTKSIKADPEFHSRLLQ-AASLLHLSESKVIS----------------
D3B1P9_POLPP      ------------NGQTIKADPEFSEKLAK-LSSMLHLAEREVIP----------------
CLU_ARATH         ------------NGKKICWNEDFHAKVLE-AAKLLHIKEHSVI-----------------
D7T2X0_VITVI      ------------NGKKICWNEDFHSKVLE-AAKHLHLKEHTVR-----------------
C5XZV7_SORBI      ------------NGKKISWNEAFHSKVVE-AAKRLHLKEHVVL-----------------
A9RLF4_PHYPA      ------------NGKKIAWNEKFHAKALE-AGKLLHIKEHTVL-----------------
D0P366_PHYIT      ------------HGKTIASNSTMHELMLE-AGKKLHIAERSIKPLGKSEEDVAAEKEQEA
H3GWU1_PHYRM      ------------HGKTIAANNKMHKLMLE-AGEKLHIAERSIKPLGKTEEDLAVEKEQEA
A0E685_PARTE      ------------DGKTIQKSEEFHKVMSK-TCEFFHLETDIVFL----------------
Q6BG47_PARTE      ------------DGKTIQKSEEFHKVMSK-TCEFFHLDTDIVFL----------------
CLU_ASHGO         ------------ASNKVIADAEFGSSLDD-FAKVFHLKKHEVDGV---------------
CLU_KLULA         ------------FVATLKFDEKFHEKVCE-FSKNFYLKEHKVEEV---------------
CLU_YEAST         ------------GLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGT---------------
CLU_VANPO         ------------ESGKVLANDQFDKSVSEEFSKYLHLKSHDVEGS---------------
CLU_CANAL         ------------DGSRILEDKSFEEPLKQ-IGDFFHLKPHKVQLSSSSSG----------
CLU_LODEL         ------------DSQKILEDKSFEKPLKL-LSEVFHLKPHGVKLS---------------
CLU_DEBHA         ------------DGSKIFSDSSFENVLKP-IAEAFHLKPHPVTLL---------------
CLU_PICST         ------------DGSTISQDKSFEEPLKQ-IAEVFHLKPHTVEVS---------------
CLU_PICGU         ------------DGTKVYSDSQFHEALKP-IAEAFHMKPHKVTLP---------------
CLU_EMENI         ------------GKDVVATHPDFVPVFEK-LSKALRIKKHPVWDK---------------
CLU_ASPFU         ------------GKDVVATHPDFVSVFEK-MSKALRIKKHPVWDK---------------
C0NW18_AJECG      ------------GKEVVAEHKDFVPVFEK-LSASLRVKKHPVWDK---------------
CLU_SCLS1         ------------GKDIVASDEKFVSVFEK-LSKALKVKKHAVWDK---------------
CLU_PHANO         ------------GKEIVADDKSFVPLFEQ-LSKALRVKKHPVWDK---------------
C7YZ61_NECH7      ------------GKDIVAADERFAPGFAQ-LSKALKVKKHPVWDK---------------
CLU_NEUCR         ------------GKDIVAADERFAPSFEK-LATALRVKKHAVWDK---------------
D5G8Q8_TUBMM      ------------GKDVVATTESFVPLFEI-MSRAMRVKKHNVWDK---------------
CLU_SCHPO         ------------GESDFRFDESFEGELSR-ISDLLHIKKHFFVDG---------------
CLU_MALGO         ------------GPDTIHTDPAFHKVLSV-AGKSLHVAEHKMRDA---------------
CLU_USTMA         ------------GPEVIRDNAAFHKLFHQ-VAQTLHLNEHQVEDA---------------
CLU_YARLI         ------------GAEEIASEQEFGDAFKP-IAAAFRLKTHTVKDA---------------
CLU_CRYNJ         ------------RPTSVHWDAATHSLLST-IATPLRLAAHTIKDG---------------
E3K6B8_PUCGT      ------------PEMGLRSDPKFHRLAAQ-VAAGFNLSEHDVIDV---------------
                                  .                 : :    .                  

G1LLQ3_AILME      -------DRD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVP-------
G1PQX9_MYOLU      -------DRD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVP-------
CLU_HUMAN         -------DRD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVP-------
H0WHW6_OTOGA      -------DRD---EEIELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVP-------
CLU_MOUSE         -------DRD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVP-------
CLU_XENTR         -------DKD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVE-------
H3BFU0_LATCH      -------DKN---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLLVE-------
CLU_DANRE         -------EKD---SAVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNFLPVE-------
C3Z652_BRAFL      -------DQN---EEIQIISSVECKGIVGNDGRYYVLDLLRTFPPDVNFLPME-------
CLU_AEDAE         -------EKE---EEIELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLKL--------
CLU_ANOGA         -------DKE---EAIELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLALPAE-----
E9GHX8_DAPPU      -------DKD---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLKIE-------
E0VTU9_PEDHC      -------DKN---EEVELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLKLE-------
CLU_DROME         -------ERD---EPVELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLKLQ-------
CLU_DROPS         -------ERD---EPVELCSSVECKGIIGNDGRHYILDLLRTFPPDVNFLKLQ-------
F6RE09_XENTR      -------EKE---EEVMLCSSVECKGIVGNDGRHYILDLLRTFPPDMNFFPLK-------
CLU_CAEBR         -------VKDGVEQELKLFTSYEAKGIVGNDGRKYVLDLLRSMPPDVHYLEDA-------
CLU_CAEEL         -------EKDGVKEELKLYTSYEAKGIIGNDGRKYVLDLLRSMPPDVHYLDDA-------
CLU_BRUMA         -------GKD-DGKIIKLCSSFETKGIVGNDSRHYILDLLRTFPPDVNYLEDA-------
CLU_DICDI         --------EDT-NQEVSVCTSFESKGIIGIDGRRYILDLIKATPRDPNYTET--------
D3B1P9_POLPP      --------GDALSDPVKISTSYDSKGIVGLDGRKYILDIMRATPRDPNYKDD--------
CLU_ARATH         ---------DASETVFKLAAPVECKGIVGSDNRHYLLDLMRVTPRDANYTGP--------
D7T2X0_VITVI      ---------DGSGNVFKLAAPVECKGIVGSDDRHYLLDLMRVTPRDANYTGP--------
C5XZV7_SORBI      ---------DGSGNPVKLAATVECKGIVGSDDRHYILDLMRVTPRDSNYIGQ--------
A9RLF4_PHYPA      ---------DGAGKEVTLCAPVECKGIVGSDDRHYLLDLMRTTPRDINYTGP--------
D0P366_PHYIT      LDIPLVSSGEASTDVTTICGAVEAKGIQGSDGRLYVLDLVRITPKDWTFYKNRGAARKNS
H3GWU1_PHYRM      LGVAPGSGGEASTDVATICGAVEAKGIQGSDGRLYVLDLVRITPKDWTFYKSRDTALKK-
A0E685_PARTE      ---------DGNQQKYSMAGSIEVKGIMGSDKRMYLLDLLRLSPRDYNYQGDN-------
Q6BG47_PARTE      ---------DSNQQKYSMAGSIEVKGIMGSDKRMYLLDLLRLSPRDYNYQGEN-------
CLU_ASHGO         ----------------ELKVASTSKGVVGFDKRNYILDLADNNPLDVGFALENFD-----
CLU_KLULA         ----------------DLRISSKSKGIFGVDQRAYILDLANTNPVDIEFVKAHYD-----
CLU_YEAST         ----------------ELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNFD-----
CLU_VANPO         ----------------KISFSYQSKGILGSDKRNYIIDLANTYPLDVKFAKEHFD-----
CLU_CANAL         ---------DDVKTESNLVVSKDTKGLKGTDGRKYVIDLYRTTPRDIEFIEQHFKL----
CLU_LODEL         ---------EQVKSEGDLVVSKDTKGLKGTDGRKYAIDLYRTTPRDIEFIEAHFK-----
CLU_DEBHA         ---------DNVKSQGDLITSKDIKGVKGTDERKYIIDLYRATPLDIEFIESNWD-----
CLU_PICST         ---------DEIKSESELLVSKDTKGIKGTDSRKYVIDLYRTTPRDIQFTEAHFD-----
CLU_PICGU         ---------NGFKTKEDIALSKDSKGIRGTDGRNYVIDLYRSTPLDIDFIEKHWR-----
CLU_EMENI         -----------DNQRHDLEGSVETKGLLGTDGRKYVLDLYRVTPLDVAWNEE--------
CLU_ASPFU         -----------EGKRHDLEGSVETKGLLGTDGRKYVLDLYRVTPLDVVWQEE--------
C0NW18_AJECG      -----------EGKRHDLEGSVETKGLLGTDGRKYVLDLYRITPLDVAWSEDA-------
CLU_SCLS1         -----------DGKRHDLEGSIETKGLLGTDGRKYVLDLYRVTPLDITWMEEVGTALDSP
CLU_PHANO         -----------DNVRHELEGSVETKGLIGTDGRRYALDLYRLTPLDVAWIEAHWSEPSKD
C7YZ61_NECH7      -----------EGKRFDLEASVETKGLLGTDARKYVLDLYRISPLDIAWLDEDGLP----
CLU_NEUCR         -----------ENKRHDLEASVEMKGLLGTDGRKYVLDLYRITPLDIAWMEESGP-----
D5G8Q8_TUBMM      -----------EGKKHELVASVETKGLLGTDGRKYVLDLYRTTPLDVDFLEKHWKGTEGE
CLU_SCHPO         -----------KEKSFPLYTSMDAKALKGSDGRTYLMDLYSLFPLDAQFLEVISDEKN--
CLU_MALGO         -----------QGMEHELCLSVDCKGLRGTDGRMYLLDVSRHTPMDVTWLDHDMEGSVLE
CLU_USTMA         -----------KGIKHSLWLSVDSKGLRGADGRRYVLDLARLNPVDINWLENDIDGAIHG
CLU_YARLI         ------------NKEHSLHLASDCKGLAGTDGRKYLLDLYRLAPVDIAFLDAN-------
CLU_CRYNJ         -----------EGKEHEFYASAEVKGLKGQDGRRYLLDAQRLAPVDVEWLEKDITGPLVG
E3K6B8_PUCGT      -----------NGRTHRLWLSADVHGIRATDGRCYLIDLYRMAPLDVSFIENDIDGPILD
                                   .  .   :.: . * * * :*     * *  :           

G1LLQ3_AILME      -----GEGLPEECTRAGFPRAHRHKLCCLRQELVDAFVEHRYLLFMKLAALQLMQQKASR
G1PQX9_MYOLU      -----GERLPEECTRAGFPRTHRHKLCCLRQELVDAFVEHRYLLFMKLAALQLMQQKASK
CLU_HUMAN         -----GEELPEECARAGFPRAHRHKLCCLRQELVDAFVEHRYLLFMKLAALQLMQQNASQ
H0WHW6_OTOGA      -----GEELPEECSRAGFPRTHRHKLCCLRQELVDAFVEHRYLLFMKLAALQLMQQKASK
CLU_MOUSE         -----GEELPEECSRAGFPRTHRHKLCCLRQELVDAFVEHRYLLFMKLAALQLMQQKASK
CLU_XENTR         -----GETMPEECTKMGFPKEHRHKLCCLRQELVDAFVEHRYLLFMKLAAMHLMQQKASI
H3BFU0_LATCH      -----NEELPEECGKMGFPKQHRHKLCCLRQELVEAFVEHRYLLFMKLAALQLMQQKANK
CLU_DANRE         -----GEELTPESQKLGFPRQHRHRLACLRQELIEAFVEHRYLLFMKMAALQLMQQKANK
C3Z652_BRAFL      -----GEELSEDCKALGFPRKHKHRLACLRQELVDAFAENRYLLFMRHAALQLMSIRQKK
CLU_AEDAE         -----DEELSKDCKALGFPIEHKHKLSCLRQELLEAFVESRYLMFIKHAAFQLQQLNSAK
CLU_ANOGA         -----EEAVGKESRAMGFPIEHRHKLCCLRQELLEAFVENRYLMFMKHAAVQLQQCVKMK
E9GHX8_DAPPU      -----GEDLSKEARALGFPVEHKHKLCCLRQELVDAFVESRYMLFIKYAAFHLQQVGLKK
E0VTU9_PEDHC      -----GEQLSKEVVALGFPIERKHKLCCLRQELIDSFVEARYMMFIKYAAFHLQQLGVKK
CLU_DROME         -----DVQLSKELVDMGFPIEHRHKLCCLRQELLEAFIEDRHVNFIRIAAARLQQLTTIK
CLU_DROPS         -----EVKLSTELVEMGFPIEHRHKLCCLRQELLEAFVEDRYVNFIRIAAVHLQQLNAKK
F6RE09_XENTR      -----EEEALKEECSHCFPKSYRHKLCNLRPELIDSFFQHNLIIYLKEEAVDVEQQMYAQ
CLU_CAEBR         -------EVSETAKDLGYPRKFPHKLSALRRELVDQFCESRLVMFIQSTARKIRA-----
CLU_CAEEL         -------EVSEAAKTLGYPRKFPHKLSALRRELIDAFCESRLVTFIQLTAKKIRD-----
CLU_BRUMA         -------EVTDICKANGYPRTFPHKLASLRQELIDAFVEYRYLMFIRIAAYHVQQT----
CLU_DICDI         ----------------------KDQLSVLRPEAIATYSEYFKVTWLNQKRQQ--------
D3B1P9_POLPP      ----------------------KHMLCLLRPELIASYTEFVRSQWEQKIKAE--------
CLU_ARATH         ----------------------ESRFCVLRPELITSFCQAESLEKSKFKTKADEGGDDSS
D7T2X0_VITVI      ----------------------GSRFCILRPELITAFCQAEVAERLKRKTKS--GGEVHV
C5XZV7_SORBI      ----------------------EHRFCVLRPELIASFVEAESIKQSFKQKVP--------
A9RLF4_PHYPA      ----------------------GCRLCVLRPELVAMFCQVSASTYSIFSGHA--------
D0P366_PHYIT      KE---NKDVVPEEDGLCFTRNDEGYAALLRPELVQLYSLWKENQARRAIREV--------
H3GWU1_PHYRM      QE---EKSIPSEEDGLCFTRNDEGYAALLRPELVQLYSLWKQNQARRVNREA--------
A0E685_PARTE      -----------------------NQCCVLRYELLQNYWVVNTIQKIKQ------------
Q6BG47_PARTE      -----------------------NQCCVLRYELLQNYWVVNTIQKIKQ------------
CLU_ASHGO         -------------AVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAYEE-----
CLU_KLULA         -------------DVKENK--YPHRQVLLRRELVERWRAEKIAASGKTLQEASED-----
CLU_YEAST         -------------NIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEE-----
CLU_VANPO         -------------NAEES-KRYPHRQTLLRPELVEKWWNSKVQAEGIEINKAYDE-----
CLU_CANAL         -------------DDDHQETSYPHGEALIRHEAVNEWWRRKVAVLFKKETEQLEKEGKL-
CLU_LODEL         ---------------EGENDSYPHGEALIRHEAVNEWWKRKVSALFAAETEKLEKEGKLE
CLU_DEBHA         ---------------ESKETSYPHRETALRHEAVEEWWKRKVSVLFKAETERLEKEGKLE
CLU_PICST         ---------------ASNDTSYPHGESLLRHEAVAEWWKRKVSALFKAETEKLEKEGKME
CLU_PICGU         ---------------PEHSDSYPHRETVLRHEAVEEWWRRRALAIFKSETERLEAEQGAK
CLU_EMENI         ----------------EDGDAYPHRMSVLRLELVESYWRAKMSQYVKAEVERRRAAKA--
CLU_ASPFU         ----------------PGSEDYPHRMSVLRLELVEAYWRSKMSQYVKAEVERRRAAKA--
C0NW18_AJECG      ----------------EGHEPYPHRMSVLRLELVESYWRYKMGQYVKAEVEKRKTAKQ--
CLU_SCLS1         K-----------EADVASESAYPHRMTVIRPELVEAYWKVKMREWVNGELERKRQAQK--
CLU_PHANO         E-----------DAK-PSEKNYPHRMATLRPELVESYGRLKLREYVKNEIDKKANKAR--
C7YZ61_NECH7      ----------------EDGDAYPHRMTVLRPELVDSFGRYKMKQWVDAELARRAEEKK--
CLU_NEUCR         -----------------EGSEYPHRMTVLRPELVEALAKQKTREYVQAELLKRGIIKKPE
D5G8Q8_TUBMM      ----------------ESEKGYPHRMAVLRPELVESFWKTKMREYVSAEMEKRKVAKG--
CLU_SCHPO         ----------------EEFPAYPHKLVHVRPELVQLFYEMKLQAFVNANHNAPKKKNL--
CLU_MALGO         G-----------TDT----ASYPHRLPLLRPELIDAYWDMHLHEFARDKLARQRASNEAS
CLU_USTMA         S-----------SSSPNQDAHYPHRMTLLRPELLEIYWDSEFRKWARAKLAARQEAKAAK
CLU_YARLI         -------------------PSYPHQLALLRFEAVEAYFRHQVRAEIKKQSLDEDE-----
CLU_CRYNJ         P--------KKDDESAEEGVQYPHRLVMLRPELIEQFWESELKRWARGVAEKAQAKKAEA
E3K6B8_PUCGT      GKTPISEPAVSKTSAKPTQDTFPHRFTVVRTEAINAFKQHKFRQFALNHIKKHKQQQQ--
                                              :* * :                          

G1LLQ3_AILME      V-----------------------------------------------------------
G1PQX9_MYOLU      M-----------------------------------------------------------
CLU_HUMAN         L-----------------------------------------------------------
H0WHW6_OTOGA      L-----------------------------------------------------------
CLU_MOUSE         V-----------------------------------------------------------
CLU_XENTR         K-----------------------------------------------------------
H3BFU0_LATCH      Q-----------------------------------------------------------
CLU_DANRE         DKTAALQDSNAAGAGSENKPLALESCDGTPDSPTSSESTLTPEDSEATTVSENSSAENQE
C3Z652_BRAFL      A-----------------------------------------------------------
CLU_AEDAE         ------------------------------------------------------------
CLU_ANOGA         ------------------------------------------------------------
E9GHX8_DAPPU      ------------------------------------------------------------
E0VTU9_PEDHC      ------------------------------------------------------------
CLU_DROME         ------------------------------------------------------------
CLU_DROPS         P-----------------------------------------------------------
F6RE09_XENTR      F-----------------------------------------------------------
CLU_CAEBR         ------------------------------------------------------------
CLU_CAEEL         ------------------------------------------------------------
CLU_BRUMA         ------------------------------------------------------------
CLU_DICDI         ------------------------------------------------------------
D3B1P9_POLPP      ------------------------------------------------------------
CLU_ARATH         N-----------------------------------------------------------
D7T2X0_VITVI      A-----------------------------------------------------------
C5XZV7_SORBI      ------------------------------------------------------------
A9RLF4_PHYPA      ------------------------------------------------------------
D0P366_PHYIT      ------------------------------------------------------------
H3GWU1_PHYRM      ------------------------------------------------------------
A0E685_PARTE      ------------------------------------------------------------
Q6BG47_PARTE      ------------------------------------------------------------
CLU_ASHGO         ------------------------------------------------------------
CLU_KLULA         ------------------------------------------------------------
CLU_YEAST         ------------------------------------------------------------
CLU_VANPO         ------------------------------------------------------------
CLU_CANAL         ------------------------------------------------------------
CLU_LODEL         ------------------------------------------------------------
CLU_DEBHA         ------------------------------------------------------------
CLU_PICST         ------------------------------------------------------------
CLU_PICGU         ------------------------------------------------------------
CLU_EMENI         ------------------------------------------------------------
CLU_ASPFU         ------------------------------------------------------------
C0NW18_AJECG      ------------------------------------------------------------
CLU_SCLS1         ------------------------------------------------------------
CLU_PHANO         ------------------------------------------------------------
C7YZ61_NECH7      ------------------------------------------------------------
CLU_NEUCR         EKKEGEE-----------------------------------------------------
D5G8Q8_TUBMM      ------------------------------------------------------------
CLU_SCHPO         ------------------------------------------------------------
CLU_MALGO         S-----------------------------------------------------------
CLU_USTMA         D-----------------------------------------------------------
CLU_YARLI         ------------------------------------------------------------
CLU_CRYNJ         E-----------------------------------------------------------
E3K6B8_PUCGT      ------------------------------------------------------------
                                                                              

G1LLQ3_AILME      ---EGPPSLENGG-SLSSES----------------------------------------
G1PQX9_MYOLU      ---ENSTSLENGS-PPSLES----------------------------------------
CLU_HUMAN         ---ETPSSLENGG-PSSLES----------------------------------------
H0WHW6_OTOGA      ---ENPTSLENGS-SPSSES----------------------------------------
CLU_MOUSE         ---ETTTSLENGGLPSSAET----------------------------------------
CLU_XENTR         ---DVL-----GTEASTASE----------------------------------------
H3BFU0_LATCH      ---DNPRTTENGTPPITEHQ----------------------------------------
CLU_DANRE         AMTEVPVASINGTHEPLAAE----------------------------------------
C3Z652_BRAFL      --TTVEETKESRERDGKEAE----------------------------------------
CLU_AEDAE         ---LKQKQEAKDSKDSEKKEEPKAIEAAPVAKEPAKKDAAESN-----------NNVE--
CLU_ANOGA         ---QEQKAAAAQKTEEGGKQAAIEAAAPAEGDKTPAKDAKDGKEAGK-------DAND--
E9GHX8_DAPPU      ---QKATSERSGSVEKETVK----------------------------------------
E0VTU9_PEDHC      ---QKER-ESKANLEKDVS-----------------------------------------
CLU_DROME         ---QSEKSEANPVPALEGAE----------------------------------------
CLU_DROPS         --EETQSEEKKQLPAIEEAE----------------------------------------
F6RE09_XENTR      -----MKLVMEKTKDGDSQQ----------------------------------------
CLU_CAEBR         --------LITEAKE---------------------------------------------
CLU_CAEEL         --------LITESKE---------------------------------------------
CLU_BRUMA         ----KLGLLETDYNDDKKETT---------------------------------------
CLU_DICDI         ------------------KL----------------------------------------
D3B1P9_POLPP      ------------------KE----------------------------------------
CLU_ARATH         -----VSADTSKVGDALIDG----------------------------------------
D7T2X0_VITVI      -----SDSPKASSVDEQVRT----------------------------------------
C5XZV7_SORBI      ------------------------------------------------------------
A9RLF4_PHYPA      ----------SFLGLLTHSL----------------------------------------
D0P366_PHYIT      ---------RKAAKKEEKGT----------------------------------------
H3GWU1_PHYRM      ---------RIAAKEAKKAE----------------------------------------
A0E685_PARTE      ------------------------------------------------------------
Q6BG47_PARTE      ------------------------------------------------------------
CLU_ASHGO         ------------------------------------------------------------
CLU_KLULA         ------------------------------------------------------------
CLU_YEAST         ------------------------------------------------------------
CLU_VANPO         ------------------------------------------------------------
CLU_CANAL         ------------------------------------------------------------
CLU_LODEL         ------------------------------------------------------------
CLU_DEBHA         ------------------------------------------------------------
CLU_PICST         ------------------------------------------------------------
CLU_PICGU         ------------------------------------------------------------
CLU_EMENI         -------------------------------------EEAAK--------KEKSSEDTES
CLU_ASPFU         -------------------------------------QEDAAN-------KEQPSETTES
C0NW18_AJECG      -------------------------------------EAEKTKAIE--AQNEDKAEVLST
CLU_SCLS1         -------------------------------------TIEPTAEEKEPGAVAEASEASKS
CLU_PHANO         -------------------------------------GGRRR-------LPKAQKKADAG
C7YZ61_NECH7      -------------------------------------QVEDAKEDKEEKDGEEKEEKEDK
CLU_NEUCR         -------------------------------------ATEEAKTEEIKTEEAEKSEEPKA
D5G8Q8_TUBMM      -------------------------------------EDQKKSDEAKAYAGEEGEAKGEA
CLU_SCHPO         -------------------------------------------------NDSLKSVELEG
CLU_MALGO         ------------------------------------------------------------
CLU_USTMA         ------------------------------------------------------------
CLU_YARLI         ------------------------------------------------------------
CLU_CRYNJ         ------------------------------------------------------------
E3K6B8_PUCGT      ------------------------------------------------------------
                                                                              

G1LLQ3_AILME      -------------KPEDP-PGPEAGSEEEGGSAGGLAKVK----------------ELAE
G1PQX9_MYOLU      -------------KSEDP-LGPE-GSEEEGGSASGLAKVK----------------ELAE
CLU_HUMAN         -------------KSEDP-PGQEAGSEEEGSSASGLAKVK----------------ELAE
H0WHW6_OTOGA      -------------TAEDP-PGPEAEREEDGSNANGLARVK----------------ELAE
CLU_MOUSE         -------------KSEDS-IGPEAGCEEEGSSVSGLAKVK----------------ELAE
CLU_XENTR         -------------QLEGN-GPSEE---KEDLDLDGEAQLK----------------QLEE
H3BFU0_LATCH      -------------ECEKA-EKLESEDGKTEESISRIARAK----------------ELAE
CLU_DANRE         -------------RQNGG-CDGPLEGKEADENIPGLAQAK----------------ELAE
C3Z652_BRAFL      -------------KSERPKLGGCTRGQGDSSKDPVDAEAQ----------------ALVE
CLU_AEDAE         ------------SKEECPKKGSTDKAKDKSAGVPKVETEE--------------AKKLME
CLU_ANOGA         ------------GKEEGSTTKEAAAAAAAARSVPKPDSED--------------AKKLVE
E9GHX8_DAPPU      -------------SDDTDIAGVQSTSEKGTEEQQQLNSDE--------------AKKIVE
E0VTU9_PEDHC      -------------NENNKVPEKQLKTFEGEKEEE-IEPDE--------------AKKIVE
CLU_DROME         -------------AASK--VNGAEKPDDKEKKNEEEEKKERS------TSGEARAAAIVN
CLU_DROPS         -------------KENKENLNVNETPNEKEKDTPVETKN---------------AEAMVN
F6RE09_XENTR      ---------------NNGIAHDESQENDHLKSFSTLSTTA-------------------Q
CLU_CAEBR         -------------KNDEELIKQAAEAESELSLVFVAVSED--------REIETKNKIVQD
CLU_CAEEL         -------------KNDETLIKQAAEAETELSLLFMAISED--------KEFEAKNKVVQD
CLU_BRUMA         -------------KEDTVLKVTGFSEDAIMSQIKREITADIKIDEMPLLETEAAKKIMEE
CLU_DICDI         --------------KEKEERQKKEGIDPPTATARDEDVQL--------------------
D3B1P9_POLPP      --------------SKRKQEEKTDAFATQEDGSQTDESEK--------------------
CLU_ARATH         --------------EANGASNSDQKSIS-DKQNTTAEDYA--------------------
D7T2X0_VITVI      --------------DANDAVASDSQDLTIEGKIEAAPDSA--------------------
C5XZV7_SORBI      --------------DAPVASASDAEATSVEGDDKSEESSV--------------------
A9RLF4_PHYPA      --------------LLSCVSSSQVEAQERATQRKADDDQA--------------------
D0P366_PHYIT      --------------EDNASIKN----DAEKKD---TEENE--------------------
H3GWU1_PHYRM      --------------EANENKENGAEADTEKKEDATSEKKE--------------------
A0E685_PARTE      --------------NNSDDPKTQQEAYQNIQNLLIGNPKE--------------------
Q6BG47_PARTE      --------------NNSDDPKTQQEAYQNIQNLLIGNPKE--------------------
CLU_ASHGO         ------------------------------------------------------------
CLU_KLULA         ------------------------------------------------------------
CLU_YEAST         ------------------------------------------------------------
CLU_VANPO         ------------------------------------------------------------
CLU_CANAL         ------------------------------------------------------------
CLU_LODEL         ------------------------------------------------------------
CLU_DEBHA         ------------------------------------------------------------
CLU_PICST         ------------------------------------------------------------
CLU_PICGU         ------------------------------------------------------------
CLU_EMENI         KEEGS-------------------------------------------------------
CLU_ASPFU         KEGES-------------------------------------------------------
C0NW18_AJECG      SEPGE-------------------------------------------------------
CLU_SCLS1         DEPTENGELAKK------------------------------------------------
CLU_PHANO         KEVDG-------------------------------------------------------
C7YZ61_NECH7      AETEEKEEK---------------------------------------------------
CLU_NEUCR         EETEKTEEASES------------------------------------------------
D5G8Q8_TUBMM      TEKFEE------------------------------------------------------
CLU_SCHPO         NGIKLS------------------------------------------------------
CLU_MALGO         -------------------PSTATSS----------------------------------
CLU_USTMA         -------------------AKAKEAASKEDGEKT--------------------------
CLU_YARLI         ------------------------------------------------------------
CLU_CRYNJ         --------------AEAAAAADAEGEKKKEGEQSEIPQEEQS------------------
E3K6B8_PUCGT      --------------ASQATADSKTDGKPIEASTEGLGEDV--------------------
                                                                              

G1LLQ3_AILME      TIASD----DGTADPRSREVIRNACKAVGSISSTAFDVRFNPDIFSPG-VR--------F
G1PQX9_MYOLU      TIASD----DGTD-PRSREVIRNACKAVGSISSTAFDVRFNPDIFSPG-VR--------F
CLU_HUMAN         TIAAD----DGTD-PRSREVIRNACKAVGSISSTAFDIRFNPDIFSPG-VR--------F
H0WHW6_OTOGA      TIAAD----DSTD-PRSREVIRNACKAVGSISSTAFDIRFNPDIFSPGKVR--------F
CLU_MOUSE         TIASD----DGTVDPRSREVIRNACKAVGSISSTAFDIRFNPDIFSPG-VR--------F
CLU_XENTR         TMAAH----KETVDTRSKEVILKACQAVGSISNTSFDIRFNPDIFSPG-VR--------F
H3BFU0_LATCH      TIASE----GGTVDPKSREVIQNACKAVGSLSNTSFDIRFNLDIFSPG-VR--------F
CLU_DANRE         SLAAED---GSGIDPKSREVVLNACKAVGSISNTSFDIRFNPDIFSPG-VR--------F
C3Z652_BRAFL      SLAEQD---SGSLDDASREVINAACRAIGSLSDSEFDVRFNPDVFSPG-VT--------H
CLU_AEDAE         SLLSSDEKNES------KEVVKRACEAVGSLKEYEFDIRFNPDVYSPGIKH--------V
CLU_ANOGA         SLISSDQKNES------MEVVKRACEAVGSLKEYEFNIRFNPDVYSPGIRH--------V
E9GHX8_DAPPU      SITDSITHGEK-----PDEIVRKAAAAVGSLKDTEFDIRFNPDVLSPGVRH--------P
E0VTU9_PEDHC      SITDSITGEKKELEESTKEIVVKAAHAVCSLKETEFDVRFNPDVYSPGVSH--------L
CLU_DROME         AIREAQSNVATSNEVQAAEVVKRACAAVGSLKEKEFDFRFNPDVFSPGIRH--------A
CLU_DROPS         AIREAQSNVATSNEIQAAEVVKQACAAVGSMKEKEFDFRFNPDVFSPGIRH--------V
F6RE09_XENTR      SIICHNYIYEK----KEVDIVRQACREVGSVLDYTFDIRFNPDICSTVVRF--------P
CLU_CAEBR         AIK-------------------EACAEIHSIYEDRFVIKFNPDCFSPNVKH--------A
CLU_CAEEL         AIK-------------------EACAVVHSIYEDRYVMKFNPDCFSSNVKH--------A
CLU_BRUMA         VIDSDHKKVDSLDKEISETIMAKAAKAVGSIRMDAFDVRFNPDCYCSTVRH--------A
CLU_DICDI         ----------------------TEEDLA-----QSPVVSFNPNLF----SK--------V
D3B1P9_POLPP      ----------------------TETAVAETANEQPPHILFNANLLGASNSI--------C
CLU_ARATH         ----------------------AGSSESSKS---CDQIAFNPNVF----TD--------F
D7T2X0_VITVI      ----------------------SAHAESTES---CEEMFFNPNVF----TE--------F
C5XZV7_SORBI      ----------------------HTHEENDNS---TSEILFNPNVF----TE--------Y
A9RLF4_PHYPA      ----------------------DEKALVQEE---LSKIMLNPNVF----TD--------F
D0P366_PHYIT      ----------------------QEEEEDEE----IPPVLLNPNVF----MD--------Y
H3GWU1_PHYRM      ----------------------TEEADEEEETAAVPPVLLNPNVF----MD--------Y
A0E685_PARTE      ------------------------------------GLKLNPALGTKTILQ--------S
Q6BG47_PARTE      ------------------------------------GLKLNPALGTKTALQ--------T
CLU_ASHGO         -----------------------------------GKFSYNPDAYK--------------
CLU_KLULA         -----------------------------------VSFIYNPDAYV--------------
CLU_YEAST         -----------------------------------NLFSYNPDAYQ--------------
CLU_VANPO         -----------------------------------AKFTYNPDAYQ--------------
CLU_CANAL         ----------------LDKNQDQDQENKPQIAIPTDQVVFNPDAFS--------------
CLU_LODEL         ----------------KDGSKGTNSEEKSQIALPIDQVSFNPDAFS--------------
CLU_DEBHA         ----------------SKDGE------KPQIVLPSDQITINTDAFT--------------
CLU_PICST         ----------------SKDGE------KPQIVLPTDQVVFNPDAFS--------------
CLU_PICGU         ----------------KNEGES----EKPQILLDAQKVSFNPDAFT--------------
CLU_EMENI         ------------------EEKSEEALDQERVDISGFSLALNPDVFSGQIPQ--------T
CLU_ASPFU         ------------------EEKAEEALDQERVDISGFQLALNPDVCSGQVPQ--------T
C0NW18_AJECG      ------------------GEKKAVASEQERVDISAFKLALNPDVFSGQVPQ--------T
CLU_SCLS1         -----------ADESDKDAEPSKPAADQERIDIGDFKFALNPDAFSGQQPQ--------T
CLU_PHANO         ------------------EKKAEAEPEQDRVDISGFSFALNPDVFSGQTPQ--------S
C7YZ61_NECH7      -----------------EGEDEASKAEKNLPDLSDFKFSLNPDAFSGQVPQ--------T
CLU_NEUCR         -----------TEVA--EKKDEEAAKEDERIDISNFKFALNPDVFSGQVPQ--------T
D5G8Q8_TUBMM      -----------------DVQEKKLEEPVNSIDISSFEFSLNPDVLSGQKPE--------T
CLU_SCHPO         ------------------SEKGKNNVNKVRNDNARFDCGFNPDCFRSDYIF--------P
CLU_MALGO         -----------------------------QVDVSDFSLNFHPDAFAEFRTG----SGDDA
CLU_USTMA         ------------------EAPEVEAEEPERLDSSEFKLTFNPDAFVEFKVADTL-AEEHS
CLU_YARLI         -----------------------------TPKFEVEPFYLNPDAFVLPAPK---------
CLU_CRYNJ         --------AAASAAAARRAEEDRPVDASLIGDIKQFNLSFNPDAFVEQPVLEAEGQEGKT
E3K6B8_PUCGT      ----------------VVDPDMSTDDGSDASVKENFEFGLNPDAFVDRKDQ---------
                                                          :                   

G1LLQ3_AILME      PES--CQEEVRDQKQLLKDAAAFLLSCQIPGLVKDCIDHA-VLPMDGATLAEVMRQRGIN
G1PQX9_MYOLU      PES--CQEEVRDQKQLLKDAAAFLLSCQIPGLVKDCTDHV-VLPMDGATLSEVMRQRGIN
CLU_HUMAN         PES--CQDEVRDQKQLLKDAAAFLLSCQIPGLVKDCMEHA-VLPVDGATLAEVMRQRGIN
H0WHW6_OTOGA      PES--CQDEVRDQKQLLKDAAAFLLSCQIPGLVKDCTEHV-VLPMDGATLAEVMRQRGIN
CLU_MOUSE         PES--CQDEVRDQKQLLKDAAAFLLSCQIPGLVKDCTEYA-VLPMDGATLAEVMRQRGIN
CLU_XENTR         PNE--SQEEVQNQKQLLKDAAAFVLTCQIPCLIKDCLDHS-VVPMDGTTLAEAMHQRGIN
H3BFU0_LATCH      PES--SSEELVKQKQLFKDAAAFLVSCQIPCLIKDCLDHT-VLPMDGATMAEALHQRGIN
CLU_DANRE         PDD--SNDDIKKQKQLLKDAAAFLVSCQIPSLVKDCLDHS-SLPMDGATLTEALHQRGIN
C3Z652_BRAFL      PNP--QGDQFRKQKQLVKDAAAFLVSHQIAGFVKDCIEHS-ITAIDGQSLCEALHDRGIN
CLU_AEDAE         DNQ-SAANSLKKQKQLVKDAAEFLVKHQIPSFVHDCLDHT-AAPMDGTTLTETLHSRGIN
CLU_ANOGA         DEEPNAAGSLRRQKQLVKDAAEFLVKHQIPSFVHECLDHT-SAPMDGVTLTELLHNRGIN
E9GHX8_DAPPU      DGL-VALERLKKEKQLIKDAADFLITIQIPTFIRDCLDHS-SAPLDGSTLIEAIHSRGIN
E0VTU9_PEDHC      N---PNGEQLKKERQLVKDAAHFLLTVQIPTFIRDCLDHS-AAPMDGATFSEALHNRGIN
CLU_DROME         DGEEGTS--LAKQKVLVQEAAEFLVLKQIPAFIKEHMSHS-SSPIDGQSLTESLHSHGIN
CLU_DROPS         DGEEGTSGSVAKQKLLVQDAAEFLVVKQIPAFVKEHLSHS-SPPIDGQNLTESLHSHGIN
F6RE09_XENTR      ESQ---KAVNQLQRRLLSEASTFLLNVQIPAFIKGCLTHV-FVPMDGKSLTEALHSHGIN
CLU_CAEBR         PSE-----NLERQRRVVIDAAEYLLTNQIPEIVQSFKDCT-VQPIDGNNLADILHSKGIN
CLU_CAEEL         PTE-----NLERQRRVVVDAADFLLTQKIPELVQNLKDCV-VQPIDGDNLADIMHINGIN
CLU_BRUMA         ESE-----DITKQRRLVAEAAEFLIVQQLPNFVRDCLQRT-IMLLDGASLIDSLHSRGIN
CLU_DICDI         KLG-GTPEEQQKDIEDLKAIGAFLKGILIPRLIEDLMLFN-VAPVDGQTLTQVMHVRGIN
D3B1P9_POLPP      RLK-GTPEELKADMETLEAAGNFLKETMIGNLIDDFKLFN-LTPVDGQTLTQAMHSRGIN
CLU_ARATH         TLG-GNQEEIAADEENVKKVSSYLVDVVLPKFIEDLCTLE-VSPMDGQTLTEALHAHGVN
D7T2X0_VITVI      KLA-GSPEEIAADEENVRKASSHLTDVVLPKFIQDLCTLE-VSPMDGQTLTEALHAHGIN
C5XZV7_SORBI      KLA-GSPEEITADEVLVKRAGTYLIDIVIPKFVQDLCSLD-ISPMDGQTLTDALHLHGIN
A9RLF4_PHYPA      KVA-GSQEEIEADEELVRKAGNYLKDTVLPRLVADLSSLE-VSPMDGPTLTDALHAHGIN
D0P366_PHYIT      AAS-TDSEQREADKAAAKDAAEYMQRIVVPAFVADVRRGA-IAPADGYALTQLMHSCGIN
H3GWU1_PHYRM      AAS-TNAEQLEADETAAKDAAEYLQRIVVPAFVADVRRGA-SAPADGYSLTQLMHSCGIN
A0E685_PARTE      SEK------LTQQEEDLKKLATFLLNQAIPQLIQELSQPE-TSRHSDLSISDIFHSHGVN
Q6BG47_PARTE      SEK------LTQQEEDLKKLATFLLNQAIPQLIQELSQPE-TSRHSDLSISDIFHSHGVN
CLU_ASHGO         IEG---IE-----DETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMHKNGIN
CLU_KLULA         IDG---VE-----DENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVN
CLU_YEAST         VEG---IE-----DANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGIN
CLU_VANPO         VEG---VE-----DVNIQDMSSYLVETVLPSVIEDYATGNVSVPYDGEHLVDTLHINGIN
CLU_CANAL         SDN---ENEIEQDREEVREISKFIKEKLIEEFLDEIKDQ--VIPFDGQQLTDVLHRSGIN
CLU_LODEL         SDF---ES--KEDRDEVREISKFIKEKLIPEFIEECQHQ--LAPFDGQQLSEQLHRYGIN
CLU_DEBHA         TID---ES--SDDQNEVREVSKFIKEHLIEEFLEENSKQ--ISPFDGNHLTSMLHKQGIN
CLU_PICST         FDS---ES--DEDREVVRNLSKFVKEKLIEEFLTEFPSQ--VAPFDGQQLTSILHRQGIN
CLU_PICGU         HDE---VD--EEDKEVVREMSLFVTKQLIEEFVEESKKQ--LCPFDGSHLSSLLHKAGIN
CLU_EMENI         DEE---KEQWAQDEKEVRDACDFLRSKVMPELIQDLHDGDVGFPMDGQSLSQLLHKRGIN
CLU_ASPFU         EEE---KKQWAEDEKEVRDACEFLRSKVIPELIQDLHDGDVGFPMDGRSLSQLLHKRGIN
C0NW18_AJECG      DEE---KEEWAQDEKEVRSACDHLISKVIPELIQDLHDGDVGFPMDGESLTQLLHKRGIN
CLU_SCLS1         DEE---KAEFAEDEQQVRLVCEFLRKTVLPELVNDLKEGDVGFPMDGQSLSRLLHKRGIN
CLU_PHANO         DED---KAEWAKDEAEVRAACDHLQTEVIPRMITELKDGEVGFPMDGQSLSSLLHKRGVN
C7YZ61_NECH7      EEE---KAEFAADEAEVRAAGAYLREQVIPELLRELSDSDISFPMDGQSLSRLLHKRGIN
CLU_NEUCR         EEE---KAEMAQDEQDVRDACTYLRDSVIPALLNDLKESDISFPMDGRSLTRLLHRRGIN
D5G8Q8_TUBMM      EEE---KVQMEKDEKDVRDACNFLLTTAIPRLISDLAEGEVGSPMDGHSLSCLMHKRGVN
CLU_SCHPO         PDN---KELYDKDIENSYALSQYLHAEVIPNFVKSLSEPSSFLPIDGVALCRAMHRSGIN
CLU_MALGO         RVIQPATDESIPSIAAVRKVSEYLRKEVIVRLISDVAAGL-TSAVDGIALTNRMHARGIN
CLU_USTMA         KVITPITDESDASIAAVRQASDFLRKVAIPRFVTDVAAGL-FTAADGGALSRQMHARGIN
CLU_YARLI         -----------EDEDAVRAASEFVSNTIIPEHVEAVIAGFGTTPIDGQQLTQSLHGKGIP
CLU_CRYNJ         EIKAAITDESDPSVKAVRDAGLFLRQIAIPAVVLDVLTGNTSGVMDGESLSKHLHQRGVN
E3K6B8_PUCGT      -PWTLPQDKEDQGMALVKELSKYVREQLLVTVVQDLSEVK-GLPADGRRLSDFLHSRGVN
                                        .:    :   :            ..  :   ::  *: 

G1LLQ3_AILME      MRYLGKVLDLVLRSPA--------------------------------------------
G1PQX9_MYOLU      MRYLGKVLDLVLRSPA--------------------------------------------
CLU_HUMAN         MRYLGKVLELVLRSPA--------------------------------------------
H0WHW6_OTOGA      MRYLGKVLDLVLRSPA--------------------------------------------
CLU_MOUSE         MRYLGKVLDLVLRSPA--------------------------------------------
CLU_XENTR         MRYLGKVIDVVRKFPV--------------------------------------------
H3BFU0_LATCH      MRYLGKIVEFISKAPA--------------------------------------------
CLU_DANRE         VRYLGTVLEFMDNMPA--------------------------------------------
C3Z652_BRAFL      MRYLGKVADLLCQ-----------------------------------------------
CLU_AEDAE         VRYLGKVANLLAKI----------------------------------------------
CLU_ANOGA         VRYLGKVVDQLAKI----------------------------------------------
E9GHX8_DAPPU      VRYLGKIVSMLSKV----------------------------------------------
E0VTU9_PEDHC      IRYLGKIVAMLSKV----------------------------------------------
CLU_DROME         VRYLGKVIKILSQM----------------------------------------------
CLU_DROPS         VRYLGKVIKALGQM----------------------------------------------
F6RE09_XENTR      IRYLGTIAETIDQVEE--------------------------------------------
CLU_CAEBR         IRYLGEIGKRVQD-----------------------------------------------
CLU_CAEEL         IRYLGEIGKRLEN-----------------------------------------------
CLU_BRUMA         IRYLGKLTKYIQNV----------------------------------------------
CLU_DICDI         MRYLGYIAKNESANVP--------------------------------------------
D3B1P9_POLPP      MRYLGHIAK-LCDGIP--------------------------------------------
CLU_ARATH         VRYIGRVANGVKHLP---------------------------------------------
D7T2X0_VITVI      VRYIGKVADRTKHLP---------------------------------------------
C5XZV7_SORBI      IRYLGKIAGMVKHLP---------------------------------------------
A9RLF4_PHYPA      IRYLGQVAKKAEHLP---------------------------------------------
D0P366_PHYIT      MRYLGRLASLAKKLEAI-------------------------------------------
H3GWU1_PHYRM      MRYLGRLALLAKKLEAI-------------------------------------------
A0E685_PARTE      MRYLGKVISFIRSEEQ--------------------------------------------
Q6BG47_PARTE      MRYLGKVISFIRSEEQ--------------------------------------------
CLU_ASHGO         IRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIKERQVTIQK
CLU_KLULA         MRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINK
CLU_YEAST         MRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINK
CLU_VANPO         VRYLGKLAILAKEKLQLQEEVHEKRLKEIEISNKDYEEWEASYLKKIEKMIIERQEKVNK
CLU_CANAL         MRYLGYVAERLVVKKEKHLVDLEELIKENEAKAEKKREEEKEKEEKEATESEDKKEKKED
CLU_LODEL         LRYLGYIAEQVLVKKAEYEESVEKTIKENEELVKVREAEKVEKDRREAEEAEKAKERAAA
CLU_DEBHA         LRYLGHIAEQACVRKDEHLKKITEARKVNEEEISKRKEESEKKATEGKDQDKEEE-----
CLU_PICST         MRYL--------------------------------------------------------
CLU_PICGU         LRYLGLIATRAQESLEAFEQEEKSKIEDNEKAIEEEKKEEKTEKKEEKEEKADEE-----
CLU_EMENI         IRYLGKLATLAKEK----------------------------------------------
CLU_ASPFU         IRYLGKLAQLSKEK----------------------------------------------
C0NW18_AJECG      VRYLGKLAKLSQAK----------------------------------------------
CLU_SCLS1         IRYLGQVATLAD------------------------------------------------
CLU_PHANO         IRYLGKIAELSDKP----------------------------------------------
C7YZ61_NECH7      VRYLGKVAELAN------------------------------------------------
CLU_NEUCR         MRYLGKLATLSE------------------------------------------------
D5G8Q8_TUBMM      VRYLGVIASLADEE----------------------------------------------
CLU_SCHPO         IRYLGEIANIILQK----------------------------------------------
CLU_MALGO         MRYLGYIANLSQPSQRD-------------------------------------------
CLU_USTMA         VRYLGYVARLCSPEAKQ-------------------------------------------
CLU_YARLI         MRHLASVIAAAKKSD---------------------------------------------
CLU_CRYNJ         IRYLGHLASTIIQFSTS-------------------------------------------
E3K6B8_PUCGT      IRYLGHITHRLQLLATALSAS---------------------------------------
                  :*::                                                        

G1LLQ3_AILME      ---------------------------------------------RGQLDHIYKIGIGEL
G1PQX9_MYOLU      ---------------------------------------------RDQLDHIYKIGIGEL
CLU_HUMAN         ---------------------------------------------RHQLDHVFKIGIGEL
H0WHW6_OTOGA      ---------------------------------------------RDQLDHVYKIGIGEL
CLU_MOUSE         ---------------------------------------------RDQLDHIYKIGIGEL
CLU_XENTR         ---------------------------------------------PSQLDHIYKILISEV
H3BFU0_LATCH      ---------------------------------------------RAQLDHIYKIGVTEL
CLU_DANRE         ---------------------------------------------KAQLEHIYRIGISEL
C3Z652_BRAFL      ---------------------------------------------HKLLEHIHRIAVSEM
CLU_AEDAE         ----------------------------------------------KQLEYLHTIAVSEL
CLU_ANOGA         ----------------------------------------------KQLEYLHTIAVSEL
E9GHX8_DAPPU      ----------------------------------------------PQLEYVYVIGVSEL
E0VTU9_PEDHC      ----------------------------------------------KQLEYLYSIAVAEL
CLU_DROME         ----------------------------------------------PRMDYLHRIAVLEL
CLU_DROPS         ----------------------------------------------PRMDYLYRIAVMEL
F6RE09_XENTR      ---------------------------------------------RQPLDHVYRIVIMEI
CLU_CAEBR         -----------------------------------------------TNSFARPLVLSDI
CLU_CAEEL         -----------------------------------------------SVSFARPLVLSDI
CLU_BRUMA         ----------------------------------------------GQLSYVKVICITEL
CLU_DICDI         --------------------------------------------------FIQDLLFNEM
D3B1P9_POLPP      --------------------------------------------------FAKEVCFNEM
CLU_ARATH         --------------------------------------------------HLWDLCLNEI
D7T2X0_VITVI      --------------------------------------------------HLWELCSNEI
C5XZV7_SORBI      --------------------------------------------------HLRDLFSAEI
A9RLF4_PHYPA      --------------------------------------------------HIWDLAVVEM
D0P366_PHYIT      ---------------------------------------------SGISKYLLEILEVEM
H3GWU1_PHYRM      ---------------------------------------------GGISKYFLEVLEVEM
A0E685_PARTE      -------------------------------------------------PSLRLTLERVV
Q6BG47_PARTE      -------------------------------------------------PSLRLTLERVV
CLU_ASHGO         LLAEGKE----------VPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEI
CLU_KLULA         YVQQGKE----------VPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEM
CLU_YEAST         LVQEGKE----------VPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEI
CLU_VANPO         LVQEGKE----------VPKELTEELKLNEDDIRKPTDDAPAVVNTDELLPLIKVTEIEI
CLU_CANAL         ---------------------KEDAEKEEAEAEEEVPTKATYQLTLANYSTLHRIIIQEM
CLU_LODEL         QPESSSDDKNQETIENSDAKSKENTESDDKDAEEQPVSKATYELVLANYDSLYRLAIQEM
CLU_DEBHA         ---------------------KANDNEKNKEDDKEEVSNGEFEPIVANFDSLYRISVQEM
CLU_PICST         ----------------------------------DEQTKATYEPTLANYDALYRVTVQEM
CLU_PICGU         ---------------------KSENEEDKTK--PEEPSKGVFDPIKANLNSVRLLAIQEM
CLU_EMENI         ---------------------------------------------GSRLEALSTLLVQEM
CLU_ASPFU         ---------------------------------------------GSRLEALTTLLVQEM
C0NW18_AJECG      ---------------------------------------------GQRLLALTALLIQEM
CLU_SCLS1         ---------------------------------------------GKRLESLRILAVQEM
CLU_PHANO         ---------------------------------------------DPRLQALKRLIVQEM
C7YZ61_NECH7      ---------------------------------------------DGRLRCLREICVQDM
CLU_NEUCR         ---------------------------------------------GTRVECFRQLCVREM
D5G8Q8_TUBMM      ---------------------------------------------GTKLGSIKTLAIQEM
CLU_SCHPO         ---------------------------------------------SPNNVILLKLVTSEI
CLU_MALGO         -------------------------------HWDQSVVSKLGSGHEALVQAFRRVVIHEM
CLU_USTMA         -------------------------------ELDQELIQKAGPGHEGFLNAFRLTVLQEM
CLU_YARLI         ---------------------------------------------TSKAQFLAELCEQEI
CLU_CRYNJ         -------------------------------------KDGAAKEPSGHLAALQSIVLQEM
E3K6B8_PUCGT      --------------------------------------PDNKTDQNVILNASIGLLQSEM
                                                                             :

G1LLQ3_AILME      ITRSAKHIFKTYLQ--GVELSGLSAAISHFLNCFLSSYPNPVA------HLPADELISK-
G1PQX9_MYOLU      ITRSAKHIFKTYLQ--GVELSGLSAAISHFLNCFLSSYPNPVA------HLPADELVSK-
CLU_HUMAN         ITRSAKHIFKTYLQ--GVELSGLSAAISHFLNCFLSSYPNPVA------HLPADELVSK-
H0WHW6_OTOGA      ITRSAKHIFKTYLQ--GVELSGLSAAISHFLNCFLSSYPNPVA------HLPADELVSK-
CLU_MOUSE         ITRSAKHIFKTYLQ--GVELSGLSAAISHFLNCFLSSYPNPVA------HLPADELLSK-
CLU_XENTR         ITRSAKHIFKTYLQ--GVELSALSAAISHFLNCFLSSFPNSVA------HLQSDELVSK-
H3BFU0_LATCH      ITRSAKHIFKSYLQ--GVELSGLSAAISHFLNCFLSSFPNPVA------HLPADELVSK-
CLU_DANRE         ITRCAKHIFKTYLQ--GVDLSALSAAVSYFLNCLLSSFPDAVA------HLPADELVSR-
C3Z652_BRAFL      ICRAAKHQFKTYMQ--GVEMLCLSAAVSHFLNCLLSTFSNPHP------QLPED--FGK-
CLU_AEDAE         IIRAAKHIFTSYMQ--NTEMMSMAAAISHFLNCFLTATTAVSH------SGSLSESD---
CLU_ANOGA         IVRAAKHLFTAYLQ--QTDVMSMAAAISHFLNCFLTVSTGGYQ------PVANGTGADGD
E9GHX8_DAPPU      IVRAAKHLFTTYMQ--GVEMMGLSAAIAHFLNCFLGSNPTPA-------TLGADELQ---
E0VTU9_PEDHC      ITRAAKHVFTNYIQ--STDLMNLSASISHFLNCFLSSCQMPHP------QQSLDELH---
CLU_DROME         IVRATKHIYYTYMQ--NTEPLHLSAAISHFLNCLLTNGPVNPA------VSSEEAHK---
CLU_DROPS         IVRATKHIYYTYMQ--STDPMHLSVAISHFLNCLLTNGPINPV------VSNDEMHK---
F6RE09_XENTR      VTRSAKQILRHYLQ--GVEMSALSAAVSHFLNCLLSSYPNPVA------HLPPDELMSR-
CLU_CAEBR         VARSAKHVIRKINV--QTPVDQLVVSTSHILNCLFSTVSEPSP-------VASHAHKKS-
CLU_CAEEL         VARSAKHVIRKINV--QITADQLSASTSHILNCLFSVVLDPSP-------IAANVAKKA-
CLU_BRUMA         LCRCAKHIFRGYLQ--PVSSAHTAAAVSHFLNCLLSSSTEPLTPSNEEVSMPINSVKKS-
CLU_DICDI         VSRAAKHCFNRLLR--STNASDMAHSISHFLNCFLGTETGSVSADEKSKKAKQIKS----
D3B1P9_POLPP      VSRATKHIFSNILR--AAPQAELSVVACQFLNCFLGTQTIGADTNNSIK-----------
CLU_ARATH         TVRSAKHILKDILR--DIEDHDIGSAVSHFLNCFFGNYQTAGGKASANSSTAKNQKKFF-
D7T2X0_VITVI      VVRSAKHILKDVLR--NTEDHDIGPAISHFFNCFFGSYQAVGVKATANSTQARTSKKDH-
C5XZV7_SORBI      IVRSAKHVIKDILR--QSLDHDIGPAIAHFLNCFVGKVLGASTKGSLSNAQSKTLKGHE-
A9RLF4_PHYPA      VVRAAKHVLKGVLR--ETLDQDVGGAIAHFFNCLVGSESANPVSEGKSVLSGKSLAKSV-
D0P366_PHYIT      IARVAKHILADVLNSNDSIRAAPGTAIVKLLNGILGSSSAAVSEK-ADETCSTDATTTT-
H3GWU1_PHYRM      ISRVAKHILADVLNSNDSIRAAPGSAIVKLLNGILGSTSAVADKKDVFETDDAAATTTA-
A0E685_PARTE      FAKTLKHIFRESMR--KAPQNQLSQVLCHLLNIIFSNSNPSVANNKQEDKKKKKKNKNK-
Q6BG47_PARTE      FAKTLKHIFRESMR--QAPQNQLSQILSHLLNVIFSNSNPSVNNNKQEEKKKKKKNKNK-
CLU_ASHGO         ISRSIKHVFRKHCHE-LPA-VIIPTFIAFALNLLFGYCYNKAPIAE-----FPTDG----
CLU_KLULA         IARSIKHIFRQQSKK-LSSPTLVPHLVAFFLNLLFGKSYNESVTVE-----NLDAL----
CLU_YEAST         VSRSLKHVLKDLSKD-VPV-FLVPSLVAYVFNMLVGINYNADPKPE-----PVDEF----
CLU_VANPO         FARTMKHILRKYTKD-LPV-VAIPSMIAFVLNLLFGQKYNEVPKPE-----SVDSF----
CLU_CANAL         ISRSVKHILRNLTKS-LPS-YLISTAIAHFHNCLFGGAINPTPKVDFIDEIYKNFC----
CLU_LODEL         VARASKHVLRQIMKE-TPL-ELSAKAVAHFHNCLLGGEINTSPEAE-IDPLEASFF----
CLU_DEBHA         VARSVKHLLRKISAD-IPV-YLIPAFVSHFHNCLLGSEINSSPECI-IDETLKGFY----
CLU_PICST         IARAAKHLLRKLSAD-VPV-NLFASFVAHFHNCLLGAAVNAQPAVE-IEELYRSFY----
CLU_PICGU         IARAVKHIFRSFAHT-LSS-YLLPYFVAHFHNCLLGSQVSSKPEIS-IDETLTAFA----
CLU_EMENI         VVRAFKHITNKYLRN-VPA-PFAASCVAHLLNCLLGADVNATP-RAEIDSSLREIY----
CLU_ASPFU         IARAFKHIANRYLRN-VPA-PFVASCVAHLLNCLLGADVNPKP-SAEIDASLREIY----
C0NW18_AJECG      VSRSFKHIANRYLRY-LPS-PFTASCVSHLLNCFLGAEVNSNP-RPEIDEELREIY----
CLU_SCLS1         VSRAFKHVAGNYLRY-LPI-PLTSSCIAHLLNCLLGTDLNATP-KPDVDEAMAALY----
CLU_PHANO         IARGFKHFANSKLRN-VSA-PFSAACVAHLLNCLLGADANAKP-VAECDEEIKRMIS---
C7YZ61_NECH7      VARAFKHLSAVYLRH-LPV-PIVPACTAHLLNCLLGHKFNSKP-VAEIDPSLRTLY----
CLU_NEUCR         IARAFKHVAAKYLRY-LPL-PLTSACLAHLLNCFLGFGLNSSP-VAEVDEELRKVF----
D5G8Q8_TUBMM      VSRACKHILNAMLRG-LPG-PLVPFCVSHFLNCLLGAEHNPNP-KVIPDEGLWKLY----
CLU_SCHPO         FIRSIKHVFRNFLAV-VPQ-VLRSHLLSHLLNNLFTVYGYVEPTKPLINENIANLF----
CLU_MALGO         VVRSAKHCLRTYLRA--LPLMEAAACIAHFANCFLGTEREPSPVPKMPEVIPASTASRS-
CLU_USTMA         VLRASKRVLRGLIRD--VEQVNVAACVSHFLNCLVGDK-----VNAHPKARPSVTPLSD-
CLU_YARLI         AVRSAKHLLRNEMAK---KGANPKYVVAHVMNLLLGSTSKVFDTPA--------------
CLU_CRYNJ         VFRAAKHILRELLYP--LQPETATDAVSHFLNCLLGSCLNPAPVASYTPIGINSNE----
E3K6B8_PUCGT      VFRACKHILNEMLLN--TSENEACHCISHFLNCLLGQSAAVPSSEQ--------------
                    :  *:                        * :.                         

G1LLQ3_AILME      ------------KRNRRRRNRPPG---------------------AADNTAWAVMTPQEL
G1PQX9_MYOLU      ------------KRNRRRRNRPPG---------------------AADNTAWAVMTPQEL
CLU_HUMAN         ------------KRNKRRKNRPPG---------------------AADNTAWAVMTPQEL
H0WHW6_OTOGA      ------------KRNKRRKNRPPG---------------------AADNTAWAVMTPQEL
CLU_MOUSE         ------------KRNKRRKNRPPG---------------------AADNTAWAVMTPQEL
CLU_XENTR         ------------KKSKKRRNRNLG---------------------NTDNTAWANTSPQEL
H3BFU0_LATCH      ------------KKKNKRKNKNLG---------------------SADNTTWASMTPQDL
CLU_DANRE         ------------KKSRKRRNRVPG---------------------GGDNTAWASLTPSEL
C3Z652_BRAFL      ------------KKNKKRSRHYPI---------------------ANHGEEWASLSPQDM
CLU_AEDAE         ---ALTKSGSSGGKQQRRQNKRSAGSKGGK---------PSFQCTQ-DNNEWQLLTPKSL
CLU_ANOGA         GQLADEFGPKAGGKKQNKQSKRGGGGGGGKGAAGG-GRKATFSVPSSDNCEWTALTSKTL
E9GHX8_DAPPU      ------------TKPSKRRNKRRG---------------KQNPSSNNESTDWIHVTPKTL
E0VTU9_PEDHC      ------------SKATKRRNKRKG---------------RNNPLLASDGTEWANLTPKNL
CLU_DROME         ------KRG-NGGKHNKHKSSKGGKGQQQQQTTGNQNGSSSGSSNSSSASDWTLMTPRSL
CLU_DROPS         ------KRGGNGGKHNKHKSSKGGKGQQQPAINQN-GGSTTSSSSSANAYDWTLVTPRSL
F6RE09_XENTR      ------------RRKGKKKVRPLE----------------------NGDSIWTSMSPADL
CLU_CAEBR         ------------SKKNGKKKNSG---------------------------VWATLTTASL
CLU_CAEEL         ------------NKKNGKKRVTS---------------------------AWSSLTTSAL
CLU_BRUMA         ------------RSSKRRKQISSG---------------------GKENDDWAQMSSHKL
CLU_DICDI         -------------------------------------------------SAINELTQGKL
D3B1P9_POLPP      ----------------------------------------------------LKLTSVQL
CLU_ARATH         ------------GADQPITK--KGQGRGKG-----------KASSKKSFSSYMMVDSNIL
D7T2X0_VITVI      ------------AGHHTSSRSSKAQAKWKA-----------GASARKNQSSYMNVSSDSL
C5XZV7_SORBI      ------------NSQIQKSS--KGHKLSNA-----------AAS-RKSLSAYSHLTSDGI
A9RLF4_PHYPA      ------------SGKSSSKE----------------------SAQPETKPSYLCITPTLV
D0P366_PHYIT      ------------SLDSKTLW---------------------------TRIDMEIKARFDY
H3GWU1_PHYRM      ------------SLDANTLW---------------------------SRIDKEIKARFDY
A0E685_PARTE      ------------STQNGDKP---------------------HFKCLIQANNYQYPTYQEV
Q6BG47_PARTE      ------------STQNGDKP---------------------HFRCLIQANNYQYPTYQEV
CLU_ASHGO         --------------------------------------------SDI-DFAFTKLTREQL
CLU_KLULA         --------------------------------------------FDINELEFAQYTREQL
CLU_YEAST         --------------------------------------------YPVNKCSFAKLTRSEL
CLU_VANPO         --------------------------------------------YDVDTYEFSKLTRDGL
CLU_CANAL         --------------------------------------------SKSDLESFIKLTHDDV
CLU_LODEL         --------------------------------------------SQSAI-SFAKLTHKDV
CLU_DEBHA         --------------------------------------------NATEL-EFTKLNSNKV
CLU_PICST         --------------------------------------------PESAF-NFTKLNSDQV
CLU_PICGU         --------------------------------------------DPDAL-RFITLDHQQV
CLU_EMENI         ---------------------------------------------PEGDFSFEKVTPEAL
CLU_ASPFU         ---------------------------------------------PEGDFSFEKVTPETL
C0NW18_AJECG      ---------------------------------------------PEGDFSFEKVTPTSL
CLU_SCLS1         ---------------------------------------------PDADLKFKEVSPESL
CLU_PHANO         --------------------------------------------TPEDDFSFEKLTPESL
C7YZ61_NECH7      ---------------------------------------------ADADLSFEKVTPESL
CLU_NEUCR         ---------------------------------------------SDADYSFEQVTPENL
D5G8Q8_TUBMM      ---------------------------------------------HDADFGFEKLTIEGL
CLU_SCHPO         ---------------------------------------------FQATQVIYSINSTSL
CLU_MALGO         ----------------------------------------------ESHKPWMSLTPAKL
CLU_USTMA         ----------------------------------------------VADAAWTKLTPETL
CLU_YARLI         --------------------------------------------GLLAVSDSVNLSVDEA
CLU_CRYNJ         -----------------------------------------------PEPAYVKLTPECL
E3K6B8_PUCGT      --------------------------------------------HLDSSSTWRTCTRHSL
                                                                              

G1LLQ3_AILME      WKNICQEAKNYFDFSLE---------------CETVDQAVETYGLQKITLLREISLKTGI
G1PQX9_MYOLU      WKNICQEAKNYFDFTLE---------------CESVDQAVETYGLQKITLLREISLKTGI
CLU_HUMAN         WKNICQEAKNYFDFDLE---------------CETVDQAVETYGLQKITLLREISLKTGI
H0WHW6_OTOGA      WKNICQEAKNYFDFSLE---------------CESVDQAVENYGLQKITLLREISLKTGI
CLU_MOUSE         WKNICHEAKNYFDFTLE---------------CDSVDQAVETYGLQKITLLREISLKTGI
CLU_XENTR         WKNICSEAKSYFDFNLE---------------CENVDQAMEVYNLQKISLLREICIKVGI
H3BFU0_LATCH      WKNIVSESKNYYDFPIE---------------CENVDQAVEKYNLQKTTLLREISIKTGI
CLU_DANRE         WKNITSEAHGYYNFSLQ---------------CESVDQAVEKYGLQKITLLREISIKTGI
C3Z652_BRAFL      WSNIRTEVKEYFDFNLT---------------CDSCDSAVETYGLQKTSLLREICIKCGV
CLU_AEDAE         WSQIEKELKSYWDYELL-----------PAGAHDSADPVVSHYRLQKISLLRAFCLKTGV
CLU_ANOGA         WAQIRQELKAYWDFELTVEQPAKEGKESKAAVIDSIEPLIGAFKLQKISLLRSFCLKTGV
E9GHX8_DAPPU      WAMLKTELSSYWDWELA---------------ADGVDAAVEKYMGQKVSLLRAFCQRTGI
E0VTU9_PEDHC      WNQIKGEIKSYFDWELN---------------ADTIDGCIETYSLQKISLLRSFCLKTGI
CLU_DROME         WQQIRKEAKVYWDWELD---------------CDSIETAVSKYGILRISLMRAFCLKVGI
CLU_DROPS         WQQIRKESKAYWDWDLD---------------CDSMDSAMSKFGIMRICLLRAFCLKVGI
F6RE09_XENTR      WKQICGKARDSYDFTLP---------------RDSVDQLVEKFNLQKVTLLREFCKKTGI
CLU_CAEBR         WKSICEESAYYYGYHID---------------TETLDKFLEQHEIQKTALFRRVVKIMGV
CLU_CAEEL         WNSIREDSASYYGYPIE---------------ADSLEKFTELHDIQKTALFRRICKVMGV
CLU_BRUMA         WERVKSDADFYYAFTID---------------EENIDAYLSTVGIQKTSFLRRFVQIVGI
CLU_DICDI         WSEIAQLVSSKFDFEIP---------------------THSVPMESRLIVLRCICLKMGI
D3B1P9_POLPP      WDQIYDLIKEKYDYEIK---------------------VRSVPLECRINVLRSICLKVGL
CLU_ARATH         WSDIQEFAKAKYEFELP---------------------ELSRTTAKKVSVLRNLCQKVGV
D7T2X0_VITVI      WLDILEFAKLKYEFELP---------------------EDARARVKKVSVIRNLCQKVGI
C5XZV7_SORBI      WLSIKEFAKSKYQFEVP---------------------DDARLSAKRVAVLRNLCQKVGI
A9RLF4_PHYPA      WSDIEECVKFKYQFDLP---------------------SDAKSRIRKISTVRNLCQKVGV
D0P366_PHYIT      KLTLWGPGRDESRGENA---------------------VYLVGRVSKSVMLRRLCQRLGL
H3GWU1_PHYRM      KLALWGPGRGEASADDA---------------------TFPVGRAHRIVLLRRLCQRLGL
A0E685_PARTE      WDQINKIAEARYQHKID-------------------SSILNKKGFHKLSCLRELCQQIGL
Q6BG47_PARTE      WDQINKIAEARYQHKID-------------------SSILNKKGFHKLSCLRELCQQIGL
CLU_ASHGO         LSEISEQAVLRFRYTLPDGWESRYEH-------------------TPFALLRPICNKFGI
CLU_KLULA         IEEVRVQAKLRFRYDLTSEWFDINEKR-----------------FSKYALIRAIAQKFGI
CLU_YEAST         LEAVSKQAFLRFRHQLPSNWIEAYME-------------------NPFTLIRSVSYKFGI
CLU_VANPO         IKEIQLVSELRFRYELAADFVDQFSD-------------------APFILIRSIARKSGI
CLU_CANAL         IKLVSKEVFSRFRYKLSSNWINT---------------------IQLPQLFREIAFKYGI
CLU_LODEL         VAQVAKEVGSRFRFTLEENWIEKL--------------------VHLPQLFREIALKFGI
CLU_DEBHA         IALVANEVLIRFRYELPTDWISTL--------------------IRPFQLFREIAIKYGI
CLU_PICST         IALITKEVFLRFRYALPEDWSSVL--------------------IHPIPLMREIALKFGI
CLU_PICGU         VSMVEEEVLLRFRFELPENWINA---------------------VSPITMMREISHKFGI
CLU_EMENI         RAEIEKQVTLRYRFNLESQWFNSL---------------------RHLQLLRDIAIKLGL
CLU_ASPFU         RAEVEKQVTVRYRYTLETEWFSSL---------------------RHLQLLRDIAIKLGL
C0NW18_AJECG      KGDIEKQIKIRFRFNLEPKWTSSL---------------------KRLQLLRDISIKLGL
CLU_SCLS1         KRDIEAQILRRFRYTLDSTWTAAI---------------------KHLQLLREVSLKLGI
CLU_PHANO         KKEVIAQIALRYRYDLGESWVESG---------------------KELQLLREVSLKLGL
C7YZ61_NECH7      REDIEEQILKRFRYELDEDWHNQF---------------------RPVQLLREVCLKIGI
CLU_NEUCR         REAMQQEILHRFRFTLEDGWYNQL---------------------QHVQMLREVSQKLGV
D5G8Q8_TUBMM      RASIEKEVSKRYRYSLQEDWISGI---------------------KHLQMLREIALKFGL
CLU_SCHPO         YSSIKKEASSRFRFNLTDDLLHSL---------------------NPICILRGTCLRLGI
CLU_MALGO         VEELRIDIRKRFRFELPMFFLETE--------------------LRKPQALRALCLKMGI
CLU_USTMA         REELKAEIRKRFRFELPASFFEQE--------------------LRRAQLLREVALRTGI
CLU_YARLI         KAAVAAIAKTRFGYDLDT----------------------SIFAKRPVQLLRELSGKLGL
CLU_CRYNJ         RAQIIKEVKSRFRWTLDESFLESG--------------------LRKKQLLRELASRVGF
E3K6B8_PUCGT      RSLITSSIRRRFRYALPNSYFTQR------------------LPRTKIQLLREICTRMGI
                     :                                              .*      *.

G1LLQ3_AILME      QILLKEYSFD--------------------------------------------------
G1PQX9_MYOLU      QILLKEYSFD--------------------------------------------------
CLU_HUMAN         QVLLKEYSFD--------------------------------------------------
H0WHW6_OTOGA      QILLKEYSFD--------------------------------------------------
CLU_MOUSE         QILLKEYSFD--------------------------------------------------
CLU_XENTR         QILLKEYNFD--------------------------------------------------
H3BFU0_LATCH      QILLKEYNFD--------------------------------------------------
CLU_DANRE         QILIKEYNFD--------------------------------------------------
C3Z652_BRAFL      QVLLREYNFD--------------------------------------------------
CLU_AEDAE         QILLREYNFE--------------------------------------------------
CLU_ANOGA         QILLQEYAFE--------------------------------------------------
E9GHX8_DAPPU      QILMREYSYE--------------------------------------------------
E0VTU9_PEDHC      QILLREYNFD--------------------------------------------------
CLU_DROME         QVLLREYNFE--------------------------------------------------
CLU_DROPS         QVLLREYNFD--------------------------------------------------
F6RE09_XENTR      QVLLREYNFE--------------------------------------------------
CLU_CAEBR         QIVARDYQLD--------------------------------------------------
CLU_CAEEL         QLVARDYQLDN-------------------------------------------------
CLU_BRUMA         QMLLRDYNLE--------------------------------------------------
CLU_DICDI         QILAKDYNFTT-------------------------------------------------
D3B1P9_POLPP      QINSKDYDFTK-------------------------------------------------
CLU_ARATH         SIAARKYDFSA-------------------------------------------------
D7T2X0_VITVI      TIAARKYDLDS-------------------------------------------------
C5XZV7_SORBI      TIAARKYDLDA-------------------------------------------------
A9RLF4_PHYPA      MLAARKYDFEV-------------------------------------------------
D0P366_PHYIT      RVVSRNYEFSS-------------------------------------------------
H3GWU1_PHYRM      RVVSRNYDFSS-------------------------------------------------
A0E685_PARTE      QLVARDYHDFQ-------------------------------------------------
Q6BG47_PARTE      QLVARDYHDFQ-------------------------------------------------
CLU_ASHGO         QLLNKEYFFTREQYQNWRQAQDKKIRSK------LVEPVS--------------------
CLU_KLULA         QLINKEYFFTKEQYEKWKQAQDKKLRSK------IVDPKQ--------------------
CLU_YEAST         QLLNKEYFFTREQLESYKQSLDKKIRNK------FVEPPT--------------------
CLU_VANPO         QFLNKDYFFTKDQFEEFKLSQDKKVRGK------LVAPAN--------------------
CLU_CANAL         QWKSQNYPFTKEEFELQNNQNKETPTQI------QIIETKS--------SKKSKKKTQTQ
CLU_LODEL         QWKSFDYTFTKQEFEHSQREQK-QESVV------DNVEKKH--------SKKSKKKSPAL
CLU_DEBHA         QWKSQEYAFTNEEFEKVKDKLAVETQVF------EAKTSKH--------KKNKKQQSQLI
CLU_PICST         QWKAQKYVFTAQEFAAYKEKFATTSKQV------ETAKSKK--------KGKK---IQVV
CLU_PICGU         QWKTQGYAFTAEGFKEFQQ--STENIIV------HKQKSSK--------KSKKR--SSPS
CLU_EMENI         QLAARDFVFTK-AQAEGLKVLPVANG---VNGTGQDEGSKK--------KKKNKNGDSGS
CLU_ASPFU         QLGARDYAFTK-AQLPA--KVPVANG---VNGASHDES--K--------KKKKKGGDSKS
C0NW18_AJECG      QIGAREFAFER-SQIKSQEHSPEPSS---THSSQDERG--K--------KKKKKGSNSAS
CLU_SCLS1         QLEMKPYHFTKQSQTEAAAAPPTTNGEATKDAAPTGKSTNG--------KKKKKNAREGS
CLU_PHANO         QLQTRQYGFTKETLTNGAAVPTPAAP-------QTNGSSTS--------SKKKKNKTITP
C7YZ61_NECH7      QVQAKDYAFTPEAAAATPAAPKAAQP---AANGQTNGESSK--------KKKKNKARDAS
CLU_NEUCR         QIQNKKYAFVATEGEAEPVAEKPVAP---APAPVEDG-NKK--------KKKKKAARETS
D5G8Q8_TUBMM      QMKIKNYEFGAPKPTSVAAKVNSEAS------PSTNGNSKG--------RSSSKKKSPVT
CLU_SCHPO         QISCKDYFSNKSDDKICEEHAVPNGS-------TKFTGKKG--------NKKKRNLGKSQ
CLU_MALGO         QLAVRDYEFEPEAKHAEGQAAAPSSNATKEKTTTSSR--------------SGLSKKGKR
CLU_USTMA         QLQLQEYVLEGKLADADGVVSDGCHGESQTNGNTTNKKNSKGKKKGGNEQQNGVKKSNVG
CLU_YARLI         QFLQKEYEFGA-------------------------------------------------
CLU_CRYNJ         QLAQREYVFSKDQEEEENKREENIKSKE---------------------------KKKGS
E3K6B8_PUCGT      QLCLRDYNLCS-------------------------------------------------
                        :                                                     

G1LLQ3_AILME      --------SRHKPAFTEEDVLNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
G1PQX9_MYOLU      --------SRHKPAFTEEDVLNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
CLU_HUMAN         --------SRHKPAFTEEDVLNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
H0WHW6_OTOGA      --------SRHKPAFTEEDVLNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
CLU_MOUSE         --------SRHKPAFTEEDVLNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
CLU_XENTR         --------SKHKPTFTEEDILNIFPVVKHVNPKA--TDAFHFFQSGQAKVQQG-------
H3BFU0_LATCH      --------SRHKPTFTEEDILNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
CLU_DANRE         --------SRHKPAFTEEDILNIFPVVKHVNPKA--SDAFHFFQSGQAKVQQG-------
C3Z652_BRAFL      --------SKHRATFTEEDIINIFPIVKHVNPKA--TDAYHFFQSGQVKIQQG-------
CLU_AEDAE         --------MKNKPTFGESDIVNVFPVVKHINPRA--SDAYNFYTTGQSKIQQG-------
CLU_ANOGA         --------QRNRPAFTDADIVNVFPVVKHINPRA--SDAYNFYTTGQTKIQQG-------
E9GHX8_DAPPU      --------VKNRNTFFEEDIINVFPVVKHINPRA--SDAFHFYTTGQQKIQQG-------
E0VTU9_PEDHC      --------SKNRLTFLEEDILNIFPVVKHINPRA--SDAYNFYTTGQTKIQQG-------
CLU_DROME         --------SKHKPTFGDDDIVNVFPIVKHISPRA--TDAYNFYTTGQAKIQQG-------
CLU_DROPS         --------SKHKPTFGDDDIVNVFPVVKHISPRA--SDAYNFYTTGQAKIQQG-------
F6RE09_XENTR      --------SRHKPALTEEDILNIFPVVKHIHIKA--KEANELVNKAQISIEQG-------
CLU_CAEBR         -----S-SAKKVAAFTEDDIINFYPIIKHHQPFT--VDAKKMIIRGQHAMSLG-------
CLU_CAEEL         -----S-TAKKTSIFVEDDIINFFPIIKHHEPFT--ADAKKMFIRGQQAMSIG-------
CLU_BRUMA         -------SGKKSQLFVEDDIQSLYCQAKHVDPKA--VDAHSLFLSGQTKVQQG-------
CLU_DICDI         -----D------APFSPEDIVDLFPIVKHVNPRS--TDGLDLLEAGKTFFNQR-------
D3B1P9_POLPP      -----D------EPFVIDDIVDMVCVVKHLGPRS--SDAIELLEGGKALLAKR-------
CLU_ARATH         -----N------TPFETSDILDLRPVIKHSVPVC--SEAKDLVEMGKVQLAEG-------
D7T2X0_VITVI      -----A------SPFQTADILNLQPVVKHSVPVC--SEAKDLVETGKVQLAEG-------
C5XZV7_SORBI      -----S------TPFEASDMLNLQPVVKHSVPTC--TDAKNLMEAGKVRMAEG-------
A9RLF4_PHYPA      -----P------APFKTSDILDLQSVVKHLSPVC--VDARDLLENGKQRLAQG-------
D0P366_PHYIT      -----S------SPISLDDISGVVPVVKTSLPAHPLTRAKQLLERGRMHLSQG-------
H3GWU1_PHYRM      -----SC----ATPISLDDITGVVPVVKHSLPAHPFAQAKQLLERGRQHLGQG-------
A0E685_PARTE      -----P-----------SDIVGIQPIIKFIEQVSE-DAKNNIEIGQKYMLEHQ-------
Q6BG47_PARTE      -----P-----------SDIVGIQPIIKFIEQVSE-DAKNNIEIGQKYMLEHQ-------
CLU_ASHGO         --------------TFSINDLSVRPIIKVATLTT--GVSDDCWAQGAYMIN----EEE--
CLU_KLULA         --------------TFSINDFSLRPVIKGAEFQS--LIAEELWIQGASLVNAVSVEEEEA
CLU_YEAST         --------------TFSLSDLTIIPRVKFSEYTS--SVSEEFWAQGASMIN----EDK--
CLU_VANPO         --------------TFTVSDLNMIPRIKDIDYSS--VLSDQKWAEGSMLLN----EDQ--
CLU_CANAL         VITEK--SIQRSSIFIADDIIGFIPIIKDSSYKS--TIVEEIYSNARSHLVQ---GNK--
CLU_LODEL         PIENKPTSFARSSIFIADDIVGFVPLVKDSSYKP--TLVDEIFANARSQLLS---GDK--
CLU_DEBHA         TKSV-----DRTTIFVTDDIVNFVPIVKDSTYRS--SLVDEIFETARAQIFK---GET--
CLU_PICST         TEVVS----ERDSIFVADDIVNFVPIVKDSSYKA--SLIDEIFQSARSHIAS---GEK--
CLU_PICGU         VEEVF----KRKTIFVADDIISFTPSVKSSSYKA--TLLDEIFEAARGKIAA---EEK--
CLU_EMENI         PAR-SAAAEKPIVTFTPDDIVNIVPLVKDASPRS--SLAEEALEAGRISLMQ---NQK--
CLU_ASPFU         PSR-AVVEEKPVVSIVPDDIVNVVPLVKDASPRS--SLAEEALEAGRISLMQ---NQK--
C0NW18_AJECG      PSR-VAASPRPVVTFVPEDILNIVPLVKDASPRS--ALAEEALEAGRISIMQ---NQK--
CLU_SCLS1         PASITSVNASSPVTFNPDDILNTVPVIKEASPRS--SLAEEALEAGRISLLQ---DQK--
CLU_PHANO         PRADSPAVSLPSQTFHADDILNIVPVIKEASPKS--LLAEEALEAGRMSVAQ---DQK--
C7YZ61_NECH7      PPE-AAASASF-HTFSVDDVVDLVPLIKDSAPRS--ALAEEALEAGRISILQ---NQK--
CLU_NEUCR         PVA-AAPVATVPHTFSPDDFVNVVPIVKDSTPRS--ALAEEALEAGRLSIYQ---NQK--
D5G8Q8_TUBMM      SIHEAPIPKRPSITFDPEDIMNVVPVVKDSSSKS--LLAEEALEAGRMSLIQ---DHK--
CLU_SCHPO         NTTNRQVESEQINIFRPKDILNLMPVIKTCIPYS--GLAQESLEACKACLLQ---GNK--
CLU_MALGO         AFPPPPSKPLRTTTFVPEDVVCVCPLVKTSTPKS--SLSEDAFEAGRISFVRG-------
CLU_USTMA         AAAAKPTKAARATSFEPEDVLNLVPMVKDSTPKS--TLAEEAFEAGRISISRG-------
CLU_YARLI         ------------EPFAVADVVNILPVFKTTTFRS--KLVEEALEAARNSVNTD-------
CLU_CRYNJ         KAGAKGETVKRTTTFEGEDVLTLVPVIKSTAPSV--SVAEEILEAGRNTINRG-------
E3K6B8_PUCGT      ---------PLPEAITNGHAQVVNEQVQKNAETVQATEEPVPATNGHTNCTDDE------
                                             :                                

G1LLQ3_AILME      -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
G1PQX9_MYOLU      -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
CLU_HUMAN         -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
H0WHW6_OTOGA      -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
CLU_MOUSE         -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
CLU_XENTR         -----------------------------------YLKEGCELINEALNLFNNVYGAMHV
H3BFU0_LATCH      -----------------------------------FLKDGCELISEALNLFNNVYGAMHV
CLU_DANRE         -----------------------------------FLKEGCELINEALNLFNNVYGAMHV
C3Z652_BRAFL      -----------------------------------FLKEGFELINEALNLFNNVYGAMHP
CLU_AEDAE         -----------------------------------YFKDGYDLISEALNLLNNVYGAMHP
CLU_ANOGA         -----------------------------------YLQDGYGLISEALNLLNNVYGAMHP
E9GHX8_DAPPU      -----------------------------------FLKEGYELISEALNLLNNVYGAMHP
E0VTU9_PEDHC      -----------------------------------YLKEGYELISEALNLLNNVYGAMHP
CLU_DROME         -----------------------------------LFKEGYELISGALNLLNNVFGALHQ
CLU_DROPS         -----------------------------------LFKEGYELISEALNLLNNVFGAMHQ
F6RE09_XENTR      -----------------------------------CLKQAAILLNEALVHFNSVYGAVHP
CLU_CAEBR         -----------------------------------ASREAYECISEAINIMTAVYGVMHP
CLU_CAEEL         -----------------------------------ASREAYECIGESLNLMTLVYGVMHP
CLU_BRUMA         -----------------------------------QLRAGFDLVLESLNLMNSVYGAMHS
CLU_DICDI         -----------------------------------KYELATELLGEALAIYHQVHGPIHP
D3B1P9_POLPP      -----------------------------------EFEKASNYLVESLAFCQQVHGPIHT
CLU_ARATH         -----------------------------------MLSESYTFFSEAFSILQQVTGPMHR
D7T2X0_VITVI      -----------------------------------MLTEAYTLFSEAFSILQQVTGPMHR
C5XZV7_SORBI      -----------------------------------TLNEAYALFSEAFSLLQQITGPMHK
A9RLF4_PHYPA      -----------------------------------KLNEAYEAFSEAFTILQQVCGPMHR
D0P366_PHYIT      -----------------------------------ALSSAYEFLQEASSLLFQVCGAAHE
H3GWU1_PHYRM      -----------------------------------ALSSAYEFLQEASSLLFQVCGAAHE
A0E685_PARTE      -----------------------------------NLHQALESYLTASQIILNLHGQMHK
Q6BG47_PARTE      -----------------------------------NLHQALESYLTASQIILNLHGQMHK
CLU_ASHGO         -----------------------------------KQATALALFSQSIAFREETSGYVHP
CLU_KLULA         EKKKEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFREDIFGLVHP
CLU_YEAST         -------------------------------------QSALTLLAQSITVLEDVNNILHP
CLU_VANPO         -------------------------------------NAALTLFAQAIAIKEEVNGVLHK
CLU_CANAL         -------------------------------------EMGMALFNELLAINESIYGKVNP
CLU_LODEL         -------------------------------------DLGMAMLAELVTIYEAIYGKVNS
CLU_DEBHA         -------------------------------------ETGINLLNNLLSVYEQIYGRVHP
CLU_PICST         -------------------------------------DVGLSIFNELVAIQEQIYGRVNS
CLU_PICGU         -------------------------------------DSGVTLLNELVSIYEQIYGVVHP
CLU_EMENI         -------------------------------------QLGQELILESLSLHEQIYGILHP
CLU_ASPFU         -------------------------------------QLGQELILESLSLHEQIYGILHP
C0NW18_AJECG      -------------------------------------EIGQELILESLSLHEQIYGILHP
CLU_SCLS1         -------------------------------------KLGQELLLESLSLHEQIYGILHP
CLU_PHANO         -------------------------------------ELGQELLLESLQLHEQIYGVLHP
C7YZ61_NECH7      -------------------------------------KLGQELLLESLSLHEQIYGILHP
CLU_NEUCR         -------------------------------------KLGEDLLLESLSLHEQIYGLVHP
D5G8Q8_TUBMM      -------------------------------------EMGQELLLESLSLHEQIYGVLHP
CLU_SCHPO         -------------------------------------ELCYNLLNESLSLHEQIYGVLHT
CLU_MALGO         -----------------------------------EREIGTELMLESIGFYEQVYGLVHP
CLU_USTMA         -----------------------------------DRELGLELLLEGVSFHEQVYGLVHP
CLU_YARLI         ------------------------------------KDVALQLLRESIPLAEQVYGSVNP
CLU_CRYNJ         -----------------------------------KIEFGLDFMLEAIQLYESIHSVIHP
E3K6B8_PUCGT      ----------------------------------NSTEGATPNESAAPSAPKQLKKKKKS
                                                                            : 

G1LLQ3_AILME      EICACLRLLARLHYIMGDY-----------------------------------------
G1PQX9_MYOLU      EICACLRLLARLHYIMGDY-----------------------------------------
CLU_HUMAN         ETCACLRLLARLHYIMGDY-----------------------------------------
H0WHW6_OTOGA      EICACLRLLARLHYIMGDY-----------------------------------------
CLU_MOUSE         EICACLRLLARLHYIMGDY-----------------------------------------
CLU_XENTR         EICACLRLLARLNYIMGDY-----------------------------------------
H3BFU0_LATCH      EICACLRLLARLNYIMGEY-----------------------------------------
CLU_DANRE         EICACLRLLARLNYIMGDH-----------------------------------------
C3Z652_BRAFL      EIAACLRTLARLNYILGDP-----------------------------------------
CLU_AEDAE         ENAQCLRMLARLSYIMGDP-----------------------------------------
CLU_ANOGA         ENAQCLRMLARLSYIMGDP-----------------------------------------
E9GHX8_DAPPU      EIAQCLRMLARLNYIMGEH-----------------------------------------
E0VTU9_PEDHC      EIAQCLRMLARLNYIMGEH-----------------------------------------
CLU_DROME         ENGSCLRMLARLSYLLGDA-----------------------------------------
CLU_DROPS         ENGSCLRMLARLSYLLGDA-----------------------------------------
F6RE09_XENTR      EIAVCLRVLARVKFLLGDI-----------------------------------------
CLU_CAEBR         DMPQCLRALARLGHVLGET-----------------------------------------
CLU_CAEEL         DMPQCLRALARLSHVLGET-----------------------------------------
CLU_BRUMA         DMAQCMRLLARLSYILGDP-----------------------------------------
CLU_DICDI         DAGACFTHLAMLAYQNEQY-----------------------------------------
D3B1P9_POLPP      DTANCFSSLAMVAFYTKEY-----------------------------------------
CLU_ARATH         EVANCCRYLAMVLYHAGDM-----------------------------------------
D7T2X0_VITVI      EVANCCRYLAMVLYHAGDM-----------------------------------------
C5XZV7_SORBI      DAANCCRYLAMVLYHAGDT-----------------------------------------
A9RLF4_PHYPA      EVANCCRYLAMVLYHAGDM-----------------------------------------
D0P366_PHYIT      DAALCSSSLATVLYHAGDV-----------------------------------------
H3GWU1_PHYRM      DAALCSSSLATVLYHAGDV-----------------------------------------
A0E685_PARTE      ELANCYSKISAVYLRKQEY-----------------------------------------
Q6BG47_PARTE      ELANCYSKISAVYLRKQEY-----------------------------------------
CLU_ASHGO         TVAESYLALSTIHSKLEKK-----------------------------------------
CLU_KLULA         SLVSSYLLLSNMYSRLGQY-----------------------------------------
CLU_YEAST         AVAEKYLSLSAIYNKLALY-----------------------------------------
CLU_VANPO         DVAEKYLTLSTVYSKLGLT-----------------------------------------
CLU_CANAL         ETAKFYNLVAQVYQELGYD-----------------------------------------
CLU_LODEL         QTAKFYSLVAKVYQELGFD-----------------------------------------
CLU_DEBHA         ETSKFYGLLSQYYAELGLK-----------------------------------------
CLU_PICST         ETARFYTLLAQVYSELGYQ-----------------------------------------
CLU_PICGU         ETSNFYSVLSQFYSDLGFT-----------------------------------------
CLU_EMENI         EVAKLYHQLSMLYYQTDEK-----------------------------------------
CLU_ASPFU         EVAKLYHQLSMLYYQTDEK-----------------------------------------
C0NW18_AJECG      EVAKLYHQLSMLYYQTDEK-----------------------------------------
CLU_SCLS1         EVARVYNSLSMLYYQLDEK-----------------------------------------
CLU_PHANO         EVARAYHTLSNLLFNLDDK-----------------------------------------
C7YZ61_NECH7      EVARVYNSLSMLYYQLDDK-----------------------------------------
CLU_NEUCR         EVAQMYHTLSQLYYQLGQK-----------------------------------------
D5G8Q8_TUBMM      EVARVYNTLSMLYYQLEEK-----------------------------------------
CLU_SCHPO         EVARAYCQLAMIYHQLEKK-----------------------------------------
CLU_MALGO         ETGKCYSKFASFLHHYAAEFAIKAARKASADSNQGSSSDGDRIGTNDAGSADGSKTEHDD
CLU_USTMA         EVARCYALFATIVHHLAGVAAMERAESINQAKSE--------------------NKEITE
CLU_YARLI         ELTKVYNTASYLAYEMDEA-----------------------------------------
CLU_CRYNJ         EVASVYNSYAQAIHQIARLKIQQIAAQENPDPEQ--------------------------
E3K6B8_PUCGT      KSKKGTASSSGSADGQTFS-----------------------------------------
                           :                                                  

G1LLQ3_AILME      ------------AEALSNQQKAVLMSERVMGIEHPNTIQEY------------VS-SRYC
G1PQX9_MYOLU      ------------AEALSNQQKAVLMSERVMGIEHPNTIQEY------------MHLALYC
CLU_HUMAN         ------------AEALSNQQKAVLMSERVMGTEHPNTIQEY------------MHLALYC
H0WHW6_OTOGA      ------------AEALSNQQKAVLMSERVMGIEHPNTIQEY------------MHLALYC
CLU_MOUSE         ------------AEALSNQQKAVLMSERVMGIEHPNTIQEY------------MHLALYC
CLU_XENTR         ------------SEALSNQQKAVLMSERIQGVEHPSTVQEY------------MHLALYC
H3BFU0_LATCH      ------------TEALSNQQKAVLMSERVLGIEHPNTIQEY------------MHLALYC
CLU_DANRE         ------------PEALSNQQKAVLMSERVLGIEHPNTIQEY------------MHLALYC
C3Z652_BRAFL      ------------VEALNNQQKAVLMSERVLGIDHPNTITEY------------VHLALYC
CLU_AEDAE         ------------QEALAIQQRAVLMSERVNGIDHPYTIAEY------------APLALYC
CLU_ANOGA         ------------QEALAIQQRAVLMSERVNGVDHPYTISEY------------GHLALYC
E9GHX8_DAPPU      ------------VEALGYQQKAVFMSERVNGIDHPYTITEY------------THLALYC
E0VTU9_PEDHC      ------------VEAMAYQQKAVLMSERVNGIDHPYTITEY------------THLALYC
CLU_DROME         ------------QDALAIQQRAVIMSERVNGMDHPSTILEY------------THLSLYS
CLU_DROPS         ------------QDALAIQQRAVIMSERVNGIDNPSTILEY------------THLSLYS
F6RE09_XENTR      ------------AEALDNQQKAVIMTERTMGYDHTTTIQDY------------VLLSLYC
CLU_CAEBR         ------------PDALNHQHKATVMSERLIGLDSGNTIIEYNSLIHYLLICFQINLAHFA
CLU_CAEEL         ------------GDALNNQHKAAVMSERLIGLDAGNTIIEY------------INLAHFA
CLU_BRUMA         ------------SEALSQQHKATLMSERCNGLDSANTIIEY------------LNLAHFS
CLU_DICDI         ------------DLAIEYQKNALVITEKTAGLDHHETVQAY------------TTLAVFC
D3B1P9_POLPP      ------------NDAIEYQKNALIITEKTLGVDHHDTIHSY------------TNLALFC
CLU_ARATH         ------------AGAIMQQHKELIINERCLGLDHPDTAHSY------------GNMALFY
D7T2X0_VITVI      ------------AGAIMQQHKELIINERCLGLDHPDTAHSY------------GNMALFY
C5XZV7_SORBI      ------------AGAIVQQHRELIINERCLGLDHPDTAHSY------------GNMALFY
A9RLF4_PHYPA      ------------AGAIMQQHKELIINERCLGGDHPDTAHSY------------GNMALFY
D0P366_PHYIT      ------------AGAIAQQQRALALYTQLRGIDYHDTAYAH------------ANLALFL
H3GWU1_PHYRM      ------------VGAIAQQQRALALYTQLQGIDYHDTAFAH------------ANLSLFL
A0E685_PARTE      ------------DAAIHFQKQAIQIYTTIYGYDHPLTVQAI------------TALSLYY
Q6BG47_PARTE      ------------DAAIHFQKQAIQIYTAIYGYDHPLTIQAI------------TALSLYY
CLU_ASHGO         ------------SEAVALCRKACAIYERVCGFDSFEMIRSL------------NNLAMLE
CLU_KLULA         ------------SQAVTFCNKAALLSERCYGVDSFETVRIL------------SNLAYLE
CLU_YEAST         ------------PEAIAFCRKACTIYERVSGIDSFEMMRAL------------TNLAILE
CLU_VANPO         ------------PEAVAFCRKSCAIYERVSGIDSFEMLRSL------------SNLALLE
CLU_CANAL         ------------IEAALIGRKAVILCERSCGFDSYDTITAY------------MNSAYYE
CLU_LODEL         ------------KEAAIMGRKAVVLSERSCGFDNHDTIAAY------------MNSAYFE
CLU_DEBHA         ------------SEACNIARKACILAERTTGFDSYESITAY------------INSAFFE
CLU_PICST         ------------SQAAFVSRKAIILSERTTGFDSYDTITAY------------LNSGFYE
CLU_PICGU         ------------TEASEVARKACVLFERTAGFDSFETISSY------------INSAYFE
CLU_EMENI         ------------DAAVELARKAVIVTERTLGVDSADTILSY------------LNLSLFE
CLU_ASPFU         ------------EAAVELARKAVIVTERTLGVDSADTILAY------------LNLSLFE
C0NW18_AJECG      ------------EAAVELARKAVIVTERTMGVDSADTILSY------------LNLSLFE
CLU_SCLS1         ------------EAAMELARKAVIVSERTLGVDNAETLLNY------------LNLGLIA
CLU_PHANO         ------------ASALELAHKAVIVSERTLGVDHADTVLAY------------LNLGLFE
C7YZ61_NECH7      ------------EAAVELARKAIIVAERTVGVDSAETLLNY------------LNLSLFL
CLU_NEUCR         ------------DAAVELSRKAAIVAERTVGLDSSETVLNY------------LNLSLFL
D5G8Q8_TUBMM      ------------TAAVELARKAVIVSERTLGIDSAETLLNY------------LNLGLFE
CLU_SCHPO         ------------EEAVELARKAVIVCERFLGFDSSETSLAY------------MNLSLYE
CLU_MALGO         QLPEVVKEVFTLENALRFQRQAVTVSERTLGLDHPETMTQY------------MNLAMME
CLU_USTMA         ADLPVVNEHLSMANAVRYQRQAVTVSERTLGLDHPETLNQY------------MNLAVLE
CLU_YARLI         ------------LLAADLGRRACIMSERCSGIDSVDAILNY------------LNLSLFE
CLU_CRYNJ         ------PLGVDISGALRFQRQAVAIAERTLGVYHHETAGYY------------FQLAMLE
E3K6B8_PUCGT      --------------PSDILNILPIVRDSTCRSSVADELYAE---------------GRKA
                                .    .    :                               .   

G1LLQ3_AILME      FASSQLSTALSLLYRARYLTLLVFGE---DHPEMALLDNNIGLVLHGVMEYDLSLRFLEN
G1PQX9_MYOLU      FASSQLSTALSLLYRARYLTLLVFGE---DHPEMALLDNNIGLVLHGVMEYDLSLRFLEN
CLU_HUMAN         FASSQLSTALSLLYRARYLMLLVFGE---DHPEMALLDNNIGLVLHGVMEYDLSLRFLEN
H0WHW6_OTOGA      FASSQLSTALSLLYRARYLMLLVFGE---DHPEMALLDNNIGLVLHGVMEYDLSLRFLEN
CLU_MOUSE         FASSQLSTALSLLYRARYLMLLVFGE---DHPEMALLDNNIGLVLHGVMEYDLSLRFLEN
CLU_XENTR         FANNQVSTSLNLLYRARYLMPLVYGE---GHPEMALLDSNIGLVLHGVMEYDLSLRFLEN
H3BFU0_LATCH      FANGQLSTALKLLYRARYLMLLVFGE---DHPEMALLDSNIGLVLHGVMEYDLSLRFLEN
CLU_DANRE         FANGQLSTALKLLYRARYLMLVVCGE---DHPEMALLDSNIGLVLHGVMEYDLSLRFLEN
C3Z652_BRAFL      FANQQVSAALRLMYRARYLALVVFGE---DHPEMALYDSNIGLILHGVGEIDLSLRFLEN
CLU_AEDAE         FANSQISTALKLLYRARYLATIVCGE---NHPDIALLDSNISLILHAVGEYELSLRFLEH
CLU_ANOGA         FANSQITTALKLLYRARYLATIVCGE---NHPDIALMDSNISLILHAVGEYELSLRFLEH
E9GHX8_DAPPU      FANNQISTALKLLYRARYLTLIVIGE---NHPEVALLDSNIGLILHAVGEYDLSLRFLEK
E0VTU9_PEDHC      FANTQVSTALKLLYRARYLALLVYGE---NHPEIALLDSNISLILHAVGEYDLSLRFLEK
CLU_DROME         FANGHVGMSLKLLYRARYLMVLICGE---DHPEVALIDSNISLILHALGEYELSLRFIEH
CLU_DROPS         FANGHVGMSLKLLYRARYLLVLTCGE---DHPEVALIDSNISLILHALGEYELSLRFIEH
F6RE09_XENTR      FASGQLPVALKLLYRARYLLLLVTGE---DHPSMATLDSNIGVVLQAVLECDLSLRFLEK
CLU_CAEBR         FGALLIPGSLRPLYRARYLMNLVFGE---KHPIMAQIDANIGTILFTIQEYDTALKYLQS
CLU_CAEEL         FGALLIPGSLRPLYRARYLMNLVFGE---KHPVMAQIDANIGLILFTVQEFDTALKYLQS
CLU_BRUMA         FANLHIAAALKLLYRARYLLLLIHGE---NHPFMAEIDGNIGVILYAVQEFDDALKFLQN
CLU_DICDI         QRSGRYNESIGYMKHVLYLTDLLGGE---YNPERASIYTAIAAILEDTERFDLALEFLKQ
D3B1P9_POLPP      QRADRFTEAMGYLKHVIYLNDLLGSD---YNPERSSIYTSAAIILQDLKEFDCAIDYLKK
CLU_ARATH         HGLNQTELALQNMGRALLLLGLSSGP---DHPDVAATFINVAMMYQDMGKMDTALRYLQE
D7T2X0_VITVI      HGLNQTELALRHMSRALLLLSLSSGP---DHPDVAATFINVAMMYQDIGKMNTALRYLQE
C5XZV7_SORBI      HGLNQTELALRHMSRTLLLLSLASGP---DHPDVAATLINVAMMYQDASNMNTALRYLQE
A9RLF4_PHYPA      HGLNQTELALRHMARTLLLLNVSCGS---DHPDVAATFINIAMMYQDIGKMEVALRYLQE
D0P366_PHYIT      HANAQTDLAVPHIRRAIYLLEFCCGP---HFPEISSLYFKMGIMCQDVGQITLALMCHRE
H3GWU1_PHYRM      HANAQTDLAVPHIRRAIYLLEFCCGP---HFPEISSLYFKMGMMCQDVGQITLALMCHRE
A0E685_PARTE      FSTKNYKEAFNHMLHTLYLANLIGGE---GQ-EVFNQYTNLSLLYSESGQHQSALNCLFE
Q6BG47_PARTE      FSTKSYKEAFNHMLHTLYLANLIGGE---GQ-EVFNQYTNLSLLYSESGQHQSALNCLFE
CLU_ASHGO         MANDSPYNAALCLKTIMSILSVVIPV---NHPATINSYSMLHSMCSSLQNSSAMIKVLNK
CLU_KLULA         YGQGSIYNSALVLKKVHELLKLLAPF---VHSGRVNVFNLLFQIAASTEDKKVQIKILNK
CLU_YEAST         FSNESPYNATVVYNRLAEILKVYELP-KIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQ
CLU_VANPO         FANESPYNSALVFKRIVETLESLKITEKIHHPAALNAFNQLEQMSLGVENTKLTVELCKQ
CLU_CANAL         SSNEQYLNSLKLYKEAMNTWSLVYGK---DHPTLINTLTNLSESLLKIKAYDSALELLQE
CLU_LODEL         LANSQIANSLKLYLRAMQLWTSTYGK---DHPALVNLLTNVADSLYYAKDYESALKLFNA
CLU_DEBHA         STNDDYINALNLYNKAINDWTLVYGD---GHPSSVNTYANLAELLSEHKLFQQANKLFEK
CLU_PICST         AANFDLINSVSLYNQAVATWTSVYGK---GHPTLINTLTNIAENYSRASQNESAIKLLES
CLU_PICGU         AANSSYVNAFKLYEKALGDWDFVFGS---HHPSSVTTLTNLAEILAQLKITDKANRLFSA
CLU_EMENI         HASGNTKVALAYIKHAMDLWKIIFGS---NHPDSITTMNNAAVMLQHLKQYSDSRKWFEA
CLU_ASPFU         HASGNTKTALVYIKHAMDLWKIIYGS---NHPDSITTMNNAAVMLQHLKQYSDSRKWFEA
C0NW18_AJECG      HASGNTHTALIYIRHALELWKIIYGS---HHPDSITTMNNAAVMLQHLKKYPDSRKWFEA
CLU_SCLS1         HASGETKLALTYIKHALDLWKVVYGP---NHPDSITTINNAAVMLQHLKEYHDSRTWFEA
CLU_PHANO         HASGNTKAALVYVRHALELWKIIYGA---DHPDSITTLNNAAVMLQAMKQYHESRIWFEA
C7YZ61_NECH7      HQVGDSKGALVYSKHALKMWKVIYGP---GHPDSITTINNAAVMLQHLKAYHESRLWFEE
CLU_NEUCR         HQRGDSKEALLYARHALDLWKVIYGP---DHPDTITTMNNYAVMLQSIKAYHESRRWFEE
D5G8Q8_TUBMM      HANGNTKTALAYIKHALGFWRIIYGQ---AHPDSVTTMNNVAVMLQALKHYTDSRKWFEA
CLU_SCHPO         FSQKNEMQAVMHMQHALKLWYLVFGP---DHPNTINSFTNLSLMLHGSEKFIQSQKCLQI
CLU_MALGO         QSSANLDDALRYQERVMQLWQLLYGR---DHPDVVHTLSSIALMLQMRQDYEPSLRAYEA
CLU_USTMA         RSAGNTRESLLCQRRVLELWSLLHGQ---HHPDCINALSNVALTLQNARLFEASLRVYRS
CLU_YARLI         HAIGNYVGALHMIKHAVSVWVTVCGT--HLHPDIITSLSNAITMLTTLKRWNESRQWLEK
CLU_CRYNJ         NLEGNAQQSLRYFRHLLTLWDVIYGP---GHPEISTILSNAGIVLQSMNDLSLSLSLQKQ
E3K6B8_PUCGT      FSNGDIALGQELCTDALTTYEQVFGS---VHPEMCRHWHSLAILYHQL-----SQRTLVE
                          .                                                   

G1LLQ3_AILME      ALAVSTKYHGPKSLKVALSH--------HLVARVYESKAEFRSALQHEKEGYTIYKTQLG
G1PQX9_MYOLU      ALAVSTKYHGPKSLKVALSH--------HLVARVYESKAEFRSALQHEKDGYTIYKTQLG
CLU_HUMAN         ALAVSTKYHGPKALKVALSH--------HLVARVYESKAEFRSALQHEKEGYTIYKTQLG
H0WHW6_OTOGA      ALAVSTKYHGPKALKVALSH--------HLVARVYESKAEFRSALQHEKEGYTIYKTQLG
CLU_MOUSE         ALAVTTKYHGPKALKVALSH--------HLVARVYESKAEFRSALQHEKEGYTIYKTQLG
CLU_XENTR         ALTINSKYHGVKSLKVALSH--------HLVARVYETKGEFRSALQHEKDGYTIYKNQLG
H3BFU0_LATCH      ALTINSKYHGAKSLKVALSH--------HLVALVYESKAEFRSALQHEKDGYTSYKNQLG
CLU_DANRE         ALAINTKYHGPRSLKVALSH--------HLVARVYESKAEFRSALQHEKEGYTIYKNQVG
C3Z652_BRAFL      ALELNKKYHGQRSLKVALNH--------HLLARAFSCKGDFRAALMHERETYTIYKSQLG
CLU_AEDAE         ALALNIKYYGEKSLKVAVSY--------HLVARTQSCMGDFRSALNNEKETYAIYKQQLG
CLU_ANOGA         ALALNIRYYGEKSLKVAVSY--------HLVARTQSCMGDFRSALVNEKETYAIYKQQLG
E9GHX8_DAPPU      ALALNKKYYGSRSLKVAVSY--------HLVARTQSCMGDFRSALQNEKETYTIYKIQLG
E0VTU9_PEDHC      ALALNVKYFGSKSLKVAVSY--------HLVARTQSCMGDFRSALNNEKETYAIYKQALG
CLU_DROME         ALKLNLKYFGDKDMHVALSY--------HLMARTQSCMGDFRSALNNEKETYSFYKSQLG
CLU_DROPS         ALKLNLKYFGNKAMHVAVSY--------HLMARTQSCMGDFRSALNNEKETYSIYKSQLG
F6RE09_XENTR      ALETNKKYFGNKSLDVALSWPSIV----HLVCTVIHREGKSENKTEHNILYIVPKHFQLG
CLU_CAEBR         ADAISKAIGEPRKLKTGLIS--------NLIARTHAARGDFRAALVAEKETSSIYTELYG
CLU_CAEEL         ADAITKTIGEPRKLKTGLIS--------NLIARTHAARGDFRAALVAEKETFAIYSELYG
CLU_BRUMA         ALKLHQIYLEPQALKTALIY--------HLLARTYSCRGDFRTALQMEKETFTIYSKTFG
CLU_DICDI         TLKHQEFLFTPDHLMCSTTY--------HKMAIVCARATNFDDSIIHQKKSTDILEKELG
D3B1P9_POLPP      CIENHKHLFGEDHLVSSSTL--------QSIAQIYAEMKNFTEAEKYQKHSTAILTRYLG
CLU_ARATH         ALKKNERLLGPEHIQTAVCY--------HALAIAFNCMGAFKLSHQHEKKTYDILVKQLG
D7T2X0_VITVI      ALKKNERLLGEEHIQTAVCY--------HALAIAFNCMGAFKLSHQHEKKTYEILVKQLG
C5XZV7_SORBI      ALMKNERLLGPDHVQTAVCY--------HALAIAFSCMSLYKLSIQHEKKTYDILVKQLG
A9RLF4_PHYPA      ALKRNKSLLGEEHIQTAVCY--------HALAIAFNCMGAYKLSLQHERSTYNILVKQLG
D0P366_PHYIT      SLRRGE----FDRNQAANVL--------HQMALACGLAGGYREALMYEKKVYSLMKEAFG
H3GWU1_PHYRM      SLRRGE----LDRNQAANVL--------HQMAMACGLAGGFREALTYEKKVYSLFKEAYG
A0E685_PARTE      GLEKCESLFKSFQGQETQQYKLRVSGYYSAIALEHGEIGDFQKAVEFQERASDLLKRTLK
Q6BG47_PARTE      GLEKCESLFKSFSGTETQQYKLRISGYYSAIALEHGEIGDFQKAVEFQERASDLLKRTLK
CLU_ASHGO         LGDIIVEIDG-HKSLPYAVNE-------SRLANLYASVGEYKRSLACIESCYELFSKELG
CLU_KLULA         LSELLLKITGSEETLPYGQNE-------SRIANLYTSLDDMSHALSHIEKAKSIFSKELG
CLU_YEAST         LSSYVVELEG-KDSLAYGYTE-------SRLGNLFAALKDFHRALEHITVTQGIFTKQLG
CLU_VANPO         FRSLIVSLDG-NDTLAYATLE-------SRIGNLYASINDFHNAMEHISKTPRIFTRELG
CLU_CANAL         ALEITKKLNG-EISEITGFIY-------YRIANIVVTLNKFKESKELFDKAYDIFMKLLG
CLU_LODEL         ALEACSHLNG-QASEIAGLFH-------FKIANVLVSQQKIEKSKDSFVAANEIFQKLLG
CLU_DEBHA         AISISTKLNG-EESQICGMLR-------YRYGGTLLGGGDFKSALDQFKSANDIFTKFIG
CLU_PICST         ALEFSKLANG-EVSEITGIVT-------FRLANCLINTSKFDQSLELYRACEATFEKVLG
CLU_PICGU         ALELSEKING-EDSQITAMIH-------YRFAGTLVNENRFDEALGHFEKAHTTFSRHID
CLU_EMENI         SLSVCESLFG-KQSINTATIL-------FQLAQALALDQDSKAAVGKMRDAYNIFLSQLG
CLU_ASPFU         SLAVCESLFG-KQSINTATIL-------FQLAQALALDQDSKGAVGKMRDAYNIFLNQLG
C0NW18_AJECG      SLTVCEGLFG-RQSINTATIL-------FQLAQALALDQDSKAAVNRMRDAYNIFLNELG
CLU_SCLS1         SLKICEEVYG-KHSINAATLL-------FQLAQALALDQDSKSAVNRMRESYNIFLTELG
CLU_PHANO         SLAICEDVSG-KTSINTATLL-------FQTAQALALDKDMRGAVNRMRESYNIFKDVLG
C7YZ61_NECH7      SLRVCESVFG-KQSVNSATLL-------FQLAQALALDRDSKGAVNRMRESYNVFLAELG
CLU_NEUCR         SLRVCNKVFG-EQTVHSATLL-------FQLAQALALDQDAKKAVDRMRESYNIFKTLLG
D5G8Q8_TUBMM      SLAVCESIFG-KQSPHTATLY-------FQLAQALALDHDSKGAVNRMRDAYNVFHAKLG
CLU_SCHPO         AVDLSDKIFG-KTT-PTASLY-------LQLAQLMVLNKDSRSALHAVRVAYDILKETLG
CLU_MALGO         SHDLAVRLFGPNSIYTGNMA--------HELSQALILSGDLKAAIQVEKEAWRIFQERLG
CLU_USTMA         AHELALTLFGADSIHTANLA--------HELSQAYTLAGDLKTALAVEKEAWRVFEERLG
CLU_YARLI         TIVITESVANEKAQAPLRFQ----------LAQTMCHEQQYKEATDELRRALKLFNAHYG
CLU_CRYNJ         AYESTLACFGPNHIQTGQSL--------HQLVQGHFLAGDMASALETAKQALEIFKARLG
E3K6B8_PUCGT      LSEYNDRLLELSAIYHSASNE--------EDREKVKERIESYQRDREPEALKNEIDTYIQ
                                                                              

G1LLQ3_AILME      EDHEKTKESSEYLKCLTQQAVALQRTMNEIYRSGSSANI---------------------
G1PQX9_MYOLU      EDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANI---------------------
CLU_HUMAN         EDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANI---------------------
H0WHW6_OTOGA      EDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANI---------------------
CLU_MOUSE         EDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANI---------------------
CLU_XENTR         EQHEKTRESSEYLKYLTQQAVALQRTMNEIYKNGSNANI---------------------
H3BFU0_LATCH      EQHEKTKESSEYLKYLTQQAVALQRTMNEIYKNGSNANI---------------------
CLU_DANRE         EAHEKTKESSEYLKYLTQQAVALQRTMNEIYKNGSNASI---------------------
C3Z652_BRAFL      EQHEKTKDSSECLKHLTQQAVVLQRTMNEIYKSGSQATI---------------------
CLU_AEDAE         ETHEKTQESSECLRHLTQQAVVLQKKMNDIYSNGK-LTSGL-------------------
CLU_ANOGA         ENHEKTQESSECLRHLTQQAVVLQKKMN--YANGKLLSTGL-------------------
E9GHX8_DAPPU      EEHEKTKESSECLRHLTQQAVVLQKKMNELYQGRLGAGVPTTGL----------------
E0VTU9_PEDHC      EDHEKTKESSDCLRHLTHQAVVLQKKMNEIYTGKVGA-----------------------
CLU_DROME         ENHEKTRDSAECLRLLTQQAVLLQRKMNDIYSSGKLTSD---------------------
CLU_DROPS         EKHEKTRDSAECLRLLTQQAVLLQRKMNDIYSNGKLTSD---------------------
F6RE09_XENTR      DFHEHTKESSAFLKHVTQQAVNLQRTMNEIYKNGSVTTL---------------------
CLU_CAEBR         KNHQRVKDSGEYLRTLTQQAVTFQKKMLNPD--NNTNINEL-------------------
CLU_CAEEL         PNHPRVNESSEYLRTLTQQAVTFQKKMLKLD--NSTNITEL-------------------
CLU_BRUMA         IDHEKTKESSDCLKHLTQQAVTFQKRINEANRQGSNNIGQL-------------------
CLU_DICDI         EAHPRTKESLEFYTGLSQTANQIKLFKQHQA-----------------------------
D3B1P9_POLPP      ANHPRTIESM--------------------------------------------------
CLU_ARATH         DDDSRTRDSLNWMKTFKMRELQMTAQKQKGQ--AANAANTQKAIDLLKAHPDLIHAFQNA
D7T2X0_VITVI      EEDSRTRDSQNWMKTFKMREIQLNAQKQKGQ--ALNAASAQKAIDILKSNPDLMHAFQAA
C5XZV7_SORBI      ENDSRTKDSENWLSTFKLREEQVNAQKQKGQ--GANASD--NAVKFLKANPAFLQAMKAA
A9RLF4_PHYPA      EEDSRTKDSANWMKTFQIRDIQAHAQKQKGKEAISAAAAQKAAADALKARPDLVQAFQQA
D0P366_PHYIT      HEDPRVIESAKFMAKFTERAVEGAKGRREVD-----------------------------
H3GWU1_PHYRM      EEDPRVIDSAKFMAAFTEKAVEGAKGRREGD-----------------------------
A0E685_PARTE      PEDTRVKEADALLANLKKALNEKRKDTQQSNLDSRRQFGTN-------------------
Q6BG47_PARTE      PEDTRVKEADALLANLKKALNEKRKDTQQSNLDSRRQFGTN-------------------
CLU_ASHGO         VNHKTTVECNSWITGVENLIES--------------------------------------
CLU_KLULA         LNDQTTLTSKQWSETIKGIITK--------------------------------------
CLU_YEAST         MNHTHSAQSRQWVNGLSSLIMD--------------------------------------
CLU_VANPO         TNHQITAQSRQWVNGLSNLMKD--------------------------------------
CLU_CANAL         PDDSMTKQVAKYVSSVGLYVEYLKRQQQQQQQ-----ETQKK------------------
CLU_LODEL         PDDSMTDQTSKYISNVAMYIEYLKARQAQSKKSPPPTQTVAP------------------
CLU_DEBHA         PDDQLSKKSLSFVTNISTYLAYNEHQKS--------EQKKAL------------------
CLU_PICST         PDDALTKQASKYVSSIETYV-------------------KEL------------------
CLU_PICGU         PNDRLTKDCSNYVANLKTYI--------------------AY------------------
CLU_EMENI         PEDRNTKEAETWLEQLTQNAVSIAKHAKDIQA----RRLRR-------------------
CLU_ASPFU         PNDRNTKEAETWLEQLTQNAVSIAKHAKDIQA----RRLRR-------------------
C0NW18_AJECG      PNDRNTKEAESWLEQLTQNAVSIAKHAKDIQA----RRLRR-------------------
CLU_SCLS1         AEDKNTKEAEKWLEQLTQNAVSIAKHAKDVQA----RRNRAG------------------
CLU_PHANO         AEDRNTKEAESWLEQLTQSAVSQAKQLNDLAK----GRIRR-------------------
C7YZ61_NECH7      PEDKNTKEAESWLEQLTQNAVSIAKHAKDVAA----RRLRSG------------------
CLU_NEUCR         PEDKNTKEAEHWLTQLTHNAVSVAKATKELQA----RRAKGS------------------
D5G8Q8_TUBMM      PNDRNTKEAESWLDQLTQNAVILAKQAKDIQE----RKKRG-------------------
CLU_SCHPO         PDHQNTKEAEHWLSEFTALAVNQERQSRT-------------------------------
CLU_MALGO         SEDPLTKESQALLSGLAATAVRAAKQQHAREL----------------------------
CLU_USTMA         KDDAQTKESEAFCSSLAASAVRVAKLEKEASE----------------------------
CLU_YARLI         EDDQNTKDCAVWLKSLTQAAVSIQRQKLWEQE----------------------------
CLU_CRYNJ         EEHNQTKEEAKNVELLTAVIENQERQKEREEAVKKEATERLKMARERIGGGAASTSR---
E3K6B8_PUCGT      LAANNLRRVSSWLNVL--------------------------------------------
                                                                              

G1LLQ3_AILME      ------------PPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEVARRQQLQE
G1PQX9_MYOLU      ------------PPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEVARRHQLQE
CLU_HUMAN         ------------PPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEVARRHQLQE
H0WHW6_OTOGA      ------------PPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEVARRHQLQE
CLU_MOUSE         ------------PPLKFTAPSMTSVLEQLNVINGILFIPLSQKDLENLKAEVARRHQLQE
CLU_XENTR         ------------MPLKFTAPSMTSVLEQLNIINGILFIPLSQKDLEHLKAEVQRRQQLQE
H3BFU0_LATCH      ------------MPLKFTAPNMASVLEQLNIINGILFIPLSQKDLENLKAEVQRRHQLQE
CLU_DANRE         ------------MPLKFTAPSMASVLEQLNIINGIIFIPLSQKDLENLKAEVQRRQLMQD
C3Z652_BRAFL      ------------PPLQISPPSASSVLELINIINGIVFLPLR-------------------
CLU_AEDAE         ------------PPIHIQPPSMGSVLDMLNAINGIIFVQISSKEIANLKNEIEKRQKEGG
CLU_ANOGA         ------------PPIHIQPPSMGSVLDMLNAINGIIFVQISSKEIANFKNEIEKRQKEAG
E9GHX8_DAPPU      ----------PLPPIQIQPPSMGSVLDMLNVINGILFVQISPQDIEAFREEMERRQMTEG
E0VTU9_PEDHC      ----------TLPPIQIQPPSMGSVLDMLNVINGILFVQISQKDIENFKAEIEKRQNKEN
CLU_DROME         -----------LPPIHITPPSMGSVLDMLNTINGILFVKISRKDIVKVRSEIEKHFKTDS
CLU_DROPS         -----------LPPIHITPPSMGSVLEMLNTINGILFVQISQRDIVKVRSEIEKRMKANT
F6RE09_XENTR      ------------PHVQIVSPGIDTLLQQLNIINGIIRINTDLASGSLEQEAAPQEEQKEQ
CLU_CAEBR         ------------FQIQ--PPPISALFDILNIINGIMIIGIPGLSNLAAL-----------
CLU_CAEEL         ------------FQAQ--PPTVTSLFDTLNIINGILIIGVPGLSSLG-------------
CLU_BRUMA         ------------LPVEIHRPSLHSVLEVLNILNGIIFIQLKGISTSSDIGEENYELGNNN
CLU_DICDI         ------------------------------LKAEQDELARLQKEKADQFKKSQPRVSAMP
D3B1P9_POLPP      ---------------------------------------RLTALWVDEMKK---------
CLU_ARATH         AATG--------RTNALNSAVLGETQPRGRGFDERAARAAAEVRKKAAAKGLLVRPQGGV
D7T2X0_VITVI      AAAGGSGSSGASASKSLNAAVIGDAVPRGRGIDERAARAAAEVRKKAAARGLLIRPHG-V
C5XZV7_SORBI      AIQSGDGS--ANVNRSLNAAVVGEGVPRLRGVDERAARATAEARKKAAARGLNVRNGP-A
A9RLF4_PHYPA      AASSTANR------GSMGSSPPNLARARG-APDERAARAVNEVRKKAAARGLNVRPQATA
D0P366_PHYIT      ------------------------------------AAEAADAIANELLGELELKTQS--
H3GWU1_PHYRM      ------------------------------------AAAAADAIANELLGELEFKTEA--
A0E685_PARTE      ------------------RNQQLKTEQQTQQISEETYIESDKEREALLQKLRAAKQSMKF
Q6BG47_PARTE      ------------------RNQQLKTEQQTQQISEETYVETDKEREALLQKLRAAKQSMKF
CLU_ASHGO         ----------------TSQSKALAASKAAAA----AKQGEKKPAQKQQQS-AELRDKSID
CLU_KLULA         ----------------QQQEKKLASAQQATK----PANISQKKGKKSSSSSPALTNKSVD
CLU_YEAST         ----------------LKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVD
CLU_VANPO         ----------------AQQKKKLAAEQASVN----SGSRKKNVNQKADAPKAELAEKSVD
CLU_CANAL         --------------SKTKTKAAPVNNIATTSTSTTKNGKKSKKNNTPPQSNPEIANQSID
CLU_LODEL         --------------NARVSASQASAKVANGNGTGSSKSKKGKKDKSTPQSDPQIANQSVE
CLU_DEBHA         --------------AQQASAS-NGKVKAKSAVEQQLKSSKKGKKNDATQPNPEIASKSVD
CLU_PICST         --------------AQQAVASGNSKIKVKSQTETVKNGKKNGKKSAIPQPDPEIASKSID
CLU_PICGU         --------------MKQQAKDKNKPKKVKAPPVPPQATTKKSK-NKSKMAQTQISKLHLN
CLU_EMENI         --------------INMGTR-TTLGTQI----QPQVGQSTADVSAPSQASNSSIDSRNID
CLU_ASPFU         --------------INMNPRVTTLGTKV----QPQVGQTAPEASGAKGAANASMDSRSID
C0NW18_AJECG      --------------TNLSPR-MTMGTKP----QPQVGQNAPATTNGATSKSIGLDSRSID
CLU_SCLS1         --------------IRVSPRVTLGQTQL----QPQVGQTAEAAAGRDSRSSRGLDSRSID
CLU_PHANO         --------------IQLTGRNPLRPAAA----TPSVSDAAAAAGG-QRTGTGRVDQRKIE
C7YZ61_NECH7      --------------IRFNAT-------------ASQAQAQNAAAPGRPGPGAQVDSRSID
CLU_NEUCR         --------------LGFSP---------------RNATAGAAGIGSVVPSAVGVDNRNID
D5G8Q8_TUBMM      --------------FPMTPHVTMSTRPQPQVGQGSVAPHGVAGSATSASGLGRMDPRSID
CLU_SCHPO         ------------------------------------------------------------
CLU_MALGO         -------------VQTRMPSSARSTRSSAHHHHHRHLHQQQQNSSSSPHPIPALANRSID
CLU_USTMA         -------------RQARLPASRRGNSNAGGGAAAITGAGTTASGN-------GTANKSLD
CLU_YARLI         --------------------------------QGRLARQAPKPTATHQKEAPKKASKKTK
CLU_CRYNJ         ----------PTGIRRLGGAGAGALPQGVRVVDPQTLAALAAAAGQGGNPSANAAAATAG
E3K6B8_PUCGT      ------------------------------------------------------------
                                                                              

G1LLQ3_AILME      ---ASRNREKAEE-PMATEPEP--AGAPEDSASQPQAAKDPSSPSLQG------------
G1PQX9_MYOLU      ---ASRNRDKAEE-PMATEPEP--AGAPEDAASQPQAAKDPPSPSLQG------------
CLU_HUMAN         ---ASRNRDRAEE-PMATEPAP--AGAPGDLGSQPPAAKDPS-PSVQG------------
H0WHW6_OTOGA      ---ASKNRDKAEE-PMATESEP--AGAPEDMGCQPQAAKDTSSPSLQG------------
CLU_MOUSE         ---ANRNRDKAEEQPMAPEPEPEPERAVEDMGSPQTAKEGPSSLNLQG------------
CLU_XENTR         ---AIKG---AEN-HEAKTKEPEMSETSDSNINAASVAPESSD-----------------
H3BFU0_LATCH      ---AAKS---SEQEMQERDTEIDLEAVNEETRSTEGTTVQASA-----------------
CLU_DANRE         ---SGKI---QEQ--QGSHLELDDKLPVDD------------------------------
C3Z652_BRAFL      ------------------------------------------------------------
CLU_AEDAE         ----TSEQ---AAAAQASQEEVDRMLTETMAKTAAGIPFEDHDKHELPVAAEASSSKQAD
CLU_ANOGA         ----AQSQQPGGGPVQANQEEVDQMLMETMQKTAAGIPFEEQDGEKKDGAAEAASHTAGG
E9GHX8_DAPPU      ----SPPK-----LLEVKEEEASSTDNSSQVKSCS-------------------------
E0VTU9_PEDHC      ----SPLS-----IVDDKKNESGEMDDNKSR-----------------------------
CLU_DROME         TENEVNDAINSIVAAANNNGEAEDAVSKDIK-EQPEAGKQLTNGDKAAATEATSS-----
CLU_DROPS         ---DVNEAIKSMVAAANNNGESEVLAPQDNNKEQAATAQQLTNGDKVAVSS---------
F6RE09_XENTR      -------------IDEQKAGTKENQGNPEEPKEQEETS----------------------
CLU_CAEBR         --------------EKEQIGTAEESKATDVAAQLDNETLD--------------------
CLU_CAEEL         ---------------KQQNGTTEESKTTDVAAQLDNETLD--------------------
CLU_BRUMA         NNNNKRKKKAVEDLAVKKNGNNDDTTVISSRPQVNNMSGSSTVQVMQEVALD--------
CLU_DICDI         PSLENGSVSELLNYINGKPKKSQSKKSKSTNTTTTTNTTTATTSKSKITMAKTPNPTTKA
D3B1P9_POLPP      -------------------EKESEKKSKSTSNQ---------------------QQQLKQ
CLU_ARATH         PVQAMPPLSQLQNMINTATVSSEKGGENGEAKVQEKKESSEN-------------GK---
D7T2X0_VITVI      PVQAFPPLTQLLNIINSGMTPDAVDNDEAEAAKKEANGHQGNEPADSKNEPPPKSGKEPA
C5XZV7_SORBI      ANHASDELAQILKLINAASGSSTSASAKTEESASEGQATNGSVQNGTATEAIAVDTNGPS
A9RLF4_PHYPA      PNQSIPPLGDLLSLINSGVAGKAPLATSSTPSSSTSKGTTKAAQAARPESSGRKSTSTPA
D0P366_PHYIT      ---------------NQDAGSPPAAKKKIRKSKNGGKKH---------------------
H3GWU1_PHYRM      ---------------DQQAGSPPAAKKKTRKTKSGSKKH---------------------
A0E685_PARTE      K-------------NKNQMDINRYILAQQLYRQQQQQQKE--------------------
Q6BG47_PARTE      K-------------NKNQMDINRYILAQQLYRQQQQQQKE--------------------
CLU_ASHGO         ELMNFING-------GSAPAKKSK---KKKNAKK--------------------------
CLU_KLULA         ELLQFIEGP------GASKSSKKS---KKKHTKN--------------------------
CLU_YEAST         ELLTFIEGD------SSNSKSKNKTNNKKKHGKK--------------------------
CLU_VANPO         ELLDFIEGG------STE-KSKKKSSKKK--GKK--------------------------
CLU_CANAL         EILRFIEGK------PSGSKKSNKKK----------------------------------
CLU_LODEL         DILKFIEGK------SKPNAKSKSKHTKA-------------------------------
CLU_DEBHA         DILQYIEGK------NPKKQLKKKSNNKKSKK----------------------------
CLU_PICST         DILQFIEGN------NPKKSSKK---SKKSKK----------------------------
CLU_PICGU         SSTRFSSSS------RVKPRLKKK------------------------------------
CLU_EMENI         ELLKFIEGG-DTSSSRTKQKKRAAASNPKLRGSKKSSA----------------------
CLU_ASPFU         ELLKFIEGG-DATSSRSKQKKRAAASNPKLRGSKKSSA----------------------
C0NW18_AJECG      ELLKFIEGGGESRSPRSKQKKRAAASNPKLRGSKQSTVQTA-------------------
CLU_SCLS1         ELLKFIEGS----DQANKNKKRPGRSNPKRRGGAAAAAGK--------------------
CLU_PHANO         DLLKYIEGE----SSKTPTKKRTQ--NPRKRTQKP-------------------------
C7YZ61_NECH7      ELIKFIEGG---EQGAKGSKKRPSRGNPKRRGQAGAR-----------------------
CLU_NEUCR         ELVKFVENS---EK-KKGGKKSKGPSNPKKRGGKA-------------------------
D5G8Q8_TUBMM      ELMKFIEGS----SEPVAPKKKPTRTNPKRRGGAAGPGPKK-------------------
CLU_SCHPO         ------------------------------------------------------------
CLU_MALGO         DLVEYIQGT------PGTGSSRAARKRAARAKRS--------------------------
CLU_USTMA         EIVRFIQG--------GSNGSVAKAKGKSKASRK--------------------------
CLU_YARLI         G-------------KGKGKDDKGEKLVAELKKKKAGKR----------------------
CLU_CRYNJ         QGEQANGESTGTPQIGERGTESLEELVRYIQGSAPGVGGSAKRGKNALRGKRRTGAKR--
E3K6B8_PUCGT      ------------------------------------------------------------
                                                                              

G1LLQ3_AILME      --------------------------------------------------------
G1PQX9_MYOLU      --------------------------------------------------------
CLU_HUMAN         --------------------------------------------------------
H0WHW6_OTOGA      --------------------------------------------------------
CLU_MOUSE         --------------------------------------------------------
CLU_XENTR         --------------------------------------------------------
H3BFU0_LATCH      --------------------------------------------------------
CLU_DANRE         --------------------------------------------------------
C3Z652_BRAFL      --------------------------------------------------------
CLU_AEDAE         NSSNASAQQVS---------------------------------------------
CLU_ANOGA         AAANTAAPAVSPRRKS----------------------------------------
E9GHX8_DAPPU      --------------------------------------------------------
E0VTU9_PEDHC      --------------------------------------------------------
CLU_DROME         --------------------------------------------------------
CLU_DROPS         --------------------------------------------------------
F6RE09_XENTR      --------------------------------------------------------
CLU_CAEBR         --------------------------------------------------------
CLU_CAEEL         --------------------------------------------------------
CLU_BRUMA         --------------------------------------------------------
CLU_DICDI         TTSKSS---------------ATASSAATNKSTTKTNPTSSSAADSSKPNKKSSKN
D3B1P9_POLPP      NKQQLN---------------NMKLNNMSNVPKDLEGQVKWFNQDDSKKGKKK---
CLU_ARATH         --------------------------TENLAPAGLGAGLTSLDKKKQKAKK-----
D7T2X0_VITVI      DAKSEQ----------------PKSGKDDQAPVGLGKGLASLDGKKQKTKPKVAA-
C5XZV7_SORBI      ----------------------ASAKSTVNTPVGLG---TTLELKKQKSKQKS---
A9RLF4_PHYPA      TAAPARPGPVSAVGNGPVQAALSAADLQAPSPVGLGSG-LSLDAKKKKSKSKNAA-
D0P366_PHYIT      --------------------------------------------------------
H3GWU1_PHYRM      --------------------------------------------------------
A0E685_PARTE      --------------------------------------------------------
Q6BG47_PARTE      --------------------------------------------------------
CLU_ASHGO         --------------------------------------------------------
CLU_KLULA         --------------------------------------------------------
CLU_YEAST         --------------------------------------------------------
CLU_VANPO         --------------------------------------------------------
CLU_CANAL         --------------------------------------------------------
CLU_LODEL         --------------------------------------------------------
CLU_DEBHA         --------------------------------------------------------
CLU_PICST         --------------------------------------------------------
CLU_PICGU         --------------------------------------------------------
CLU_EMENI         --------------------------------------------------------
CLU_ASPFU         --------------------------------------------------------
C0NW18_AJECG      --------------------------------------------------------
CLU_SCLS1         --------------------------------------------------------
CLU_PHANO         --------------------------------------------------------
C7YZ61_NECH7      --------------------------------------------------------
CLU_NEUCR         --------------------------------------------------------
D5G8Q8_TUBMM      --------------------------------------------------------
CLU_SCHPO         --------------------------------------------------------
CLU_MALGO         --------------------------------------------------------
CLU_USTMA         --------------------------------------------------------
CLU_YARLI         --------------------------------------------------------
CLU_CRYNJ         --------------------------------------------------------
E3K6B8_PUCGT      --------------------------------------------------------